NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|21740732|emb|CAD40853|]
View 

OSJNBa0086B14.26 [Oryza sativa Japonica Group]

Protein Classification

Peptidase_C19G domain-containing protein (domain architecture ID 10119250)

Peptidase_C19G domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Peptidase_C19G cd02663
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-359 1.73e-177

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


:

Pssm-ID: 239128 [Multi-domain]  Cd Length: 300  Bit Score: 494.52  E-value: 1.73e-177
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFcipfreklleyyannktpgdaeENLLTCLADLFMQVSQSKKKTGVIAPKRFVQRVKKQNE 103
Cdd:cd02663   1 GLENFGNTCYCNSVLQALYF----------------------ENLLTCLKDLFESISEQKKRTGVISPKKFITRLKRENE 58
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 104 LFRSYMHQDAHEFLNFLLNELVDILEKESNAAKDSPQSSSPEKVPNGPvqplangvrkeppvTLVHKNFQGILTNETRCL 183
Cdd:cd02663  59 LFDNYMHQDAHEFLNFLLNEIAEILDAERKAEKANRKLNNNNNAEPQP--------------TWVHEIFQGILTNETRCL 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 184 RCETVTARDETFFDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFKYIEQ 263
Cdd:cd02663 125 TCETVSSRDETFLDLSIDVEQNTSITSCLRQFSATETLCGRNKFYCDECCSLQEAEKRMKIKKLPKILALHLKRFKYDEQ 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 264 LGRYKKLSYRVVFPMELKL-STSDD---VDTEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMVEESTLQTF 339
Cdd:cd02663 205 LNRYIKLFYRVVFPLELRLfNTTDDaenPDRLYELVAVVVHIGGGPNHGHYVSIVKSHGGWLLFDDETVEKIDENAVEEF 284
                       330       340
                ....*....|....*....|
gi 21740732 340 FGssheYSGNTDHGYILFYE 359
Cdd:cd02663 285 FG----DSPNQATAYVLFYQ 300
 
Name Accession Description Interval E-value
Peptidase_C19G cd02663
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-359 1.73e-177

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239128 [Multi-domain]  Cd Length: 300  Bit Score: 494.52  E-value: 1.73e-177
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFcipfreklleyyannktpgdaeENLLTCLADLFMQVSQSKKKTGVIAPKRFVQRVKKQNE 103
Cdd:cd02663   1 GLENFGNTCYCNSVLQALYF----------------------ENLLTCLKDLFESISEQKKRTGVISPKKFITRLKRENE 58
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 104 LFRSYMHQDAHEFLNFLLNELVDILEKESNAAKDSPQSSSPEKVPNGPvqplangvrkeppvTLVHKNFQGILTNETRCL 183
Cdd:cd02663  59 LFDNYMHQDAHEFLNFLLNEIAEILDAERKAEKANRKLNNNNNAEPQP--------------TWVHEIFQGILTNETRCL 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 184 RCETVTARDETFFDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFKYIEQ 263
Cdd:cd02663 125 TCETVSSRDETFLDLSIDVEQNTSITSCLRQFSATETLCGRNKFYCDECCSLQEAEKRMKIKKLPKILALHLKRFKYDEQ 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 264 LGRYKKLSYRVVFPMELKL-STSDD---VDTEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMVEESTLQTF 339
Cdd:cd02663 205 LNRYIKLFYRVVFPLELRLfNTTDDaenPDRLYELVAVVVHIGGGPNHGHYVSIVKSHGGWLLFDDETVEKIDENAVEEF 284
                       330       340
                ....*....|....*....|
gi 21740732 340 FGssheYSGNTDHGYILFYE 359
Cdd:cd02663 285 FG----DSPNQATAYVLFYQ 300
UCH pfam00443
Ubiquitin carboxyl-terminal hydrolase;
23-358 1.87e-93

Ubiquitin carboxyl-terminal hydrolase;


Pssm-ID: 334078 [Multi-domain]  Cd Length: 305  Bit Score: 281.20  E-value: 1.87e-93
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732    23 FGLENFGNTCYCNSVLQALYFCIPFREKLLEYYANNKTPGDAEE-NLLTCLADLFMQVsQSKKKTGVIAPKRFVQRVKKQ 101
Cdd:pfam00443   1 TGLVNLGNTCYMNSVLQCLFSIPPFRDYLLRISPLSEDSRYNKDiNLLCALADLFKAL-QSEKKSSSVSPKEFKKTLGKL 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   102 NELFRSYMHQDAHEFLNFLLNELVDILEKESNAAKDSPqssspekvpngpvqplangvrkeppvtlVHKNFQGILTNETR 181
Cdd:pfam00443  80 NPDFSGYKQQDAQEFLLFLLDGLHEDLNGKHSTENESL----------------------------ITDLFRGQLKSRLK 131
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   182 CLRCETVTARDETFFDLSVDIEQNSS--ITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFK 259
Cdd:pfam00443 132 CLNCGKESYTFEPFLDLSLPIPSLKNydLQDCLKAFTKEEILKGENMYYCPKCKGKCGAIKKLKISRLPPVLIIHLKRFS 211
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   260 YieQLGRYKKLSYRVVFPMELKLS--TSDDVD------TEYSLFAVVVHVGSgPNHGHYVSLVKSH--NHWLFFDDENVE 329
Cdd:pfam00443 212 Y--NRSTWEKLNTEVEFPEELDLSeyLAEGLDekevepTKYRLVAVVVHSGS-LSSGHYIAYIKKYenGRWYKFDDEKVT 288
                         330       340
                  ....*....|....*....|....*....
gi 21740732   330 MVEESTLQtffgssheysgnTDHGYILFY 358
Cdd:pfam00443 289 EVDEEEVL------------NKSAYILFY 305
COG5533 COG5533
Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]; ...
24-359 1.81e-45

Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227820 [Multi-domain]  Cd Length: 415  Bit Score: 160.57  E-value: 1.81e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFC----IPFREKLLEYYANNKTP-GDAEENLLTCLADLFMQVSQSKKKTgvIAPKRFVQRV 98
Cdd:COG5533  73 GLRNKGNTCYMNCALQCLLSIgdlnTMLQGRFYLQNINTDFPrGKPGSNAFKQFIALYETPGCHGPKS--ISPRNFIDIL 150
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  99 KKQNELFRSYMHQDAHEFLNFLLNELVDilEKESNAAKDSPQSSSPE------KVPNGPVQPLANGVRKEPPVTLVHKNF 172
Cdd:COG5533 151 SGRNKLFSGDMQQDSQEFLIFFLDLLHE--DLNGNKSRSPILELKDEfeevreELPLSHFSHHEWNLHLRSNKSLVAKTF 228
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 173 QGILTNETRCLRCETVTARDETFFDLSVDIEQNSS--ITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHI 250
Cdd:COG5533 229 FGQDKSRLQCEACNYTSTTIAMFSTLLVPPYEVVQlgLQECIDRFYEEEKLEGKDAWRCPKCGRKESSRKRMEILVLPDV 308
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 251 LVIHLKRFKyIEQLGRYK---KLSYRVVFPMELKL-----STSDDVDTEYSLFAVVVHVGSgPNHGHYVSLVKSHNHWLF 322
Cdd:COG5533 309 LIIHISRFH-ISVMGRKKidtPQGWKNTASVEVNVtllfnNGIGYIPRKYSLLGVVCHNGT-LNGGHYFSEVKRSGTWNV 386
                       330       340       350
                ....*....|....*....|....*....|....*..
gi 21740732 323 FDDENVEMVeestlqtffgsSHEYSGNTDHGYILFYE 359
Cdd:COG5533 387 YDDSQVRKG-----------SRTTSGSHPSSYILFYT 412
 
Name Accession Description Interval E-value
Peptidase_C19G cd02663
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-359 1.73e-177

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239128 [Multi-domain]  Cd Length: 300  Bit Score: 494.52  E-value: 1.73e-177
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFcipfreklleyyannktpgdaeENLLTCLADLFMQVSQSKKKTGVIAPKRFVQRVKKQNE 103
Cdd:cd02663   1 GLENFGNTCYCNSVLQALYF----------------------ENLLTCLKDLFESISEQKKRTGVISPKKFITRLKRENE 58
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 104 LFRSYMHQDAHEFLNFLLNELVDILEKESNAAKDSPQSSSPEKVPNGPvqplangvrkeppvTLVHKNFQGILTNETRCL 183
Cdd:cd02663  59 LFDNYMHQDAHEFLNFLLNEIAEILDAERKAEKANRKLNNNNNAEPQP--------------TWVHEIFQGILTNETRCL 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 184 RCETVTARDETFFDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFKYIEQ 263
Cdd:cd02663 125 TCETVSSRDETFLDLSIDVEQNTSITSCLRQFSATETLCGRNKFYCDECCSLQEAEKRMKIKKLPKILALHLKRFKYDEQ 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 264 LGRYKKLSYRVVFPMELKL-STSDD---VDTEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMVEESTLQTF 339
Cdd:cd02663 205 LNRYIKLFYRVVFPLELRLfNTTDDaenPDRLYELVAVVVHIGGGPNHGHYVSIVKSHGGWLLFDDETVEKIDENAVEEF 284
                       330       340
                ....*....|....*....|
gi 21740732 340 FGssheYSGNTDHGYILFYE 359
Cdd:cd02663 285 FG----DSPNQATAYVLFYQ 300
UCH pfam00443
Ubiquitin carboxyl-terminal hydrolase;
23-358 1.87e-93

Ubiquitin carboxyl-terminal hydrolase;


Pssm-ID: 334078 [Multi-domain]  Cd Length: 305  Bit Score: 281.20  E-value: 1.87e-93
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732    23 FGLENFGNTCYCNSVLQALYFCIPFREKLLEYYANNKTPGDAEE-NLLTCLADLFMQVsQSKKKTGVIAPKRFVQRVKKQ 101
Cdd:pfam00443   1 TGLVNLGNTCYMNSVLQCLFSIPPFRDYLLRISPLSEDSRYNKDiNLLCALADLFKAL-QSEKKSSSVSPKEFKKTLGKL 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   102 NELFRSYMHQDAHEFLNFLLNELVDILEKESNAAKDSPqssspekvpngpvqplangvrkeppvtlVHKNFQGILTNETR 181
Cdd:pfam00443  80 NPDFSGYKQQDAQEFLLFLLDGLHEDLNGKHSTENESL----------------------------ITDLFRGQLKSRLK 131
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   182 CLRCETVTARDETFFDLSVDIEQNSS--ITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFK 259
Cdd:pfam00443 132 CLNCGKESYTFEPFLDLSLPIPSLKNydLQDCLKAFTKEEILKGENMYYCPKCKGKCGAIKKLKISRLPPVLIIHLKRFS 211
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   260 YieQLGRYKKLSYRVVFPMELKLS--TSDDVD------TEYSLFAVVVHVGSgPNHGHYVSLVKSH--NHWLFFDDENVE 329
Cdd:pfam00443 212 Y--NRSTWEKLNTEVEFPEELDLSeyLAEGLDekevepTKYRLVAVVVHSGS-LSSGHYIAYIKKYenGRWYKFDDEKVT 288
                         330       340
                  ....*....|....*....|....*....
gi 21740732   330 MVEESTLQtffgssheysgnTDHGYILFY 358
Cdd:pfam00443 289 EVDEEEVL------------NKSAYILFY 305
Peptidase_C19 cd02257
Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ...
24-359 1.75e-69

Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239072 [Multi-domain]  Cd Length: 255  Bit Score: 218.12  E-value: 1.75e-69
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFcipfreklleyyannktpgdaeenlltcladlfmqvsqskkktgviapkrfvqrvkkqne 103
Cdd:cd02257   1 GLNNLGNTCYLNSVLQALFS------------------------------------------------------------ 20
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 104 lfrsyMHQDAHEFLNFLLNELVDILEKESNAAKDSPQSSSpekvpngpvqplangvrkeppvtLVHKNFQGILTNETRCL 183
Cdd:cd02257  21 -----EQQDAHEFLLFLLDKLHEELKKSSKRTSDSSSLKS-----------------------LIHDLFGGKLESTIVCL 72
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 184 RC--ETVTARDETFFDLSVDIEQ--NSSITSCLKNFCSTETLNAEDKFFCDKCcSLQEAQKRMKIKKAPHILVIHLKRFK 259
Cdd:cd02257  73 ECghESVSTEPELFLSLPLPVKGlpQVSLEDCLEKFFKEEILEGDNCYKCEKK-KKQEATKRLKIKKLPPVLIIHLKRFS 151
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 260 YIEQlGRYKKLSYRVVFPMELKLST----------SDDVDTEYSLFAVVVHVGSGPNHGHYVSLVKSHNH--WLFFDDEN 327
Cdd:cd02257 152 FNED-GTKEKLNTKVSFPLELDLSPylsegekdsdSDNGSYKYELVAVVVHSGTSADSGHYVAYVKDPSDgkWYKFNDDK 230
                       330       340       350
                ....*....|....*....|....*....|..
gi 21740732 328 VEMVEESTLQTFFGSSHEysgntdhGYILFYE 359
Cdd:cd02257 231 VTEVSEEEVLEFGSLSSS-------AYILFYE 255
peptidase_C19C cd02659
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
21-359 1.75e-59

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239124 [Multi-domain]  Cd Length: 334  Bit Score: 195.17  E-value: 1.75e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  21 RYFGLENFGNTCYCNSVLQALYFCIPFREKLLEYYANNKTPGDAEENLLTCLADLFMQVSQSKKKTGVIAPKRFVQRVKK 100
Cdd:cd02659   1 GYVGLKNQGATCYMNSLLQQLYMTPEFRNAVYSIPPTEDDDDNKSVPLALQRLFLFLQLSESPVKTTELTDKTRSFGWDS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 101 QNelfrSYMHQDAHEFLNFLLnelvDILEkesnaakdspQSSSPEKVPNgpvqplangvrkeppvtLVHKNFQGILTNET 180
Cdd:cd02659  81 LN----TFEQHDVQEFFRVLF----DKLE----------EKLKGTGQEG-----------------LIKNLFGGKLVNYI 125
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 181 RCLRCETVTARDETFFDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFKY 260
Cdd:cd02659 126 ICKECPHESEREEYFLDLQVAVKGKKNLEESLDAYVQGETLEGDNKYFCEKCGKKVDAEKGVCFKKLPPVLTLQLKRFEF 205
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 261 IEQLGRYKKLSYRVVFPMELKLST---------------SDDVDTEYSLFAVVVHvgSGPNH-GHYVSLVKS--HNHWLF 322
Cdd:cd02659 206 DFETMMRIKINDRFEFPLELDMEPytekglakkegdsekKDSESYIYELHGVLVH--SGDAHgGHYYSYIKDrdDGKWYK 283
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*...
gi 21740732 323 FDDENV-EMVEESTLQTFFGsSHEYSGNTDHG----------YILFYE 359
Cdd:cd02659 284 FNDDVVtPFDPNDAEEECFG-GEETQKTYDSGprafkrttnaYMLFYE 330
Peptidase_C19E cd02661
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-358 7.08e-59

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239126 [Multi-domain]  Cd Length: 304  Bit Score: 192.49  E-value: 7.08e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFCIPFREKLLEYyANNKTPGDAEENLLTCLADLFMQVSQSKKKTgvIAPKRFVQRVKKQNE 103
Cdd:cd02661   3 GLQNLGNTCFLNSVLQCLTHTPPLANYLLSR-EHSKDCCNEGFCMMCALEAHVERALASSGPG--SAPRIFSSNLKQISK 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 104 LFRSYMHQDAHEFLNFLLnelvDILEKesnaakdspqSSSPEKVPNGPVQPLANGVrkeppvTLVHKNFQGILTNETRCL 183
Cdd:cd02661  80 HFRIGRQEDAHEFLRYLL----DAMQK----------ACLDRFKKLKAVDPSSQET------TLVQQIFGGYLRSQVKCL 139
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 184 RCETVTARDETFFDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFKYIeq 263
Cdd:cd02661 140 NCKHVSNTYDPFLDLSLDIKGADSLEDALEQFTKPEQLDGENKYKCERCKKKVKASKQLTIHRAPNVLTIHLKRFSNF-- 217
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 264 lgRYKKLSYRVVFPMELKL----STSDDVDTEYSLFAVVVHVGSGPNHGHYVSLVK-SHNHWLFFDDENVEMVEESTLQt 338
Cdd:cd02661 218 --RGGKINKQISFPETLDLspymSQPNDGPLKYKLYAVLVHSGFSPHSGHYYCYVKsSNGKWYNMDDSKVSPVSIETVL- 294
                       330       340
                ....*....|....*....|
gi 21740732 339 ffgssheysgnTDHGYILFY 358
Cdd:cd02661 295 -----------SQKAYILFY 303
Peptidase_C19R cd02674
A subfamily of peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-359 1.57e-48

A subfamily of peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239139 [Multi-domain]  Cd Length: 230  Bit Score: 163.23  E-value: 1.57e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALyfcipfreklleyyannktpgdaeenlltcladlfmqvsqskkktgviapkrfvqrvkkqne 103
Cdd:cd02674   1 GLRNLGNTCYMNSILQCL-------------------------------------------------------------- 18
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 104 lfrSYMHQDAHEFLNFLLNELvdilekesnaakDSpqssspekvpngpvqplangvrkeppvtLVHKNFQGILTNETRCL 183
Cdd:cd02674  19 ---SADQQDAQEFLLFLLDGL------------HS----------------------------IIVDLFQGQLKSRLTCL 55
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 184 RCETVTARDETFFDLSVDIEQNS------SITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKR 257
Cdd:cd02674  56 TCGKTSTTFEPFTYLSLPIPSGSgdapkvTLEDCLRLFTKEETLDGDNAWKCPKCKKKRKATKKLTISRLPKVLIIHLKR 135
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 258 FKYieQLGRYKKLSYRVVFPMElKLSTSDDVDTE-------YSLFAVVVHVGSGpNHGHYVSLVKS--HNHWLFFDDENV 328
Cdd:cd02674 136 FSF--SRGSTRKLTTPVTFPLN-DLDLTPYVDTRsftgpfkYDLYAVVNHYGSL-NGGHYTAYCKNneTNDWYKFDDSRV 211
                       330       340       350
                ....*....|....*....|....*....|.
gi 21740732 329 EMVEEStlqtffgssheySGNTDHGYILFYE 359
Cdd:cd02674 212 TKVSES------------SVVSSSAYILFYE 230
Peptidase_C19D cd02660
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-358 2.55e-46

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239125 [Multi-domain]  Cd Length: 328  Bit Score: 160.62  E-value: 2.55e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFCIPFREKLLEYYANNKTPGDAEENLLTC-LADLFMQVSQSKKKTGVIaPKRFVQRVKKQN 102
Cdd:cd02660   2 GLINLGATCFMNVILQALLHNPLLRNYFLSDRHSCTCLSCSPNSCLSCaMDEIFQEFYYSGDRSPYG-PINLLYLSWKHS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 103 ELFRSYMHQDAHEFLNFLLNELvdilekESNAAKDSPQSSSPEKVPngpvqplangvrkeppvTLVHKNFQGILTNETRC 182
Cdd:cd02660  81 RNLAGYSQQDAHEFFQFLLDQL------HTHYGGDKNEANDESHCN-----------------CIIHQTFSGSLQSSVTC 137
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 183 LRCETVTARDETFFDLSVDIEQNS---------------SITSCLKNFCSTETLnAEDKFFCDKCCSLQEAQKRMKIKKA 247
Cdd:cd02660 138 QRCGGVSTTVDPFLDLSLDIPNKStpswalgesgvsgtpTLSDCLDRFTRPEKL-GDFAYKCSGCGSTQEATKQLSIKKL 216
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 248 PHILVIHLKRFKYiEQLGRYKKLSYRVVFPMEL-------------KLSTSDDVDTEYSLFAVVVHVGSgPNHGHYVSLV 314
Cdd:cd02660 217 PPVLCFQLKRFEH-SLNKTSRKIDTYVQFPLELnmtpytsssigdtQDSNSLDPDYTYDLFAVVVHKGT-LDTGHYTAYC 294
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*
gi 21740732 315 KSHN-HWLFFDDENVEMVEESTLQtffgssheysgnTDHGYILFY 358
Cdd:cd02660 295 RQGDgQWFKFDDAMITRVSEEEVL------------KSQAYLLFY 327
Peptidase_C19L cd02668
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-359 5.00e-46

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239133 [Multi-domain]  Cd Length: 324  Bit Score: 159.51  E-value: 5.00e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFCIPFREKLLE-------YYANNKTPGDAEEN-LLTCLADLFMQVSQSKKKtgVIAPKRFV 95
Cdd:cd02668   1 GLKNLGATCYVNSFLQLWFMNLEFRKAVYEcnstedaELKNMPPDKPHEPQtIIDQLQLIFAQLQFGNRS--VVDPSGFV 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  96 QRVKKQNELfrsymHQDAHEFLNFLLNELVDILEKESNaakdspqssspekvPNGpvqplangvrkeppVTLVHKNFQGI 175
Cdd:cd02668  79 KALGLDTGQ-----QQDAQEFSKLFLSLLEAKLSKSKN--------------PDL--------------KNIVQDLFRGE 125
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 176 LTNETRCLRCETVTARDETFFDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHL 255
Cdd:cd02668 126 YSYVTQCSKCGRESSLPSKFYELELQLKGHKTLEECIDEFLKEEQLTGDNQYFCESCNSKTDATRRIRLTTLPPTLNFQL 205
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 256 KRFKYIEQLGRYKKLSYRVVFPMELKLST----SDDVDTEYSLFAVVVHVGSGPNHGHYVSLVKSHNH--WLFFDDENVE 329
Cdd:cd02668 206 LRFVFDRKTGAKKKLNASISFPEILDMGEylaeSDEGSYVYELSGVLIHQGVSAYSGHYIAHIKDEQTgeWYKFNDEDVE 285
                       330       340       350
                ....*....|....*....|....*....|....*....
gi 21740732 330 MVEESTLQ------TFFGSSHEYSGNT---DHGYILFYE 359
Cdd:cd02668 286 EMPGKPLKlgnsedPAKPRKSEIKKGThssRTAYMLVYK 324
COG5533 COG5533
Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]; ...
24-359 1.81e-45

Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227820 [Multi-domain]  Cd Length: 415  Bit Score: 160.57  E-value: 1.81e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFC----IPFREKLLEYYANNKTP-GDAEENLLTCLADLFMQVSQSKKKTgvIAPKRFVQRV 98
Cdd:COG5533  73 GLRNKGNTCYMNCALQCLLSIgdlnTMLQGRFYLQNINTDFPrGKPGSNAFKQFIALYETPGCHGPKS--ISPRNFIDIL 150
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  99 KKQNELFRSYMHQDAHEFLNFLLNELVDilEKESNAAKDSPQSSSPE------KVPNGPVQPLANGVRKEPPVTLVHKNF 172
Cdd:COG5533 151 SGRNKLFSGDMQQDSQEFLIFFLDLLHE--DLNGNKSRSPILELKDEfeevreELPLSHFSHHEWNLHLRSNKSLVAKTF 228
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 173 QGILTNETRCLRCETVTARDETFFDLSVDIEQNSS--ITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHI 250
Cdd:COG5533 229 FGQDKSRLQCEACNYTSTTIAMFSTLLVPPYEVVQlgLQECIDRFYEEEKLEGKDAWRCPKCGRKESSRKRMEILVLPDV 308
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 251 LVIHLKRFKyIEQLGRYK---KLSYRVVFPMELKL-----STSDDVDTEYSLFAVVVHVGSgPNHGHYVSLVKSHNHWLF 322
Cdd:COG5533 309 LIIHISRFH-ISVMGRKKidtPQGWKNTASVEVNVtllfnNGIGYIPRKYSLLGVVCHNGT-LNGGHYFSEVKRSGTWNV 386
                       330       340       350
                ....*....|....*....|....*....|....*..
gi 21740732 323 FDDENVEMVeestlqtffgsSHEYSGNTDHGYILFYE 359
Cdd:COG5533 387 YDDSQVRKG-----------SRTTSGSHPSSYILFYT 412
Peptidase_C19O cd02671
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-358 3.41e-44

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239136 [Multi-domain]  Cd Length: 332  Bit Score: 155.05  E-value: 3.41e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFCIPFREKLLEYYANNktpGDAEENLLTCLADLFMQVSQSKKKtgviAPKRFVQRVKKQNE 103
Cdd:cd02671  26 GLNNLGNTCYLNSVLQVLYFCPGFKHGLKHLVSLI---SSVEQLQSSFLLNPEKYNDELANQ----APRRLLNALREVNP 98
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 104 LFRSYMHQDAHEFLNFLLNELVDILEKEsnaakdspqssspekvpngpvqplangvrkeppvtlvhknFQGILTNETRCL 183
Cdd:cd02671  99 MYEGYLQHDAQEVLQCILGNIQELVEKD----------------------------------------FQGQLVLRTRCL 138
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 184 RCETVTARDETFFDLSVDI--------EQNSSITSCLK-----------NFCSTETLNAEDKFFCDKCCSLQEAQKRMKI 244
Cdd:cd02671 139 ECETFTERREDFQDISVPVqeselsksEESSEISPDPKtemktlkwaisQFASVERIVGEDKYFCENCHHYTEAERSLLF 218
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 245 KKAPHILVIHLKRF----KYIEQLGRYKKLSYRVVFPMELKL---STSDDVDTeYSLFAVVVHVGSGPNHGHYVSLVKsh 317
Cdd:cd02671 219 DKLPEVITIHLKCFaangSEFDCYGGLSKVNTPLLTPLKLSLeewSTKPKNDV-YRLFAVVMHSGATISSGHYTAYVR-- 295
                       330       340       350       360
                ....*....|....*....|....*....|....*....|.
gi 21740732 318 nhWLFFDDENVEMVEEstlQTFFGSSHEYSGNTDHGYILFY 358
Cdd:cd02671 296 --WLLFDDSEVKVTEE---KDFLEALSPNTSSTSTPYLLFY 331
Peptidase_C19H cd02664
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-359 1.21e-40

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239129 [Multi-domain]  Cd Length: 327  Bit Score: 145.71  E-value: 1.21e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFCIPFREKLLEYYANNKTPGDAeenLLTCLADLFMQVSQSKKKTGViAPKRFVQRVKKqnE 103
Cdd:cd02664   1 GLINLGNTCYMNSVLQALFMAKDFRRQVLSLNLPRLGDSQS---VMKKLQLLQAHLMHTQRRAEA-PPDYFLEASRP--P 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 104 LFRSYMHQDAHEFLNFLLnELVDilekesnaakdspqssspekvpngpvqplangvrkeppvTLVHKNFQGILTNETRCL 183
Cdd:cd02664  75 WFTPGSQQDCSEYLRYLL-DRLH---------------------------------------TLIEKMFGGKLSTTIRCL 114
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 184 RCETVTARDETFFDLSVDIeqnSSITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFKYIEQ 263
Cdd:cd02664 115 NCNSTSARTERFRDLDLSF---PSVQDLLNYFLSPEKLTGDNQYYCEKCASLQDAEKEMKVTGAPEYLILTLLRFSYDQK 191
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 264 LGRYKKLSYRVVFPMELKL------STSDDVDTE-----------------YSLFAVVVHVGSGPNHGHYVSLVK----- 315
Cdd:cd02664 192 THVREKIMDNVSINEVLSLpvrvesKSSESPLEKkeeesgddgelvtrqvhYRLYAVVVHSGYSSESGHYFTYARdqtda 271
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 21740732 316 -SHNH----------------WLFFDDENVEMVEESTLQ--TFFGSSheysgntDHGYILFYE 359
Cdd:cd02664 272 dSTGQecpepkdaeendesknWYLFNDSRVTFSSFESVQnvTSRFPK-------DTPYILFYE 327
Peptidase_C19K cd02667
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-359 2.22e-38

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239132 [Multi-domain]  Cd Length: 279  Bit Score: 138.29  E-value: 2.22e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFCIPFREKLLEyyannkTPgdaeenlltclADLFMQVSQSkkktgviAPKrfvqrvkkqne 103
Cdd:cd02667   1 GLSNLGNTCFFNAVMQNLSQTPALRELLSE------TP-----------KELFSQVCRK-------APQ----------- 45
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 104 lFRSYMHQDAHEFLNFLLNELVdilekesnaakdspqssspekvpngpvqplangvrkeppvTLVHKNFQGILTNETRCL 183
Cdd:cd02667  46 -FKGYQQQDSHELLRYLLDGLR----------------------------------------TFIDSIFGGELTSTIMCE 84
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 184 RCETVTARDETFFDLS----VDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCslqEAQKRMKIKKAPHILVIHLKRFK 259
Cdd:cd02667  85 SCGTVSLVYEPFLDLSlprsDEIKSECSIESCLKQFTEVEILEGNNKFACENCT---KAKKQYLISKLPPVLVIHLKRFQ 161
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 260 YiEQLGRYKKLSYRVVFPMELKL---------STSDDVDTEYSLFAVVVHVGSGpNHGHYVSLVKSHN------------ 318
Cdd:cd02667 162 Q-PRSANLRKVSRHVSFPEILDLapfcdpkcnSSEDKSSVLYRLYGVVEHSGTM-RSGHYVAYVKVRPpqqrlsdltksk 239
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|..
gi 21740732 319 -----------HWLFFDDENVEMVEESTLqtffgSSHEysgntdhGYILFYE 359
Cdd:cd02667 240 paadeagpgsgQWYYISDSDVREVSLEEV-----LKSE-------AYLLFYE 279
Peptidase_C19A cd02657
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-359 9.29e-34

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239122 [Multi-domain]  Cd Length: 305  Bit Score: 126.68  E-value: 9.29e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFCIPFREKLLEYYANNKTPGDAEENLLTCLADLFMQVSqskKKTGVIAPKRFV-------- 95
Cdd:cd02657   1 GLTNLGNTCYLNSTLQCLRSVPELRDALKNYNPARRGANQSSDNLTNALRDLFDTMD---KKQEPVPPIEFLqllrmafp 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  96 QRVKKQNELFrsYMHQDAHEFLNFLLNELVDILEkesnaakdsPQSSSPEKvpngpvqplangvrkeppvtlVHKNFQGI 175
Cdd:cd02657  78 QFAEKQNQGG--YAQQDAEECWSQLLSVLSQKLP---------GAGSKGSF---------------------IDQLFGIE 125
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 176 LTNETRCL---RCETVTARDETFFDLSVDIEQN-SSITSCLKnfcstETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHIL 251
Cdd:cd02657 126 LETKMKCTespDEEEVSTESEYKLQCHISITTEvNYLQDGLK-----KGLEEEIEKHSPTLGRDAIYTKTSRISRLPKYL 200
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 252 VIHLKRFKYIEQLGRYKKLSYRVVFPMELKLSTSDDVDTEYSLFAVVVHVGSGPNHGHYVSLVKS--HNHWLFFDDENVE 329
Cdd:cd02657 201 TVQFVRFFWKRDIQKKAKILRKVKFPFELDLYELCTPSGYYELVAVITHQGRSADSGHYVAWVRRknDGKWIKFDDDKVS 280
                       330       340       350
                ....*....|....*....|....*....|
gi 21740732 330 MVEESTLQTFFGssheySGNTDHGYILFYE 359
Cdd:cd02657 281 EVTEEDILKLSG-----GGDWHIAYILLYK 305
Peptidase_C19B cd02658
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-359 5.74e-32

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239123 [Multi-domain]  Cd Length: 311  Bit Score: 122.05  E-value: 5.74e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALyFCIP-FREKLLEYYAN-NKTPGDAEENL---LTCLADLFMQ----VSQSKKKTGV-----I 89
Cdd:cd02658   1 GLRNLGNSCYLNSVLQVL-FSIPsFQWRYDDLENKfPSDVVDPANDLncqLIKLADGLLSgrysKPASLKSENDpyqvgI 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  90 APKRFVQRVKKQNELFRSYMHQDAHEFLNFLLnelvDILEKESNAAKDSPqssspekvPNgpvqplangvrkeppvtlvh 169
Cdd:cd02658  80 KPSMFKALIGKGHPEFSTMRQQDALEFLLHLI----DKLDRESFKNLGLN--------PN-------------------- 127
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 170 KNFQGILTNETRCLRCETVTARDETFFDLSVDIE--------------QNSSITSCLKNFCSTETLnaedKFFCDKCCSL 235
Cdd:cd02658 128 DLFKFMIEDRLECLSCKKVKYTSELSEILSLPVPkdeatekeegelvyEPVPLEDCLKAYFAPETI----EDFCSTCKEK 203
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 236 QEAQKRMKIKKAPHILVIHLKRFKYIEQlGRYKKLSYRVVFPMELKlstsddvDTEYSLFAVVVHVGSGPNHGHYVSLVK 315
Cdd:cd02658 204 TTATKTTGFKTFPDYLVINMKRFQLLEN-WVPKKLDVPIDVPEELG-------PGKYELIAFISHKGTSVHSGHYVAHIK 275
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*...
gi 21740732 316 ----SHNHWLFFDDENVemveestlqtffGSSHEYSGNTDHGYILFYE 359
Cdd:cd02658 276 keidGEGKWVLFNDEKV------------VASQDPPEMKKLGYIYFYQ 311
UCH_1 pfam13423
Ubiquitin carboxyl-terminal hydrolase;
24-328 7.03e-30

Ubiquitin carboxyl-terminal hydrolase;


Pssm-ID: 315986 [Multi-domain]  Cd Length: 295  Bit Score: 115.97  E-value: 7.03e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732    24 GLENFGNTCYCNSVLQALYFCIPFREKLLEyyaNNKTPGDAEENLLTCLADLFMQVSQSKKKTGVIApkRFVQRVKKQNE 103
Cdd:pfam13423   2 GLENHLDNSYLNALLQLYFFIPDLFEAILG---HSFDECPPENCLLCELGFLFDMLDKSNGQNCQAT--NFLRTFSTIPE 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   104 LFRSYMHQDAHEFLNFLLNELVDILEKEsnaakdspqssspekvpngpVQPLANGVRKEPPVTLVHKNFQGILTNETRCL 183
Cdd:pfam13423  77 AAALGLQQDIQEANRFILEQLSLPLLTL--------------------KPSIENRRDSSEAESQLSELFGTGLINSIRCI 136
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   184 RCETVTARDETFFDLSV---DIEQNSSITSCLKnfcstETLNAE--DKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRF 258
Cdd:pfam13423 137 SCNNESVKEESTLTVELpypPSEKGQNFSNILK-----SSIRREkiVTIWCSSCNKYQPVLIRKTFVSLPPILGICLKRY 211
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   259 KYIEQLGRyKKLSYRVVFPMELKLS--TSDDVDTE--------YSLFAVVVHVGSGPNHGHYVSLV----KSHN-HWLFF 323
Cdd:pfam13423 212 SEKDNFWA-VRLNLFVDIPLEINMPhfIQDDEQNErplsglfkYELQGVVCHIGDSLTSGHLVSFIrvapSSENsQWYLF 290

                  ....*
gi 21740732   324 DDENV 328
Cdd:pfam13423 291 NDFLV 295
COG5077 COG5077
Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, ...
22-346 2.66e-25

Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227409 [Multi-domain]  Cd Length: 1089  Bit Score: 107.26  E-value: 2.66e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   22 YFGLENFGNTCYCNSVLQALYFCIPFREKLLEYYANNKTPGDAeenLLTCLADLF--MQVSQSKKKTGVIApKRFVQrvk 99
Cdd:COG5077  193 YVGLRNQGATCYMNSLLQSLFFIAKFRKDVYGIPTDHPRGRDS---VALALQRLFynLQTGEEPVDTTELT-RSFGW--- 265
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  100 kqnELFRSYMHQDAHEFLNFLLNELvdilekESNAAKDspqssspekvpngPVQPLANGVrkeppvtlvhknFQGILTNE 179
Cdd:COG5077  266 ---DSDDSFMQHDIQEFNRVLQDNL------EKSMRGT-------------VVENALNGI------------FVGKMKSY 311
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  180 TRCLRCETVTARDETFFDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKcCSLQEAQKRMKIKKAPHILVIHLKRFK 259
Cdd:COG5077  312 IKCVNVNYESARVEDFWDIQLNVKGMKNLQESFRRYIQVETLDGDNRYNAEK-HGLQDAKKGVIFESLPPVLHLQLKRFE 390
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  260 YIEQLGRYKKLSYRVVFPMELKLS--------TSDDVDTEYSLFAVVVHVGSGPNhGHYVSLVKSH--NHWLFFDDENV- 328
Cdd:COG5077  391 YDFERDMMVKINDRYEFPLEIDLLpfldrdadKSENSDAVYVLYGVLVHSGDLHE-GHYYALLKPEkdGRWYKFDDTRVt 469
                        330
                 ....*....|....*...
gi 21740732  329 EMVEESTLQTFFGSSHEY 346
Cdd:COG5077  470 RATEKEVLEENFGGDHPY 487
Peptidase_C19F cd02662
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-359 4.49e-25

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239127 [Multi-domain]  Cd Length: 240  Bit Score: 101.67  E-value: 4.49e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFCIPFREklleyyannktpgdaeenlltcladlfmqvsqskkktgviapkrFVQRVKKQne 103
Cdd:cd02662   1 GLVNLGNTCFMNSVLQALASLPSLIE--------------------------------------------YLEEFLEQ-- 34
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 104 lfrsymhQDAHEFLNFLLNELvdilekesnaakdSPQSSSPekvpngpvqplangvrkeppvtlvhknFQGILTNETRCL 183
Cdd:cd02662  35 -------QDAHELFQVLLETL-------------EQLLKFP---------------------------FDGLLASRIVCL 67
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 184 RCETVTA-RDETFFDLSVDIEQNSSIT-----SCLKNFCSTETLnaeDKFFCDKCcslqeaqkRMKIKKAPHILVIHLKR 257
Cdd:cd02662  68 QCGESSKvRYESFTMLSLPVPNQSSGSgttleHCLDDFLSTEII---DDYKCDRC--------QTVIVRLPQILCIHLSR 136
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 258 FKYIEQlGRYKKLSYRVVFPMELKlstsddvDTEYSLFAVVVHVGSgPNHGHYVSLVKS--------------------- 316
Cdd:cd02662 137 SVFDGR-GTSTKNSCKVSFPERLP-------KVLYRLRAVVVHYGS-HSSGHYVCYRRKplfskdkepgsfvrmregpss 207
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....
gi 21740732 317 -HNHWLFFDDENVEMVEESTLqtffgssHEYSGntdhGYILFYE 359
Cdd:cd02662 208 tSHPWWRISDTTVKEVSESEV-------LEQKS----AYMLFYE 240
Peptidase_C19Q cd02673
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
25-359 2.19e-19

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239138 [Multi-domain]  Cd Length: 245  Bit Score: 86.04  E-value: 2.19e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  25 LENFGNTCYCNSVLQALyfcipfreklleyyannktpgdaeenlltcladlfmqvsqskkktgviapkrfvQRVKKQNEL 104
Cdd:cd02673   2 LVNTGNSCYFNSTMQAL------------------------------------------------------SSIGKINTE 27
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 105 FRSYMHQDAHEFLNFLLNELVDILEKESNAAKDSPQSSSPEKvpngPVQPLAngvrkeppvtlvhknfqgiLTNETR--C 182
Cdd:cd02673  28 FDNDDQQDAHEFLLTLLEAIDDIMQVNRTNVPPSNIEIKRLN----PLEAFK-------------------YTIESSyvC 84
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 183 LRCETVTARDETFFDLSVDIEQN--SSITSCLKNFCSTETLNAEdkffCDKCcSLQEAQKRMKIKKAPHILVIHLKRFKY 260
Cdd:cd02673  85 IGCSFEENVSDVGNFLDVSMIDNklDIDELLISNFKTWSPIEKD----CSSC-KCESAISSERIMTFPECLSINLKRYKL 159
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 261 IEQLGRYKKLSYRVVFPMELKLSTsddvdteYSLFAVVVHVGSGPNHGHYVSLVKS---HNHWLFFDDENVEMVEESTLQ 337
Cdd:cd02673 160 RIATSDYLKKNEEIMKKYCGTDAK-------YSLVAVICHLGESPYDGHYIAYTKElynGSSWLYCSDDEIRPVSKNDVS 232
                       330       340
                ....*....|....*....|..
gi 21740732 338 TFFGSSheysgntdhGYILFYE 359
Cdd:cd02673 233 TNARSS---------GYLIFYD 245
UBP12 COG5560
Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones];
211-359 2.38e-19

Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227847 [Multi-domain]  Cd Length: 823  Bit Score: 89.56  E-value: 2.38e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 211 CLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFKYieQLGRYKKLSYRVVFP-----MELKLSTS 285
Cdd:COG5560 680 CLNEFSKPEQLGLSDSWYCPGCKEFRQASKQMELWRLPMILIIHLKRFSS--VRSFRDKIDDLVEYPiddldLSGVEYMV 757
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 21740732 286 DDVDTEYSLFAVVVHVGsGPNHGHYVSLVK--SHNHWLFFDDENVEMV-EESTLqtffgssheysgnTDHGYILFYE 359
Cdd:COG5560 758 DDPRLIYDLYAVDNHYG-GLSGGHYTAYARnfANNGWYLFDDSRITEVdPEDSV-------------TSSAYVLFYR 820
Peptidase_C19M cd02669
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
6-333 1.07e-18

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239134 [Multi-domain]  Cd Length: 440  Bit Score: 86.60  E-value: 1.07e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732   6 SKLEKAL-GDQFPEGerYFGLENFGNTCYCNSVLQALYFCIPFREKLLEYyANNKTPGDAEENLLTCLADLFMQVSQSKK 84
Cdd:cd02669 104 PKLSRDLdGKPYLPG--FVGLNNIKNNDYANVIIQALSHVKPIRNFFLLY-ENYENIKDRKSELVKRLSELIRKIWNPRN 180
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  85 KTGVIAPKRFVQRVKKQNELFRSYMHQ-DAHEFLNFLLNELVDILEKesnaakdspqssspekvpngpvqplangvRKEP 163
Cdd:cd02669 181 FKGHVSPHELLQAVSKVSKKKFSITEQsDPVEFLSWLLNTLHKDLGG-----------------------------SKKP 231
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 164 PVTLVHKNFQGILTNETRCLRCETVTARD-ETFFDLSVDIEQNSSITSCL---------------KNFCSTETL-NAEDK 226
Cdd:cd02669 232 NSSIIHDCFQGKVQIETQKIKPHAEEEGSkDKFFKDSRVKKTSVSPFLLLtldlpppplfkdgneENIIPQVPLkQLLKK 311
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 227 FFCDKCCSLQEAQKRMKIKKAPHILVIHLKRF-KYIEQLGRYKKLsyrVVFPMELkLSTSDDVD---------TEYSLFA 296
Cdd:cd02669 312 YDGKTETELKDSLKRYLISRLPKYLIFHIKRFsKNNFFKEKNPTI---VNFPIKN-LDLSDYVHfdkpslnlsTKYNLVA 387
                       330       340       350
                ....*....|....*....|....*....|....*....
gi 21740732 297 VVVHVGSGPNHGHYVSLV--KSHNHWLFFDDENVEMVEE 333
Cdd:cd02669 388 NIVHEGTPQEDGTWRVQLrhKSTNKWFEIQDLNVKEVLP 426
UBP12 COG5560
Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones];
24-202 2.61e-13

Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227847 [Multi-domain]  Cd Length: 823  Bit Score: 71.07  E-value: 2.61e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQALYFCIPFREKLL----EYYANNKTPGDAEENLLTCLADLFMQVSQSKKKTgvIAPKRFVQRVK 99
Cdd:COG5560 267 GLRNLGNTCYMNSALQCLMHTWELRDYFLsdeyEESINEENPLGMHGSVASAYADLIKQLYDGNLHA--FTPSGFKKTIG 344
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 100 KQNELFRSYMHQDAHEFLNFLLnelvDILEKESNAAKDSPQSSSPEKVPNGP--VQPLANG---VRKEPPVTLVHKNFQG 174
Cdd:COG5560 345 SFNEEFSGYDQQDSQEFIAFLL----DGLHEDLNRIIKKPYTSKPDLSPGDDvvVKKKAKEcwwEHLKRNDSIITDLFQG 420
                       170       180
                ....*....|....*....|....*...
gi 21740732 175 ILTNETRCLRCETVTARDETFFDLSVDI 202
Cdd:COG5560 421 MYKSTLTCPGCGSVSITFDPFMDLTLPL 448
UBP14 COG5207
Uncharacterized Zn-finger protein, UBP-type [General function prediction only];
21-260 8.75e-13

Uncharacterized Zn-finger protein, UBP-type [General function prediction only];


Pssm-ID: 227532 [Multi-domain]  Cd Length: 749  Bit Score: 69.32  E-value: 8.75e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  21 RYFGLENFGNTCYCNSVLQALYFCIPFREKLLeyYANNKTPGDAeENLLTCLADLFMQVSQSKKKTGV------IAPKRF 94
Cdd:COG5207 302 PYVGLINLGNSCYLSSVIQSLVGYAVSKEEFD--LLQHFEICYM-KNPLECLFCQLMKLLSKMKETPDneyvngISPLDF 378
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  95 VQRVKKQNELFRSYMHQDAHEFLNFLLNElvdILEKESNAAKdspqssspekvpngpvqplangvrkePPVTlvhKNFQG 174
Cdd:COG5207 379 KMLIGQDHPEFGKFAQQDAHEFLLFLLEK---IRKGERSYLI--------------------------PPIT---SLFEF 426
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 175 ILTNETRCLRCETVTARDETFFDLSVDIEQN---SSITSCLKNFCSTETLnaedKFFCDKCCSLQEAQKRMKIKKAPHIL 251
Cdd:COG5207 427 EVERRLSCSGCMDVSYSYESMLMICIFLEGNdepQDIRKSVEAFFLPDTI----EWSCENCKGKKKASRKPFIKSLPKYL 502

                ....*....
gi 21740732 252 VIHLKRFKY 260
Cdd:COG5207 503 ILQVGRYSL 511
Peptidase_C19J cd02666
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
24-358 4.02e-11

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239131 [Multi-domain]  Cd Length: 343  Bit Score: 63.28  E-value: 4.02e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  24 GLENFGNTCYCNSVLQaLYFCI-PFREKLLEYYANNktpgdaeenlltclADLFMQVSQSKKKTGVIAPKRFVQR----V 98
Cdd:cd02666   3 GLDNIGNTCYLNSLLQ-YFFTIkPLRDLVLNFDESK--------------AELASDYPTERRIGGREVSRSELQRsnqfV 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732  99 KKQNELFRSYMHQDAH------EFLNFLLN-----ELVDI----LEKESNAAKDSPQSSSPE--KVPNGPVQPLANGVRK 161
Cdd:cd02666  68 YELRSLFNDLIHSNTRsvtpskELAYLALRqqdvtECIDNvlfqLEVALEPISNAFAGPDTEddKEQSDLIKRLFSGKTK 147
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 162 EPPVTLVHKNFQGILTNEtrclrcetvtardETFFDLSVDIEQNSSITSCLKNFCSteTLNAEDKFFcdkccslqeaqKR 241
Cdd:cd02666 148 QQLVPESMGNQPSVRTKT-------------ERFLSLLVDVGKKGREIVVLLEPKD--LYDALDRYF-----------DY 201
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 242 MKIKKAPHILVIHLKR--FKYIEQLG---RYKKLSYRVVFPMELKLSTS-----------------------DDV-DTEY 292
Cdd:cd02666 202 DSLTKLPQRSQVQAQLaqPLQRELISmdrYELPSSIDDIDELIREAIQSesslvrqaqnelaelkheiekqfDDLkSYGY 281
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 21740732 293 SLFAVVVHVGSGpNHGHYVSLVKSH--NHWLFFDDENVEMVEESTLQTFfgssheYSGNTDHGYILFY 358
Cdd:cd02666 282 RLHAVFIHRGEA-SSGHYWVYIKDFeeNVWRKYNDETVTVVPASEVFLF------TLGNTATPYFLVY 342
Peptidase_C19N cd02670
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
244-359 5.07e-07

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239135 [Multi-domain]  Cd Length: 241  Bit Score: 49.83  E-value: 5.07e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 244 IKKAPHILVIHLKRFKYIEqlGRYKKLSYRVVFPMELKL---------------STSDDVDTEY-----------SLFAV 297
Cdd:cd02670  95 FAKAPSCLIICLKRYGKTE--GKAQKMFKKILIPDEIDIpdfvaddpracskcqLECRVCYDDKdfsptcgkfklSLCSA 172
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 21740732 298 VVHVGSGPNHGHYVSLVKS-------------HNHWLFFDDenveMVEESTLQTffGSSHEYSGNTDHGYILFYE 359
Cdd:cd02670 173 VCHRGTSLETGHYVAFVRYgsysltetdneayNAQWVFFDD----MADRDGVSN--GFNIPAARLLEDPYMLFYQ 241
Peptidase_C19P cd02672
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
168-336 3.15e-06

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239137 [Multi-domain]  Cd Length: 268  Bit Score: 47.89  E-value: 3.15e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 168 VHKNFQGILTNETRC------LRCETVTARDETFFDLSVD-----IEQNSSITSCLKnfcSTETLNAEDKFFCDKCCSLQ 236
Cdd:cd02672  68 LIQNFTRFLLETISQdqlgtpFSCGTSRNSVSLLYTLSLPlgstkTSKESTFLQLLK---RSLDLEKVTKAWCDTCCKYQ 144
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 237 EAQKRMKIKKAPHI----LVIHLKRFKYIE-----QLGRYKKLSYRVVFPMELKLSTSDDVDTE----YSLFAVVVHVGS 303
Cdd:cd02672 145 PLEQTTSIRHLPDIlllvLVINLSVTNGEFddinvVLPSGKVMQNKVSPKAIDHDKLVKNRGQEsiykYELVGYVCEIND 224
                       170       180       190
                ....*....|....*....|....*....|....*....
gi 21740732 304 GPNHGHYVSLV------KSHNHWLFFDDENVEMVEESTL 336
Cdd:cd02672 225 SSRGQHNVVFVikvneeSTHGRWYLFNDFLVTPVSELAY 263
Peptidase_C19I cd02665
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are ...
111-337 3.58e-05

A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.


Pssm-ID: 239130 [Multi-domain]  Cd Length: 228  Bit Score: 44.47  E-value: 3.58e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 111 QDAHEFLNFLLNELVDILEKESNAAKDspqsssPEKVPNGPVQplangvrkeppvtlvhkNFQGilTNETRCLRCETVTA 190
Cdd:cd02665  23 QDVSEFTHLLLDWLEDAFQAAAEAISP------GEKSKNPMVQ-----------------LFYG--TFLTEGVLEGKPFC 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21740732 191 RDETFFDLSVDIEQNSSITSCLknfcstETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFKYIEqlGRYKKL 270
Cdd:cd02665  78 NCETFGQYPLQVNGYGNLHECL------EAAMFEGEVELLPSDHSVKSGQERWFTELPPVLTFELSRFEFNQ--GRPEKI 149
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 21740732 271 SYRVVFPMELKlstsddvDTEYSLFAVVVHVGSGpNHGHYVS--LVKSHNHWLFFDDENVEMVEESTLQ 337
Cdd:cd02665 150 HDKLEFPQIIQ-------QVPYELHAVLVHEGQA-NAGHYWAyiYKQSRQEWEKYNDISVTESSWEEVE 210
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH