NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|23498129|emb|CAD49096|]
View 

erythrocyte membrane protein 1, PfEMP1 [Plasmodium falciparum 3D7]

Protein Classification

NTS and ATS domain-containing protein (domain architecture ID 13267887)

protein containing domains NTS, PFEMP, and ATS

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ATS pfam15445
acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and ...
3018-3467 0e+00

acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and relatively conserved acidic terminal segment of the Plasmodium falciparum erythrocyte membrane protein-1 (PfEMP1). this domain appears to be present in all variants of the highly polymorphic PfEMP1 proteins.


:

Pssm-ID: 317799  Cd Length: 446  Bit Score: 779.37  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3018 TIPFGIALALTSIALLFLKKKPKSPV-DLIRVLDVHKGDYGMPTLESKNRYIPYRSGTYKGKTYIYMEGDTSGDDdKYMF 3096
Cdd:pfam15445    1 TIPWSVGIAFAAFTYFFLKKKTKSSVgNLFQILQIPKGDYDIPTLKSKNRYIPYASDRYKGKTYIYMEGDSSGDE-KYAF 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3097 LSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKSNGNTPSkGDGNTLGDDMIPTTNTFTDEEWNELKHDFI 3176
Cdd:pfam15445   80 MSDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKNNTNTPS-DTQNDIPSDDIPSTNPITDEEWNTLKHDFI 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3177 SQYIQSRlPMDVPQYDVSTELPMNITEVNVLDVGINEKPFITSIHDRDLYSGEEINYNINMSTNTNNDIPKYVSNNVYSG 3256
Cdd:pfam15445  159 SNMLQNT-QNDEPNILRSGNVPNNTHPNTLSRDNMEEKPFIMSIHDRNLYSGEEYSYNINMSTNSMDDIPKYVSNNVYSG 237
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3257 IDLINDTLSGNKHIDIYDEVLKRKENELFGTNHTKNTSNNSVAKNTNSDSIMNQLDLLHKWLDRRRNMCEKWEkhNKEEL 3336
Cdd:pfam15445  238 IDLINDTLSGNQHIDIYDEVLKRKENELFGTNHTKHTSTNSVAKNTNSDPILNQLNLFHKWLDRHRDMCEKWK--NKEER 315
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3337 LDKLNEQWNKDNDGI-------NVPSDNRSLNTDVSIQIDMDENKGKKEFSNMDTNVDTPTMDNILDDLETCNEPFYDIY 3409
Cdd:pfam15445  316 LDKLKEEWNKENNHSgdihpsdDIPSDNKVLNTDVSIQIDMDNPKPKNEFTNMDTNPDNSTMDTILDDLEKYNEPYYDFY 395
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 23498129   3410 EDDIYYDVNDEnpsvDDIPMDHNKVDVPKKVHVEMKIlNNTsnGSLEPEFPISDVWNI 3467
Cdd:pfam15445  396 EDDIYYDVNDH----DASTVDSNNMDVPTKVQIEMDV-NNT--KLVEEKYPISDVWNI 446
PTZ00176 super family cl31413
erythrocyte membrane protein 1 (PfEMP1); Provisional
12-418 2.07e-115

erythrocyte membrane protein 1 (PfEMP1); Provisional


The actual alignment was detected with superfamily member PTZ00176:

Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 401.72  E-value: 2.07e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    12 KDVKNESHNSARNVLENIGIEIYNEEKKKVNgYTSQLRGDLSRARFHDGLRKAARLgVIPGPANSCDLDHKFYTNINNGY 91
Cdd:PTZ00176    5 KGVINESKLSARNVLENIGNEIKDKRENESK-YTDKLKGSLWEARFSDGLSSSFGD-VRSGYYDSCSLDHKFHTNINNGY 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    92 PPARNPCDLRNQNRFGENAEAYCNSDKIRVTGKKSAGGACAPFRRQNMCDKNLEYLDNTNTDDTDDLLGNVLVTAKYEGE 171
Cdd:PTZ00176   83 PPARNPCDGRNQNRFDENGESYCNSDKIRGNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGE 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   172 SIVAKHPHKENSEVCTALARSFADIGDIVRGKDMFKRNEEDAVQKGLRAVFKKINDNLKEKEISDY---DNDPNYYKLRE 248
Cdd:PTZ00176  163 SIVNNHPDKDKSSVCTALARSFADIGDIVRGKDMFKRNKHDNVENGLREVFKKIYEGLKNNGAREHykeVKNGNYIKLRE 242
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   249 DWWTANRDQVWRAITCYIPYYVnYFKKTSDDTIVFTN----DGKCGHyEGAPPTnLDYVPQFLRWFDEWAEEFCRIRNHK 324
Cdd:PTZ00176  243 DWWTANRDQVWKAMTCVAPENA-YFRKTEADGIGISSlilpYSKCGR-DTDPPV-VDYIPQRLRWMSEWSEYFCNVLNKE 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   325 LRKIKDACRNDKERLYCSQNgydctkriekgsscSRENKCTGCSNKCVDYDFWLEKQQNEFKIQKDKYdkeIETYVN-KT 403
Cdd:PTZ00176  320 IDEMNNQCKDCEMSRRCNND--------------TEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKY---MELYNKaST 382
                         410
                  ....*....|....*
gi 23498129   404 PISNSNSNTKKEYYK 418
Cdd:PTZ00176  383 NITKQNSSAPERGYR 397
PTZ00176 super family cl31413
erythrocyte membrane protein 1 (PfEMP1); Provisional
743-1534 5.04e-72

erythrocyte membrane protein 1 (PfEMP1); Provisional


The actual alignment was detected with superfamily member PTZ00176:

Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 267.67  E-value: 5.04e-72
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   743 NGGKLVRVKRlaemmqRRARKQLEKRGGEINlKADASQGKYIRGGKEKKLNGQICNIDTSYSNDSRNGNNGG--PCTGKN 820
Cdd:PTZ00176   21 NIGNEIKDKR------ENESKYTDKLKGSLW-EARFSDGLSSSFGDVRSGYYDSCSLDHKFHTNINNGYPPArnPCDGRN 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   821 DKRFKIGTEwSYGEHEKKRTHPEVY-----MPPRREHMCISNLEKLdvvsVIKNGNASHSLLGDVLLAAKYEAKNIkely 895
Cdd:PTZ00176   94 QNRFDENGE-SYCNSDKIRGNENNSnagacAPFRRQNMCDKNLEYL----INKNTENTHDLLGNVLVTAKYEGESI---- 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   896 qQNNSKNgvidqNDKETICRAMKYSFADIGDIIRGKDMWVQNtDATKLQAYLAKIFDKIKDNHKDIKGKLQYN--GDTDH 973
Cdd:PTZ00176  165 -VNNHPD-----KDKSSVCTALARSFADIGDIVRGKDMFKRN-KHDNVENGLREVFKKIYEGLKNNGAREHYKevKNGNY 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   974 KLLREDWWEANRHQVWRAMKC-AIEND--KDMKCNGI------------------PIEDYIPQRLRWMTEWAEWYCKEQS 1032
Cdd:PTZ00176  238 IKLREDWWTANRDQVWKAMTCvAPENAyfRKTEADGIgisslilpyskcgrdtdpPVVDYIPQRLRWMSEWSEYFCNVLN 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1033 RLYGELLEKCQSCKGKQKC---TEGDvDCGKCKAACDKYKDEINKWREQWTKIKGKYKTLYKKATKpGVTTSNNPK---- 1105
Cdd:PTZ00176  318 KEIDEMNNQCKDCEMSRRCnndTEGE-KCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKAST-NITKQNSSAperg 395
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1106 -----------DEKDVVDFLKQLLprkSKNTPGVTAMTpntlyssaagyihQELGKTVGCNTQKEFCDNKKGK---YAFK 1171
Cdd:PTZ00176  396 yrrnhrrrgydDDTNVQLFLKKVI---ENNECKVESLG-------------KYLDKTSHCGNYNFNYDNTPGSnrsNAFE 459
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1172 HPPKEYEEACICdtrqKAQKPIEK------KNDCngikTLLDRsnggtggIDGCNPKI--GNYPSWNCERNESKA-ENKG 1242
Cdd:PTZ00176  460 ITPEKFKKACKC----KIPNPLEKcpneenKNVC----TRFDK-------VYSCTSLSfkNDLSEWNNSGVKNKEnDNNG 524
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1243 ACVPPRREKFCVSLLAKEGiFKNKGE-DIRETFVKSAALETYFAWKRYNDDNKKAEEELKsgtipenfkrqmyYTFADYR 1321
Cdd:PTZ00176  525 VLVPPRRRNLCINLFSKKD-YKMKDEnDFKEDLLNAAFSQGKLLGKKYSNYSNEAYEAMK-------------FSYADYS 590
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1322 DIFFGTDITshDHILDVSKNAKNKLKEKngeQKSVIIIDDEKlladWWKEHGHEIWEGMLCALTheiDEEEKNKIKSTYS 1401
Cdd:PTZ00176  591 DIVKGTDMM--NDLKKLNKELNTLLKET---EKGDISVDRKT----WWDDNKNVVWNAMLCGYK---TENENQQLNSSWC 658
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1402 ydqlkkttngTTPLEKFAErpQFLRWFTEWSDEFCREREKKEEVVEKKCKKDHEGCNKPNTKG--NHGCVSACKDYEEYI 1479
Cdd:PTZ00176  659 ----------NVPDDDNID--QFLRWLTEWAQQYCKEKLIKAHIINTKCKDIVEGRKHKSMVDitDVECKRLFIDYEEWF 726
                         810       820       830       840       850
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 23498129  1480 STKKKQYNTQKEKFDIDKNKGNEEYENYKDKEAHDYLKDKCFPGTCDY--MEKVKNN 1534
Cdd:PTZ00176  727 RYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAASYVTKHCNGCICNLrdMEDIHKN 783
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1616-1795 2.11e-51

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


:

Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 180.21  E-value: 2.11e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   1616 ACMPPRRQKLCVINLQYFKG-----KTTVDLREAFIKCAAVETFFLWHKYKEDNnggedLQNQLesGIIPDDFKRQMFYT 1690
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINStnttsNTTHDLLEAVILAAKYEGFSLWHKYKKYN-----PQYKL--GTIPSEFCRQMAYS 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   1691 FGDYRDFLFGTDISKG-----HGIGSELAKKIDSLFKNIGGKNPGDLS--------RKDWWNENGPYIWKGMLCSLEKAw 1757
Cdd:pfam05424   74 FADIGDIVRGKDLYLGnnkkkKNKREKLEENLKKIFKKIYEKLTSKNKddgnyyqlREDWWEANREDIWKAMTCALTYG- 152
                          170       180       190
                   ....*....|....*....|....*....|....*...
gi 23498129   1758 GKDTIKNKSNYNYhnvKFSDNRNGPDLETFAKRPQFLR 1795
Cdd:pfam05424  153 AKYFRKTCGDGNS---SSTAGCNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
2168-2386 2.48e-41

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


:

Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 151.32  E-value: 2.48e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2168 ICVPPRRRRLYVGKLTQWASQRTQGGTSSQivgktasqpnshptlspssnprddgLRDAFIQSAAVETFFLWDRYKKLNT 2247
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSNTTHD-------------------------LLEAVILAAKYEGFSLWHKYKKYNP 55
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2248 KKPDatlgglpqiplamgaingyvpsgddnnpqkkleeGEIPEEFKRQMFYTLGDYRDILFGKnDIVIGNtgsgasDKEM 2327
Cdd:pfam05424   56 QYKL----------------------------------GTIPSEFCRQMAYSFADIGDIVRGK-DLYLGN------NKKK 94
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2328 KAKEEKIKETIDKVFPNSVSTPPPTPATKPSDEK-RKTWWEANGEHIWKGMIYALTYKDN 2386
Cdd:pfam05424   95 KNKREKLEENLKKIFKKIYEKLTSKNKDDGNYYQlREDWWEANREDIWKAMTCALTYGAK 154
PFEMP super family cl03834
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
581-726 6.08e-18

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


The actual alignment was detected with superfamily member pfam03011:

Pssm-ID: 281064  Cd Length: 154  Bit Score: 83.32  E-value: 6.08e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    581 FHSWAKNLLIDTIRWEHQLKNCINNTNVTDCTSKCIKNCECYEAWIERKKDEWEKLKEVLNKKDETSHNYYNKLKDVFD- 659
Cdd:pfam03011    2 FKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKGLTGKTLDEYLDl 81
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 23498129    660 -----RFLFQVMFALDQDEKGKWDQFTEDLKK-KFGPSVESAGTANSQDAIEFLLDHLKDNALTCRDNNSIKP 726
Cdd:pfam03011   82 ksfleTFLFYIDIKEAYGDVKELKKLEEILDEeGCSAGAESAKNNKNEDAIDKLLDKEEKKANNCKEKHKEND 154
PFEMP super family cl03834
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
2738-2884 2.98e-12

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


The actual alignment was detected with superfamily member pfam03011:

Pssm-ID: 281064  Cd Length: 154  Bit Score: 66.75  E-value: 2.98e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2738 FLEYWLQDFIEGYyiLKKRKIIEQCKENG-GETCNENSKNDCACVKGWVAQKTTEWNQIKDHYNKKEYGNG--YDMSHKV 2814
Cdd:pfam03011    1 LFKRWVEYFLEDS--IKWRKKLKSCINNGkGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKGltGKTLDEY 78
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 23498129   2815 KNYFEKNENELRKWI-----DNYDVLKNNEEYEVCNNGDKNCNFEGKKRKKDMVTLLLSRLQNEIKTCQNPPPSD 2884
Cdd:pfam03011   79 LDLKSFLETFLFYIDikeayGDVKELKKLEEILDEEGCSAGAESAKNNKNEDAIDKLLDKEEKKANNCKEKHKEN 153
 
Name Accession Description Interval E-value
ATS pfam15445
acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and ...
3018-3467 0e+00

acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and relatively conserved acidic terminal segment of the Plasmodium falciparum erythrocyte membrane protein-1 (PfEMP1). this domain appears to be present in all variants of the highly polymorphic PfEMP1 proteins.


Pssm-ID: 317799  Cd Length: 446  Bit Score: 779.37  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3018 TIPFGIALALTSIALLFLKKKPKSPV-DLIRVLDVHKGDYGMPTLESKNRYIPYRSGTYKGKTYIYMEGDTSGDDdKYMF 3096
Cdd:pfam15445    1 TIPWSVGIAFAAFTYFFLKKKTKSSVgNLFQILQIPKGDYDIPTLKSKNRYIPYASDRYKGKTYIYMEGDSSGDE-KYAF 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3097 LSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKSNGNTPSkGDGNTLGDDMIPTTNTFTDEEWNELKHDFI 3176
Cdd:pfam15445   80 MSDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKNNTNTPS-DTQNDIPSDDIPSTNPITDEEWNTLKHDFI 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3177 SQYIQSRlPMDVPQYDVSTELPMNITEVNVLDVGINEKPFITSIHDRDLYSGEEINYNINMSTNTNNDIPKYVSNNVYSG 3256
Cdd:pfam15445  159 SNMLQNT-QNDEPNILRSGNVPNNTHPNTLSRDNMEEKPFIMSIHDRNLYSGEEYSYNINMSTNSMDDIPKYVSNNVYSG 237
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3257 IDLINDTLSGNKHIDIYDEVLKRKENELFGTNHTKNTSNNSVAKNTNSDSIMNQLDLLHKWLDRRRNMCEKWEkhNKEEL 3336
Cdd:pfam15445  238 IDLINDTLSGNQHIDIYDEVLKRKENELFGTNHTKHTSTNSVAKNTNSDPILNQLNLFHKWLDRHRDMCEKWK--NKEER 315
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3337 LDKLNEQWNKDNDGI-------NVPSDNRSLNTDVSIQIDMDENKGKKEFSNMDTNVDTPTMDNILDDLETCNEPFYDIY 3409
Cdd:pfam15445  316 LDKLKEEWNKENNHSgdihpsdDIPSDNKVLNTDVSIQIDMDNPKPKNEFTNMDTNPDNSTMDTILDDLEKYNEPYYDFY 395
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 23498129   3410 EDDIYYDVNDEnpsvDDIPMDHNKVDVPKKVHVEMKIlNNTsnGSLEPEFPISDVWNI 3467
Cdd:pfam15445  396 EDDIYYDVNDH----DASTVDSNNMDVPTKVQIEMDV-NNT--KLVEEKYPISDVWNI 446
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
3019-3467 0e+00

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 627.06  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  3019 IPFGIALALTSIALLF-LKKKPKSPVDLIRVLDVHKGDYGMPTLESKNRYIPYRSGTYKGKTYIYMEGDTsgDDDKYMFL 3097
Cdd:PTZ00176  891 VPAGIGVALTLGLLLFkMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYLYVEGDT--DEEKYMFM 968
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  3098 SDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKSNGNTPSKGDGNTlgddmiptTNTFTDEEWNELKHDFIS 3177
Cdd:PTZ00176  969 SDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTQNDIPSDNTP--------SYKLTDEEWNQLKDDFIS 1040
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  3178 QYIQSRLPMDVPQydvSTELPMNITEVNVLDVGINEKPFITSIHDRDLYSGEEINYNINMSTNTNNDiPKYVSNNVYSGI 3257
Cdd:PTZ00176 1041 QYLPNTEPNNNYR---SGNSPTNTNNTTTSHDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTMDD-PKYVSNNVYSGI 1116
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  3258 DLINDTLSGNKHIDIYDEVLKRKENELFGTNHTKNTSNNSVAKNT-NSDSIMNQLDLLHKWLDRRRNMCEKWEkhNKEEL 3336
Cdd:PTZ00176 1117 DLINDTLSGNQHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLDRHRDMCEKWE--NHHER 1194
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  3337 LDKLNEQWNKDNDGINVPSDNRSLNTDVSIQIDMDENKGKKEFSNMDTNVDTPTMDNIlddletcnepfydiyEDDIYYD 3416
Cdd:PTZ00176 1195 LAKLKEKWENDNDGGNVPSDNHVLNTDVSIEIDMDNPKPINQFSNMDINVDTPTMDNM---------------EDDIYYD 1259
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 23498129  3417 VND-----ENPSVDDIPMDHNK--VDVPKKVHVEMKILNNTSNGSLEPEFPISDVWNI 3467
Cdd:PTZ00176 1260 VNDndddnDQPSVYDIPMDHNKvdVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1317
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
12-418 2.07e-115

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 401.72  E-value: 2.07e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    12 KDVKNESHNSARNVLENIGIEIYNEEKKKVNgYTSQLRGDLSRARFHDGLRKAARLgVIPGPANSCDLDHKFYTNINNGY 91
Cdd:PTZ00176    5 KGVINESKLSARNVLENIGNEIKDKRENESK-YTDKLKGSLWEARFSDGLSSSFGD-VRSGYYDSCSLDHKFHTNINNGY 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    92 PPARNPCDLRNQNRFGENAEAYCNSDKIRVTGKKSAGGACAPFRRQNMCDKNLEYLDNTNTDDTDDLLGNVLVTAKYEGE 171
Cdd:PTZ00176   83 PPARNPCDGRNQNRFDENGESYCNSDKIRGNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGE 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   172 SIVAKHPHKENSEVCTALARSFADIGDIVRGKDMFKRNEEDAVQKGLRAVFKKINDNLKEKEISDY---DNDPNYYKLRE 248
Cdd:PTZ00176  163 SIVNNHPDKDKSSVCTALARSFADIGDIVRGKDMFKRNKHDNVENGLREVFKKIYEGLKNNGAREHykeVKNGNYIKLRE 242
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   249 DWWTANRDQVWRAITCYIPYYVnYFKKTSDDTIVFTN----DGKCGHyEGAPPTnLDYVPQFLRWFDEWAEEFCRIRNHK 324
Cdd:PTZ00176  243 DWWTANRDQVWKAMTCVAPENA-YFRKTEADGIGISSlilpYSKCGR-DTDPPV-VDYIPQRLRWMSEWSEYFCNVLNKE 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   325 LRKIKDACRNDKERLYCSQNgydctkriekgsscSRENKCTGCSNKCVDYDFWLEKQQNEFKIQKDKYdkeIETYVN-KT 403
Cdd:PTZ00176  320 IDEMNNQCKDCEMSRRCNND--------------TEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKY---MELYNKaST 382
                         410
                  ....*....|....*
gi 23498129   404 PISNSNSNTKKEYYK 418
Cdd:PTZ00176  383 NITKQNSSAPERGYR 397
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
743-1534 5.04e-72

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 267.67  E-value: 5.04e-72
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   743 NGGKLVRVKRlaemmqRRARKQLEKRGGEINlKADASQGKYIRGGKEKKLNGQICNIDTSYSNDSRNGNNGG--PCTGKN 820
Cdd:PTZ00176   21 NIGNEIKDKR------ENESKYTDKLKGSLW-EARFSDGLSSSFGDVRSGYYDSCSLDHKFHTNINNGYPPArnPCDGRN 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   821 DKRFKIGTEwSYGEHEKKRTHPEVY-----MPPRREHMCISNLEKLdvvsVIKNGNASHSLLGDVLLAAKYEAKNIkely 895
Cdd:PTZ00176   94 QNRFDENGE-SYCNSDKIRGNENNSnagacAPFRRQNMCDKNLEYL----INKNTENTHDLLGNVLVTAKYEGESI---- 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   896 qQNNSKNgvidqNDKETICRAMKYSFADIGDIIRGKDMWVQNtDATKLQAYLAKIFDKIKDNHKDIKGKLQYN--GDTDH 973
Cdd:PTZ00176  165 -VNNHPD-----KDKSSVCTALARSFADIGDIVRGKDMFKRN-KHDNVENGLREVFKKIYEGLKNNGAREHYKevKNGNY 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   974 KLLREDWWEANRHQVWRAMKC-AIEND--KDMKCNGI------------------PIEDYIPQRLRWMTEWAEWYCKEQS 1032
Cdd:PTZ00176  238 IKLREDWWTANRDQVWKAMTCvAPENAyfRKTEADGIgisslilpyskcgrdtdpPVVDYIPQRLRWMSEWSEYFCNVLN 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1033 RLYGELLEKCQSCKGKQKC---TEGDvDCGKCKAACDKYKDEINKWREQWTKIKGKYKTLYKKATKpGVTTSNNPK---- 1105
Cdd:PTZ00176  318 KEIDEMNNQCKDCEMSRRCnndTEGE-KCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKAST-NITKQNSSAperg 395
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1106 -----------DEKDVVDFLKQLLprkSKNTPGVTAMTpntlyssaagyihQELGKTVGCNTQKEFCDNKKGK---YAFK 1171
Cdd:PTZ00176  396 yrrnhrrrgydDDTNVQLFLKKVI---ENNECKVESLG-------------KYLDKTSHCGNYNFNYDNTPGSnrsNAFE 459
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1172 HPPKEYEEACICdtrqKAQKPIEK------KNDCngikTLLDRsnggtggIDGCNPKI--GNYPSWNCERNESKA-ENKG 1242
Cdd:PTZ00176  460 ITPEKFKKACKC----KIPNPLEKcpneenKNVC----TRFDK-------VYSCTSLSfkNDLSEWNNSGVKNKEnDNNG 524
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1243 ACVPPRREKFCVSLLAKEGiFKNKGE-DIRETFVKSAALETYFAWKRYNDDNKKAEEELKsgtipenfkrqmyYTFADYR 1321
Cdd:PTZ00176  525 VLVPPRRRNLCINLFSKKD-YKMKDEnDFKEDLLNAAFSQGKLLGKKYSNYSNEAYEAMK-------------FSYADYS 590
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1322 DIFFGTDITshDHILDVSKNAKNKLKEKngeQKSVIIIDDEKlladWWKEHGHEIWEGMLCALTheiDEEEKNKIKSTYS 1401
Cdd:PTZ00176  591 DIVKGTDMM--NDLKKLNKELNTLLKET---EKGDISVDRKT----WWDDNKNVVWNAMLCGYK---TENENQQLNSSWC 658
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1402 ydqlkkttngTTPLEKFAErpQFLRWFTEWSDEFCREREKKEEVVEKKCKKDHEGCNKPNTKG--NHGCVSACKDYEEYI 1479
Cdd:PTZ00176  659 ----------NVPDDDNID--QFLRWLTEWAQQYCKEKLIKAHIINTKCKDIVEGRKHKSMVDitDVECKRLFIDYEEWF 726
                         810       820       830       840       850
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 23498129  1480 STKKKQYNTQKEKFDIDKNKGNEEYENYKDKEAHDYLKDKCFPGTCDY--MEKVKNN 1534
Cdd:PTZ00176  727 RYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAASYVTKHCNGCICNLrdMEDIHKN 783
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
130-308 2.18e-62

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 211.80  E-value: 2.18e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    130 ACAPFRRQNMCDKNLEYLDNTNTDDTDDLL--GNVLVTAKYEGESIVAKHPHKE--------NSEVCTALARSFADIGDI 199
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSNTTHDllEAVILAAKYEGFSLWHKYKKYNpqyklgtiPSEFCRQMAYSFADIGDI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    200 VRGKDMF------KRNEEDAVQKGLRAVFKKINDNLKEKEisdyDNDPNYYKLREDWWTANRDQVWRAITCYIPYYVNYF 273
Cdd:pfam05424   81 VRGKDLYlgnnkkKKNKREKLEENLKKIFKKIYEKLTSKN----KDDGNYYQLREDWWEANREDIWKAMTCALTYGAKYF 156
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 23498129    274 KKTSDDTIVFTNDGKcghyEGAPPTNLDYVPQFLR 308
Cdd:pfam05424  157 RKTCGDGNSSSTAGC----NDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1616-1795 2.11e-51

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 180.21  E-value: 2.11e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   1616 ACMPPRRQKLCVINLQYFKG-----KTTVDLREAFIKCAAVETFFLWHKYKEDNnggedLQNQLesGIIPDDFKRQMFYT 1690
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINStnttsNTTHDLLEAVILAAKYEGFSLWHKYKKYN-----PQYKL--GTIPSEFCRQMAYS 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   1691 FGDYRDFLFGTDISKG-----HGIGSELAKKIDSLFKNIGGKNPGDLS--------RKDWWNENGPYIWKGMLCSLEKAw 1757
Cdd:pfam05424   74 FADIGDIVRGKDLYLGnnkkkKNKREKLEENLKKIFKKIYEKLTSKNKddgnyyqlREDWWEANREDIWKAMTCALTYG- 152
                          170       180       190
                   ....*....|....*....|....*....|....*...
gi 23498129   1758 GKDTIKNKSNYNYhnvKFSDNRNGPDLETFAKRPQFLR 1795
Cdd:pfam05424  153 AKYFRKTCGDGNS---SSTAGCNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
844-1018 3.96e-51

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 179.44  E-value: 3.96e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    844 VYMPPRREHMCISNLEKLDVVSVIKNgnASHSLLGDVLLAAKYEAKNIKELYQQNNSKNGviDQNDKETICRAMKYSFAD 923
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSN--TTHDLLEAVILAAKYEGFSLWHKYKKYNPQYK--LGTIPSEFCRQMAYSFAD 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    924 IGDIIRGKDMWVQN-----TDATKLQAYLAKIFDKIKDNHKDIKGKlqyngDTDHKLLREDWWEANRHQVWRAMKCAIEN 998
Cdd:pfam05424   77 IGDIVRGKDLYLGNnkkkkNKREKLEENLKKIFKKIYEKLTSKNKD-----DGNYYQLREDWWEANREDIWKAMTCALTY 151
                          170       180       190
                   ....*....|....*....|....*....|....*.
gi 23498129    999 DKD--------------MKCNGIPIE--DYIPQRLR 1018
Cdd:pfam05424  152 GAKyfrktcgdgnssstAGCNDDVPTyfDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
2168-2386 2.48e-41

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 151.32  E-value: 2.48e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2168 ICVPPRRRRLYVGKLTQWASQRTQGGTSSQivgktasqpnshptlspssnprddgLRDAFIQSAAVETFFLWDRYKKLNT 2247
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSNTTHD-------------------------LLEAVILAAKYEGFSLWHKYKKYNP 55
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2248 KKPDatlgglpqiplamgaingyvpsgddnnpqkkleeGEIPEEFKRQMFYTLGDYRDILFGKnDIVIGNtgsgasDKEM 2327
Cdd:pfam05424   56 QYKL----------------------------------GTIPSEFCRQMAYSFADIGDIVRGK-DLYLGN------NKKK 94
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2328 KAKEEKIKETIDKVFPNSVSTPPPTPATKPSDEK-RKTWWEANGEHIWKGMIYALTYKDN 2386
Cdd:pfam05424   95 KNKREKLEENLKKIFKKIYEKLTSKNKDDGNYYQlREDWWEANREDIWKAMTCALTYGAK 154
PFEMP pfam03011
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
581-726 6.08e-18

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


Pssm-ID: 281064  Cd Length: 154  Bit Score: 83.32  E-value: 6.08e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    581 FHSWAKNLLIDTIRWEHQLKNCINNTNVTDCTSKCIKNCECYEAWIERKKDEWEKLKEVLNKKDETSHNYYNKLKDVFD- 659
Cdd:pfam03011    2 FKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKGLTGKTLDEYLDl 81
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 23498129    660 -----RFLFQVMFALDQDEKGKWDQFTEDLKK-KFGPSVESAGTANSQDAIEFLLDHLKDNALTCRDNNSIKP 726
Cdd:pfam03011   82 ksfleTFLFYIDIKEAYGDVKELKKLEEILDEeGCSAGAESAKNNKNEDAIDKLLDKEEKKANNCKEKHKEND 154
PFEMP pfam03011
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
2738-2884 2.98e-12

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


Pssm-ID: 281064  Cd Length: 154  Bit Score: 66.75  E-value: 2.98e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2738 FLEYWLQDFIEGYyiLKKRKIIEQCKENG-GETCNENSKNDCACVKGWVAQKTTEWNQIKDHYNKKEYGNG--YDMSHKV 2814
Cdd:pfam03011    1 LFKRWVEYFLEDS--IKWRKKLKSCINNGkGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKGltGKTLDEY 78
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 23498129   2815 KNYFEKNENELRKWI-----DNYDVLKNNEEYEVCNNGDKNCNFEGKKRKKDMVTLLLSRLQNEIKTCQNPPPSD 2884
Cdd:pfam03011   79 LDLKSFLETFLFYIDikeayGDVKELKKLEEILDEEGCSAGAESAKNNKNEDAIDKLLDKEEKKANNCKEKHKEN 153
 
Name Accession Description Interval E-value
ATS pfam15445
acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and ...
3018-3467 0e+00

acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and relatively conserved acidic terminal segment of the Plasmodium falciparum erythrocyte membrane protein-1 (PfEMP1). this domain appears to be present in all variants of the highly polymorphic PfEMP1 proteins.


Pssm-ID: 317799  Cd Length: 446  Bit Score: 779.37  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3018 TIPFGIALALTSIALLFLKKKPKSPV-DLIRVLDVHKGDYGMPTLESKNRYIPYRSGTYKGKTYIYMEGDTSGDDdKYMF 3096
Cdd:pfam15445    1 TIPWSVGIAFAAFTYFFLKKKTKSSVgNLFQILQIPKGDYDIPTLKSKNRYIPYASDRYKGKTYIYMEGDSSGDE-KYAF 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3097 LSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKSNGNTPSkGDGNTLGDDMIPTTNTFTDEEWNELKHDFI 3176
Cdd:pfam15445   80 MSDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKNNTNTPS-DTQNDIPSDDIPSTNPITDEEWNTLKHDFI 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3177 SQYIQSRlPMDVPQYDVSTELPMNITEVNVLDVGINEKPFITSIHDRDLYSGEEINYNINMSTNTNNDIPKYVSNNVYSG 3256
Cdd:pfam15445  159 SNMLQNT-QNDEPNILRSGNVPNNTHPNTLSRDNMEEKPFIMSIHDRNLYSGEEYSYNINMSTNSMDDIPKYVSNNVYSG 237
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3257 IDLINDTLSGNKHIDIYDEVLKRKENELFGTNHTKNTSNNSVAKNTNSDSIMNQLDLLHKWLDRRRNMCEKWEkhNKEEL 3336
Cdd:pfam15445  238 IDLINDTLSGNQHIDIYDEVLKRKENELFGTNHTKHTSTNSVAKNTNSDPILNQLNLFHKWLDRHRDMCEKWK--NKEER 315
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   3337 LDKLNEQWNKDNDGI-------NVPSDNRSLNTDVSIQIDMDENKGKKEFSNMDTNVDTPTMDNILDDLETCNEPFYDIY 3409
Cdd:pfam15445  316 LDKLKEEWNKENNHSgdihpsdDIPSDNKVLNTDVSIQIDMDNPKPKNEFTNMDTNPDNSTMDTILDDLEKYNEPYYDFY 395
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 23498129   3410 EDDIYYDVNDEnpsvDDIPMDHNKVDVPKKVHVEMKIlNNTsnGSLEPEFPISDVWNI 3467
Cdd:pfam15445  396 EDDIYYDVNDH----DASTVDSNNMDVPTKVQIEMDV-NNT--KLVEEKYPISDVWNI 446
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
3019-3467 0e+00

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 627.06  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  3019 IPFGIALALTSIALLF-LKKKPKSPVDLIRVLDVHKGDYGMPTLESKNRYIPYRSGTYKGKTYIYMEGDTsgDDDKYMFL 3097
Cdd:PTZ00176  891 VPAGIGVALTLGLLLFkMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYLYVEGDT--DEEKYMFM 968
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  3098 SDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKSNGNTPSKGDGNTlgddmiptTNTFTDEEWNELKHDFIS 3177
Cdd:PTZ00176  969 SDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTQNDIPSDNTP--------SYKLTDEEWNQLKDDFIS 1040
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  3178 QYIQSRLPMDVPQydvSTELPMNITEVNVLDVGINEKPFITSIHDRDLYSGEEINYNINMSTNTNNDiPKYVSNNVYSGI 3257
Cdd:PTZ00176 1041 QYLPNTEPNNNYR---SGNSPTNTNNTTTSHDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTMDD-PKYVSNNVYSGI 1116
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  3258 DLINDTLSGNKHIDIYDEVLKRKENELFGTNHTKNTSNNSVAKNT-NSDSIMNQLDLLHKWLDRRRNMCEKWEkhNKEEL 3336
Cdd:PTZ00176 1117 DLINDTLSGNQHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLDRHRDMCEKWE--NHHER 1194
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  3337 LDKLNEQWNKDNDGINVPSDNRSLNTDVSIQIDMDENKGKKEFSNMDTNVDTPTMDNIlddletcnepfydiyEDDIYYD 3416
Cdd:PTZ00176 1195 LAKLKEKWENDNDGGNVPSDNHVLNTDVSIEIDMDNPKPINQFSNMDINVDTPTMDNM---------------EDDIYYD 1259
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 23498129  3417 VND-----ENPSVDDIPMDHNK--VDVPKKVHVEMKILNNTSNGSLEPEFPISDVWNI 3467
Cdd:PTZ00176 1260 VNDndddnDQPSVYDIPMDHNKvdVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1317
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
12-418 2.07e-115

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 401.72  E-value: 2.07e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    12 KDVKNESHNSARNVLENIGIEIYNEEKKKVNgYTSQLRGDLSRARFHDGLRKAARLgVIPGPANSCDLDHKFYTNINNGY 91
Cdd:PTZ00176    5 KGVINESKLSARNVLENIGNEIKDKRENESK-YTDKLKGSLWEARFSDGLSSSFGD-VRSGYYDSCSLDHKFHTNINNGY 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    92 PPARNPCDLRNQNRFGENAEAYCNSDKIRVTGKKSAGGACAPFRRQNMCDKNLEYLDNTNTDDTDDLLGNVLVTAKYEGE 171
Cdd:PTZ00176   83 PPARNPCDGRNQNRFDENGESYCNSDKIRGNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGE 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   172 SIVAKHPHKENSEVCTALARSFADIGDIVRGKDMFKRNEEDAVQKGLRAVFKKINDNLKEKEISDY---DNDPNYYKLRE 248
Cdd:PTZ00176  163 SIVNNHPDKDKSSVCTALARSFADIGDIVRGKDMFKRNKHDNVENGLREVFKKIYEGLKNNGAREHykeVKNGNYIKLRE 242
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   249 DWWTANRDQVWRAITCYIPYYVnYFKKTSDDTIVFTN----DGKCGHyEGAPPTnLDYVPQFLRWFDEWAEEFCRIRNHK 324
Cdd:PTZ00176  243 DWWTANRDQVWKAMTCVAPENA-YFRKTEADGIGISSlilpYSKCGR-DTDPPV-VDYIPQRLRWMSEWSEYFCNVLNKE 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   325 LRKIKDACRNDKERLYCSQNgydctkriekgsscSRENKCTGCSNKCVDYDFWLEKQQNEFKIQKDKYdkeIETYVN-KT 403
Cdd:PTZ00176  320 IDEMNNQCKDCEMSRRCNND--------------TEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKY---MELYNKaST 382
                         410
                  ....*....|....*
gi 23498129   404 PISNSNSNTKKEYYK 418
Cdd:PTZ00176  383 NITKQNSSAPERGYR 397
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
743-1534 5.04e-72

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 267.67  E-value: 5.04e-72
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   743 NGGKLVRVKRlaemmqRRARKQLEKRGGEINlKADASQGKYIRGGKEKKLNGQICNIDTSYSNDSRNGNNGG--PCTGKN 820
Cdd:PTZ00176   21 NIGNEIKDKR------ENESKYTDKLKGSLW-EARFSDGLSSSFGDVRSGYYDSCSLDHKFHTNINNGYPPArnPCDGRN 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   821 DKRFKIGTEwSYGEHEKKRTHPEVY-----MPPRREHMCISNLEKLdvvsVIKNGNASHSLLGDVLLAAKYEAKNIkely 895
Cdd:PTZ00176   94 QNRFDENGE-SYCNSDKIRGNENNSnagacAPFRRQNMCDKNLEYL----INKNTENTHDLLGNVLVTAKYEGESI---- 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   896 qQNNSKNgvidqNDKETICRAMKYSFADIGDIIRGKDMWVQNtDATKLQAYLAKIFDKIKDNHKDIKGKLQYN--GDTDH 973
Cdd:PTZ00176  165 -VNNHPD-----KDKSSVCTALARSFADIGDIVRGKDMFKRN-KHDNVENGLREVFKKIYEGLKNNGAREHYKevKNGNY 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   974 KLLREDWWEANRHQVWRAMKC-AIEND--KDMKCNGI------------------PIEDYIPQRLRWMTEWAEWYCKEQS 1032
Cdd:PTZ00176  238 IKLREDWWTANRDQVWKAMTCvAPENAyfRKTEADGIgisslilpyskcgrdtdpPVVDYIPQRLRWMSEWSEYFCNVLN 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1033 RLYGELLEKCQSCKGKQKC---TEGDvDCGKCKAACDKYKDEINKWREQWTKIKGKYKTLYKKATKpGVTTSNNPK---- 1105
Cdd:PTZ00176  318 KEIDEMNNQCKDCEMSRRCnndTEGE-KCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKAST-NITKQNSSAperg 395
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1106 -----------DEKDVVDFLKQLLprkSKNTPGVTAMTpntlyssaagyihQELGKTVGCNTQKEFCDNKKGK---YAFK 1171
Cdd:PTZ00176  396 yrrnhrrrgydDDTNVQLFLKKVI---ENNECKVESLG-------------KYLDKTSHCGNYNFNYDNTPGSnrsNAFE 459
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1172 HPPKEYEEACICdtrqKAQKPIEK------KNDCngikTLLDRsnggtggIDGCNPKI--GNYPSWNCERNESKA-ENKG 1242
Cdd:PTZ00176  460 ITPEKFKKACKC----KIPNPLEKcpneenKNVC----TRFDK-------VYSCTSLSfkNDLSEWNNSGVKNKEnDNNG 524
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1243 ACVPPRREKFCVSLLAKEGiFKNKGE-DIRETFVKSAALETYFAWKRYNDDNKKAEEELKsgtipenfkrqmyYTFADYR 1321
Cdd:PTZ00176  525 VLVPPRRRNLCINLFSKKD-YKMKDEnDFKEDLLNAAFSQGKLLGKKYSNYSNEAYEAMK-------------FSYADYS 590
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1322 DIFFGTDITshDHILDVSKNAKNKLKEKngeQKSVIIIDDEKlladWWKEHGHEIWEGMLCALTheiDEEEKNKIKSTYS 1401
Cdd:PTZ00176  591 DIVKGTDMM--NDLKKLNKELNTLLKET---EKGDISVDRKT----WWDDNKNVVWNAMLCGYK---TENENQQLNSSWC 658
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1402 ydqlkkttngTTPLEKFAErpQFLRWFTEWSDEFCREREKKEEVVEKKCKKDHEGCNKPNTKG--NHGCVSACKDYEEYI 1479
Cdd:PTZ00176  659 ----------NVPDDDNID--QFLRWLTEWAQQYCKEKLIKAHIINTKCKDIVEGRKHKSMVDitDVECKRLFIDYEEWF 726
                         810       820       830       840       850
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 23498129  1480 STKKKQYNTQKEKFDIDKNKGNEEYENYKDKEAHDYLKDKCFPGTCDY--MEKVKNN 1534
Cdd:PTZ00176  727 RYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAASYVTKHCNGCICNLrdMEDIHKN 783
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
130-308 2.18e-62

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 211.80  E-value: 2.18e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    130 ACAPFRRQNMCDKNLEYLDNTNTDDTDDLL--GNVLVTAKYEGESIVAKHPHKE--------NSEVCTALARSFADIGDI 199
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSNTTHDllEAVILAAKYEGFSLWHKYKKYNpqyklgtiPSEFCRQMAYSFADIGDI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    200 VRGKDMF------KRNEEDAVQKGLRAVFKKINDNLKEKEisdyDNDPNYYKLREDWWTANRDQVWRAITCYIPYYVNYF 273
Cdd:pfam05424   81 VRGKDLYlgnnkkKKNKREKLEENLKKIFKKIYEKLTSKN----KDDGNYYQLREDWWEANREDIWKAMTCALTYGAKYF 156
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 23498129    274 KKTSDDTIVFTNDGKcghyEGAPPTNLDYVPQFLR 308
Cdd:pfam05424  157 RKTCGDGNSSSTAGC----NDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1616-1795 2.11e-51

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 180.21  E-value: 2.11e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   1616 ACMPPRRQKLCVINLQYFKG-----KTTVDLREAFIKCAAVETFFLWHKYKEDNnggedLQNQLesGIIPDDFKRQMFYT 1690
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINStnttsNTTHDLLEAVILAAKYEGFSLWHKYKKYN-----PQYKL--GTIPSEFCRQMAYS 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   1691 FGDYRDFLFGTDISKG-----HGIGSELAKKIDSLFKNIGGKNPGDLS--------RKDWWNENGPYIWKGMLCSLEKAw 1757
Cdd:pfam05424   74 FADIGDIVRGKDLYLGnnkkkKNKREKLEENLKKIFKKIYEKLTSKNKddgnyyqlREDWWEANREDIWKAMTCALTYG- 152
                          170       180       190
                   ....*....|....*....|....*....|....*...
gi 23498129   1758 GKDTIKNKSNYNYhnvKFSDNRNGPDLETFAKRPQFLR 1795
Cdd:pfam05424  153 AKYFRKTCGDGNS---SSTAGCNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
844-1018 3.96e-51

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 179.44  E-value: 3.96e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    844 VYMPPRREHMCISNLEKLDVVSVIKNgnASHSLLGDVLLAAKYEAKNIKELYQQNNSKNGviDQNDKETICRAMKYSFAD 923
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSN--TTHDLLEAVILAAKYEGFSLWHKYKKYNPQYK--LGTIPSEFCRQMAYSFAD 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    924 IGDIIRGKDMWVQN-----TDATKLQAYLAKIFDKIKDNHKDIKGKlqyngDTDHKLLREDWWEANRHQVWRAMKCAIEN 998
Cdd:pfam05424   77 IGDIVRGKDLYLGNnkkkkNKREKLEENLKKIFKKIYEKLTSKNKD-----DGNYYQLREDWWEANREDIWKAMTCALTY 151
                          170       180       190
                   ....*....|....*....|....*....|....*.
gi 23498129    999 DKD--------------MKCNGIPIE--DYIPQRLR 1018
Cdd:pfam05424  152 GAKyfrktcgdgnssstAGCNDDVPTyfDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1243-1426 6.35e-42

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 153.25  E-value: 6.35e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   1243 ACVPPRREKFCVSLLAK---EGIFKNKGEDIRETFVKSAALETYFAWKRYNDDNkkaeEELKSGTIPENFKRQMYYTFAD 1319
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKinsTNTTSNTTHDLLEAVILAAKYEGFSLWHKYKKYN----PQYKLGTIPSEFCRQMAYSFAD 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   1320 YRDIFFGTDI------TSHDHILDVSKNAKNKLKEKNGEQKS--VIIIDDEKLLADWWKEHGHEIWEGMLCALTHeideE 1391
Cdd:pfam05424   77 IGDIVRGKDLylgnnkKKKNKREKLEENLKKIFKKIYEKLTSknKDDGNYYQLREDWWEANREDIWKAMTCALTY----G 152
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 23498129   1392 EKNKIKSTYSYDQLKKTTNGTTPLEKFAERPQFLR 1426
Cdd:pfam05424  153 AKYFRKTCGDGNSSSTAGCNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
2168-2386 2.48e-41

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 151.32  E-value: 2.48e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2168 ICVPPRRRRLYVGKLTQWASQRTQGGTSSQivgktasqpnshptlspssnprddgLRDAFIQSAAVETFFLWDRYKKLNT 2247
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSNTTHD-------------------------LLEAVILAAKYEGFSLWHKYKKYNP 55
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2248 KKPDatlgglpqiplamgaingyvpsgddnnpqkkleeGEIPEEFKRQMFYTLGDYRDILFGKnDIVIGNtgsgasDKEM 2327
Cdd:pfam05424   56 QYKL----------------------------------GTIPSEFCRQMAYSFADIGDIVRGK-DLYLGN------NKKK 94
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2328 KAKEEKIKETIDKVFPNSVSTPPPTPATKPSDEK-RKTWWEANGEHIWKGMIYALTYKDN 2386
Cdd:pfam05424   95 KNKREKLEENLKKIFKKIYEKLTSKNKDDGNYYQlREDWWEANREDIWKAMTCALTYGAK 154
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
1233-1869 2.47e-29

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 129.38  E-value: 2.47e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1233 RNESKAENKGACVPPRREKFCVSLLakEGIFKNKGEDIRETFVKSAALETYFAWKRYNDDNKKAEEELKSGtipenfkrq 1312
Cdd:PTZ00176  111 RGNENNSNAGACAPFRRQNMCDKNL--EYLINKNTENTHDLLGNVLVTAKYEGESIVNNHPDKDKSSVCTA--------- 179
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1313 MYYTFADYRDIFFGTDI---TSHDHILD-------------VSKNAKNKLKE-KNGEQKsviiiddeKLLADWWKEHGHE 1375
Cdd:PTZ00176  180 LARSFADIGDIVRGKDMfkrNKHDNVENglrevfkkiyeglKNNGAREHYKEvKNGNYI--------KLREDWWTANRDQ 251
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1376 IWEGMLCA-------LTHEIDEEEKNKIKSTYSydqlKKTTNGTTPLEKFAerPQFLRWFTEWSDEFCREREKKEEVVEK 1448
Cdd:PTZ00176  252 VWKAMTCVapenayfRKTEADGIGISSLILPYS----KCGRDTDPPVVDYI--PQRLRWMSEWSEYFCNVLNKEIDEMNN 325
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1449 KCKkDHEGCNKPNTKGNHG----CVSACKDYEEYISTKKKQYNTQKEKF---------DIDKNKGNEEYENYK------- 1508
Cdd:PTZ00176  326 QCK-DCEMSRRCNNDTEGEkckkCKEQCQIFKELVSKWKNQFDKQSMKYmelynkastNITKQNSSAPERGYRrnhrrrg 404
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1509 ---DKEAHDYLKDKCFPGTCD------YMEKVKN----NSEYWDKPNKTYTNS------DLEKKCECKPQPPPPAPAPTQ 1569
Cdd:PTZ00176  405 yddDTNVQLFLKKVIENNECKveslgkYLDKTSHcgnyNFNYDNTPGSNRSNAfeitpeKFKKACKCKIPNPLEKCPNEE 484
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1570 SAceivddilNGKSATDYIEKCNGKYKYGRYPEWNcNSQI---HRTHNGACMPPRRQKLCvINL---QYFKGKTTVDLRE 1643
Cdd:PTZ00176  485 NK--------NVCTRFDKVYSCTSLSFKNDLSEWN-NSGVknkENDNNGVLVPPRRRNLC-INLfskKDYKMKDENDFKE 554
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1644 AFIKCAAVETFFLWHKYKEDNNGGEDlqnqlesgiipddfkrQMFYTFGDYRDFLFGTDISKGHgigSELAKKIDSLFKN 1723
Cdd:PTZ00176  555 DLLNAAFSQGKLLGKKYSNYSNEAYE----------------AMKFSYADYSDIVKGTDMMNDL---KKLNKELNTLLKE 615
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1724 iggKNPGDLS--RKDWWNENGPYIWKGMLCslekAWGKDTIKNKSNYNYHNVKFSDNRNgpdletfakrpQFLRWFTEWG 1801
Cdd:PTZ00176  616 ---TEKGDISvdRKTWWDDNKNVVWNAMLC----GYKTENENQQLNSSWCNVPDDDNID-----------QFLRWLTEWA 677
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129  1802 DEFCREQKKQLDILKKKCPKETctnEGKKK---------ECSDACKAYKEWLQ----TWKEHYEKQkIKYENDKDSYTND 1868
Cdd:PTZ00176  678 QQYCKEKLIKAHIINTKCKDIV---EGRKHksmvditdvECKRLFIDYEEWFRyrynQWKGLSEKY-IKIKKSKNSGVNI 753

                  .
gi 23498129  1869 P 1869
Cdd:PTZ00176  754 P 754
PFEMP pfam03011
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
581-726 6.08e-18

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


Pssm-ID: 281064  Cd Length: 154  Bit Score: 83.32  E-value: 6.08e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129    581 FHSWAKNLLIDTIRWEHQLKNCINNTNVTDCTSKCIKNCECYEAWIERKKDEWEKLKEVLNKKDETSHNYYNKLKDVFD- 659
Cdd:pfam03011    2 FKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKGLTGKTLDEYLDl 81
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 23498129    660 -----RFLFQVMFALDQDEKGKWDQFTEDLKK-KFGPSVESAGTANSQDAIEFLLDHLKDNALTCRDNNSIKP 726
Cdd:pfam03011   82 ksfleTFLFYIDIKEAYGDVKELKKLEEILDEeGCSAGAESAKNNKNEDAIDKLLDKEEKKANNCKEKHKEND 154
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
129-394 1.27e-12

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 74.30  E-value: 1.27e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   129 GACAPFRRQNMCdKNLEYLDNTNTDDTDDLLGNVLVTAKYEGESIVAKHPHKENsEVCTALARSFADIGDIVRGKDMFkr 208
Cdd:PTZ00176  524 GVLVPPRRRNLC-INLFSKKDYKMKDENDFKEDLLNAAFSQGKLLGKKYSNYSN-EAYEAMKFSYADYSDIVKGTDMM-- 599
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   209 needavqKGLRAVFKKINDNLKEKEISDYDNDpnyyklREDWWTANRDQVWRAITCyipyyvNYFKKTSDDTIvftNDGK 288
Cdd:PTZ00176  600 -------NDLKKLNKELNTLLKETEKGDISVD------RKTWWDDNKNVVWNAMLC------GYKTENENQQL---NSSW 657
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   289 CGhyegaPPTNlDYVPQFLRWFDEWAEEFCR---IRNHKLR-KIKDACRNDKERLYCSQNGYDCtKRIekgsscsrenkc 364
Cdd:PTZ00176  658 CN-----VPDD-DNIDQFLRWLTEWAQQYCKeklIKAHIINtKCKDIVEGRKHKSMVDITDVEC-KRL------------ 718
                         250       260       270
                  ....*....|....*....|....*....|
gi 23498129   365 tgcsnkCVDYDFWLEKQQNEFKIQKDKYDK 394
Cdd:PTZ00176  719 ------FIDYEEWFRYRYNQWKGLSEKYIK 742
PFEMP pfam03011
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
2738-2884 2.98e-12

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


Pssm-ID: 281064  Cd Length: 154  Bit Score: 66.75  E-value: 2.98e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23498129   2738 FLEYWLQDFIEGYyiLKKRKIIEQCKENG-GETCNENSKNDCACVKGWVAQKTTEWNQIKDHYNKKEYGNG--YDMSHKV 2814
Cdd:pfam03011    1 LFKRWVEYFLEDS--IKWRKKLKSCINNGkGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKGltGKTLDEY 78
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 23498129   2815 KNYFEKNENELRKWI-----DNYDVLKNNEEYEVCNNGDKNCNFEGKKRKKDMVTLLLSRLQNEIKTCQNPPPSD 2884
Cdd:pfam03011   79 LDLKSFLETFLFYIDikeayGDVKELKKLEEILDEEGCSAGAESAKNNKNEDAIDKLLDKEEKKANNCKEKHKEN 153
NTS pfam15447
N-terminal segments of PfEMP1; This family, the N-terminal segment, is the most variable part ...
21-56 1.02e-08

N-terminal segments of PfEMP1; This family, the N-terminal segment, is the most variable part of the variant surface antigen family of Plasmodium falciparum, the erythrocyte membrane protein-1 (PfEMP1) proteins. PfEMP1 is an important target for protective immunity and is implicated in the pathology of malaria through its ability to adhere to host endothelial receptors. A structural and functional study of the N-terminal domain of PfEMP1 from the VarO variant comprising the N-terminal segment (NTS) and the first DBL domain (DBL1alpha1), shows this region is directly implicated in rosetting. NTS, previously thought to be a structurally independent component of PfEMP1, forms an integral part of the DBL1alpha domain that is found to be the important heparin-binding site. This family is closely associated with PFEMP, pfam03011, and Duffy_binding, pfam05424.


Pssm-ID: 317801  Cd Length: 36  Bit Score: 52.77  E-value: 1.02e-08
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 23498129     21 SARNVLENIGIEIYNEEKKKVNGYTSQLRGDLSRAR 56
Cdd:pfam15447    1 SAKHVLDRIGKKVHDKVKKEAKKYKSELKGDLSKAK 36
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH