NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6425507|emb|CAB60609|]
View 

GCL (Drosophila Germ Cell-Less) homolog [Caenorhabditis elegans]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
BTB_POZ_GCL cd18305
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
55-169 7.24e-62

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; GCL proteins are nuclear envelope proteins highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in embryos. Both, human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 2 (GMCL2), also called germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L), may function in spermatogenesis. They may also be substrate-specific adaptors of E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. They contain BTB and BACK domains. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


:

Pssm-ID: 349614 [Multi-domain]  Cd Length: 115  Bit Score: 197.50  E-value: 7.24e-62
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   55 TCAYVYQKLFLQGENSDIVLAACGREWRVHKLYLKQTKFFESMFDGLWTESNSGRVQMEITDPNIDADGLNSVLGSLYHN 134
Cdd:cd18305   1 TSKYIYQTLFLNGENSDITICALGREWKLHKIYLCQSGYFASMFSGSWKESKETVINLEIPDDNITVEALNVVFGSLYRD 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 6425507  135 EIEIDLDKIEGTVAAASYIVLDSVTDRCSEMMIEA 169
Cdd:cd18305  81 EIEIKPSRVVSILAAATLLQLDGLIQQCSEVMKET 115
BACK super family cl28903
BACK (BTB and C-terminal Kelch) domain; The BACK domain is found in architectures C-terminal ...
170-248 1.04e-08

BACK (BTB and C-terminal Kelch) domain; The BACK domain is found in architectures C-terminal to a BTB domain, in a diverse set of architectures together with Kelch, MATH, and/or TAZ domains. It is involved in interactions with the Cullin3 (Cul3) ubiquitin ligase complex, as well as in homo-oligomerization. Most proteins containing the BACK domain are understood to function as adaptor proteins that play a role in ubiquitination of various substrates.


The actual alignment was detected with superfamily member cd18495:

Pssm-ID: 355779  Cd Length: 78  Bit Score: 51.86  E-value: 1.04e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507  170 LSTKNAVRFYDVSTKYGLEKVREKSMEVLLHQfwkIMTDR--EKLNEVDRQLFVTLLNSPNLLIIEGEFDLYKVVKSWIY 247
Cdd:cd18495   1 ISAKTVCSYYEAACMYGLTEVKKKCLEWLLRN---LMTSQnvTLLRELSIELMEQLIASPNLFVMQVEMDVYTLLKKWLF 77

                .
gi 6425507  248 M 248
Cdd:cd18495  78 L 78
 
Name Accession Description Interval E-value
BTB_POZ_GCL cd18305
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
55-169 7.24e-62

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; GCL proteins are nuclear envelope proteins highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in embryos. Both, human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 2 (GMCL2), also called germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L), may function in spermatogenesis. They may also be substrate-specific adaptors of E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. They contain BTB and BACK domains. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349614 [Multi-domain]  Cd Length: 115  Bit Score: 197.50  E-value: 7.24e-62
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   55 TCAYVYQKLFLQGENSDIVLAACGREWRVHKLYLKQTKFFESMFDGLWTESNSGRVQMEITDPNIDADGLNSVLGSLYHN 134
Cdd:cd18305   1 TSKYIYQTLFLNGENSDITICALGREWKLHKIYLCQSGYFASMFSGSWKESKETVINLEIPDDNITVEALNVVFGSLYRD 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 6425507  135 EIEIDLDKIEGTVAAASYIVLDSVTDRCSEMMIEA 169
Cdd:cd18305  81 EIEIKPSRVVSILAAATLLQLDGLIQQCSEVMKET 115
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
60-168 4.10e-12

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerized PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


Pssm-ID: 334194 [Multi-domain]  Cd Length: 108  Bit Score: 62.29  E-value: 4.10e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507     60 YQKLFLQGENSDIVLAA-CGREWRVHKLYLK-QTKFFESMFDGLWTESNsgrvQMEITDPNIDADGLNSVLGSLYHNEIE 137
Cdd:pfam00651   1 LNELREQGKLCDVTLVVgDGKEFRAHKAVLAaCSPYFKALFSGQEEESS----VSEIELDDVSPEDFEALLEFMYTGELE 76
                          90       100       110
                  ....*....|....*....|....*....|.
gi 6425507    138 IDLDKIEGTVAAASYIVLDSVTDRCSEMMIE 168
Cdd:pfam00651  77 ISEENVDDLLAAADKLQIPSLVDKCEEFLIQ 107
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
71-168 2.65e-09

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585 [Multi-domain]  Cd Length: 97  Bit Score: 54.23  E-value: 2.65e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507      71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMeitdPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:smart00225   1 DVTLVVGGKKFHAHKAVLAAhSPYFKALFSSDFKESDKSEIYL----DDVSPEDFRALLNFLYTGKLDLPEENVEELLEL 76
                           90
                   ....*....|....*....
gi 6425507     150 ASYIVLDSVTDRCSEMMIE 168
Cdd:smart00225  77 ADYLQIPGLVELCEEFLLK 95
BACK_GCL cd18495
BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less ...
170-248 1.04e-08

BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; The GCL protein is a nuclear envelope protein highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in Drosophila embryos. Both human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L) may function in spermatogenesis. They may also be substrate-specific adaptors of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.


Pssm-ID: 350570  Cd Length: 78  Bit Score: 51.86  E-value: 1.04e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507  170 LSTKNAVRFYDVSTKYGLEKVREKSMEVLLHQfwkIMTDR--EKLNEVDRQLFVTLLNSPNLLIIEGEFDLYKVVKSWIY 247
Cdd:cd18495   1 ISAKTVCSYYEAACMYGLTEVKKKCLEWLLRN---LMTSQnvTLLRELSIELMEQLIASPNLFVMQVEMDVYTLLKKWLF 77

                .
gi 6425507  248 M 248
Cdd:cd18495  78 L 78
PHA03098 PHA03098
kelch-like protein; Provisional
82-210 4.96e-07

kelch-like protein; Provisional


Pssm-ID: 222983 [Multi-domain]  Cd Length: 534  Bit Score: 52.08  E-value: 4.96e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507    82 RVHKLYLKQ-TKFFESMFdglwtesNSGRVQMEITdPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAAASYIVLDSVTD 160
Cdd:PHA03098  24 KVHKIILSSsSEYFKKMF-------KNNFKENEIN-LNIDYDSFNEVIKYIYTGKINITSNNVKDILSIANYLIIDFLIN 95
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 6425507   161 RCSEMMIEALSTKNAVRFYDVSTKYGLEKVREKSMEVLLHQFWKIMTDRE 210
Cdd:PHA03098  96 LCINYIIKIIDDNNCIDIYRFSFFYGCKKLYSAAYNYIRNNIELIYNDPD 145
 
Name Accession Description Interval E-value
BTB_POZ_GCL cd18305
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
55-169 7.24e-62

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; GCL proteins are nuclear envelope proteins highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in embryos. Both, human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 2 (GMCL2), also called germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L), may function in spermatogenesis. They may also be substrate-specific adaptors of E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. They contain BTB and BACK domains. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349614 [Multi-domain]  Cd Length: 115  Bit Score: 197.50  E-value: 7.24e-62
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   55 TCAYVYQKLFLQGENSDIVLAACGREWRVHKLYLKQTKFFESMFDGLWTESNSGRVQMEITDPNIDADGLNSVLGSLYHN 134
Cdd:cd18305   1 TSKYIYQTLFLNGENSDITICALGREWKLHKIYLCQSGYFASMFSGSWKESKETVINLEIPDDNITVEALNVVFGSLYRD 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 6425507  135 EIEIDLDKIEGTVAAASYIVLDSVTDRCSEMMIEA 169
Cdd:cd18305  81 EIEIKPSRVVSILAAATLLQLDGLIQQCSEVMKET 115
BTB_POZ_BTBD16 cd18291
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
58-178 2.29e-12

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 16 (BTBD16); BTBD16 is a BTB domain-containing protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349600  Cd Length: 114  Bit Score: 63.23  E-value: 2.29e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   58 YVYQKLFLQGENSDIVLAACGREWRVHKLYLKQTKFFESMFdglwtesNSGRVQMEITDPNIDADGLNSVLGSLYHNEIE 137
Cdd:cd18291   1 YYHSQKVARSACPDVVLECLGSFWELHSPYLCKSETLAELL-------KPVTISLNINDPLVTKEAFAVALGNLYNSEVE 73
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 6425507  138 IDLDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKNAVRF 178
Cdd:cd18291  74 VNVEDAVGVLAAAALLRFPTLFQKCVKVMISSISSSTVCKF 114
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
60-168 4.10e-12

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerized PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


Pssm-ID: 334194 [Multi-domain]  Cd Length: 108  Bit Score: 62.29  E-value: 4.10e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507     60 YQKLFLQGENSDIVLAA-CGREWRVHKLYLK-QTKFFESMFDGLWTESNsgrvQMEITDPNIDADGLNSVLGSLYHNEIE 137
Cdd:pfam00651   1 LNELREQGKLCDVTLVVgDGKEFRAHKAVLAaCSPYFKALFSGQEEESS----VSEIELDDVSPEDFEALLEFMYTGELE 76
                          90       100       110
                  ....*....|....*....|....*....|.
gi 6425507    138 IDLDKIEGTVAAASYIVLDSVTDRCSEMMIE 168
Cdd:pfam00651  77 ISEENVDDLLAAADKLQIPSLVDKCEEFLIQ 107
BTB_POZ_ZBTB_KLHL-like cd18186
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-152 5.86e-11

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing (ZBTB) proteins, Kelch-like (KLHL) proteins, and similar proteins; This family includes a variety of BTB/POZ domain-containing proteins, such as zinc finger and BTB domain-containing (ZBTB) proteins and Kelch-like (KLHL) proteins. They have diverse functions, such as transcriptional regulation, chromatin remodeling, protein degradation and cytoskeletal regulation. Many BTB/POZ proteins contain one or two additional domains, such as kelch repeats, zinc-finger domains, FYVE (Fab1, YOTB, Vac1, and EEA1) fingers, or ankyrin repeats. These special additional domains or interaction partners provide unique characteristics and functions to BTB/POZ proteins. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349497 [Multi-domain]  Cd Length: 82  Bit Score: 58.33  E-value: 5.86e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYL-KQTKFFESMFDGLWTESNSGRVQMeitdPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVA 148
Cdd:cd18186   2 CDVTLVVGGREFPAHRAVLaARSPYFRAMFSSGMKESSSSEIEL----DDVSPEAFEALLDYIYTGELELSEENVEELLA 77

                ....
gi 6425507  149 AASY 152
Cdd:cd18186  78 AADK 81
BTB_POZ_KLHL26 cd18255
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
65-174 8.88e-10

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 26 (KLHL26); KLHL26 is encoded by the klhl26 gene, which is regulated by p53 via fuzzy tandem repeats. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349564 [Multi-domain]  Cd Length: 121  Bit Score: 56.25  E-value: 8.88e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   65 LQGENS--------DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNsgrvQMEITDPNIDADGLNSVLGSLYHNE 135
Cdd:cd18255   6 LQGLNAlrakgqllDVTLIADGQRFQAHKVVLAScSDYFRAMFTGGMRESS----QDEIELKGVSAKGLKHILDFAYTSE 81
                        90       100       110
                ....*....|....*....|....*....|....*....
gi 6425507  136 IEIDLDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18255  82 LTLDLDCIQDVLGAAVHLQMLPVVELCEEFLKSAMSVEN 120
BTB_POZ_KLHL34 cd18264
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
60-174 9.92e-10

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 34 (KLHL34); KLHL34 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The methylation status of KLHL34 cg14232291 appears to be predictive of pathologic response to preoperative chemoradiation therapy in rectal cancer patients. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349573 [Multi-domain]  Cd Length: 136  Bit Score: 56.34  E-value: 9.92e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   60 YQKLFLQGENSDIVLAACGREWRVHKLYLK-QTKFFESMFDGLWTESNSGRVQMeitdPNIDADGLNSVLGSLYHNEIEI 138
Cdd:cd18264  19 YQSLRAEGFLCDVVLEAEGNEFPAHRSLLAcSSDYFRALFKDYTQESKARVIHL----PVVSAAGLQRVLDFIYTSWLSL 94
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 6425507  139 DLDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18264  95 SLDTLEDTLEAASYLQVTEAIGLCSQYLINNLAPEN 130
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
71-168 2.65e-09

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585 [Multi-domain]  Cd Length: 97  Bit Score: 54.23  E-value: 2.65e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507      71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMeitdPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:smart00225   1 DVTLVVGGKKFHAHKAVLAAhSPYFKALFSSDFKESDKSEIYL----DDVSPEDFRALLNFLYTGKLDLPEENVEELLEL 76
                           90
                   ....*....|....*....
gi 6425507     150 ASYIVLDSVTDRCSEMMIE 168
Cdd:smart00225  77 ADYLQIPGLVELCEEFLLK 95
BACK_GCL cd18495
BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less ...
170-248 1.04e-08

BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; The GCL protein is a nuclear envelope protein highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in Drosophila embryos. Both human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L) may function in spermatogenesis. They may also be substrate-specific adaptors of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.


Pssm-ID: 350570  Cd Length: 78  Bit Score: 51.86  E-value: 1.04e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507  170 LSTKNAVRFYDVSTKYGLEKVREKSMEVLLHQfwkIMTDR--EKLNEVDRQLFVTLLNSPNLLIIEGEFDLYKVVKSWIY 247
Cdd:cd18495   1 ISAKTVCSYYEAACMYGLTEVKKKCLEWLLRN---LMTSQnvTLLRELSIELMEQLIASPNLFVMQVEMDVYTLLKKWLF 77

                .
gi 6425507  248 M 248
Cdd:cd18495  78 L 78
BTB_POZ_KBTBD2_BKLHD1 cd18270
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
50-178 1.74e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 2 (KBTBD2); KBTBD2, also called BTB and kelch domain-containing protein 1 (BKLHD1), plays an essential role in the regulation of insulin-signaling pathway. It is a BTB-Kelch family substrate recognition subunit of the Cullin-3-based E3 ubiquitin ligase, which targets p85alpha, the regulatory subunit of the phosphoinositol-3-kinase (PI3K) heterodimer, causing p85alpha ubiquitination and proteasome-mediated degradation. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349579 [Multi-domain]  Cd Length: 133  Bit Score: 52.70  E-value: 1.74e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   50 VAKLNTCAYVYQKLFLqgenSDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVL 128
Cdd:cd18270  11 VSLLEQLKFFYEQQLL----TDIVLIVEGTEFPCHKMVLATcSSYFRAMFMSGLSESKQTHVHLR----NVDAATLQIII 82
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|
gi 6425507  129 GSLYHNEIEIDLDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKNAVRF 178
Cdd:cd18270  83 TYAYTGNLAINDSTVEQLYETACFLQVEDVLQRCREYLIKKINAENCVRL 132
BTB_POZ_KLHL11 cd18241
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-174 8.94e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 11 (KLHL11); KLHL11 is a component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, leading most often to their proteasomal degradation. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349550 [Multi-domain]  Cd Length: 135  Bit Score: 51.01  E-value: 8.94e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   66 QGENSDIVLA---ACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQME--ITDPNIDADGLNSVLGSLYHNEIEID 139
Cdd:cd18241  20 QGLFCDITLAfggAGGREFRAHRSVLAAaTEYFTPLLSGQFSESRSGRVEMRkwSSEPGPDPDTVEAVIQYMYTGRIRVS 99
                        90       100       110
                ....*....|....*....|....*....|....*
gi 6425507  140 LDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18241 100 TGNVHEVLELADRFLLIRLKEFCGEFLKKKLNLSN 134
BTB_POZ_KLHL30 cd18259
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
61-174 2.15e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 30 (KLHL30); KLHL30 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349568 [Multi-domain]  Cd Length: 137  Bit Score: 49.83  E-value: 2.15e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   61 QKLFLQGENSDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEITDPNIdadgLNSVLGSLYHNEIEID 139
Cdd:cd18259  24 QTLRSNPKLSDVTLLVGGREFPCHRSVLALcSHYFNAMFTGDFVESISARVEIKDVDPAV----MESLIDFAYTGKLTIN 99
                        90       100       110
                ....*....|....*....|....*....|....*
gi 6425507  140 LDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18259 100 QGNVEALIRTSNRLQFPTVRKVCSRYLQQQIDATN 134
BTB_POZ_KBTBD8 cd18274
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
53-176 2.92e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 8 (KBTBD8); KBTBD8, also called T-cell activation kelch repeat protein (TA-KRP), is a BTB-kelch family protein that is located in the Golgi apparatus and translocates to the spindle apparatus during mitosis. It acts as a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a regulator of neural crest specification. The BCR(KBTBD8) complex monoubiquitylates NOLC1 and its paralog TCOF1, the mutation of which underlies the neurocristopathy Treacher Collins syndrome. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349583 [Multi-domain]  Cd Length: 129  Bit Score: 49.22  E-value: 2.92e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   53 LNTCAYVYQ--KLFLQGENSDIVLAA-CGREWRVHKLYLKQ-TKFFESMFDGLWTESNsgrvQMEITDPNIDADGLNSVL 128
Cdd:cd18274   4 LHACSILQQlkAMYDEGQLTDIVVEVdHGKTFSCHRNVLAAiSPYFRSMFTSGLTEST----QKEVRIVGVEAESMHLVL 79
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*...
gi 6425507  129 GSLYHNEIEIDLDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKNAV 176
Cdd:cd18274  80 DYAYTSRVTLTEANVQALFTAASIFQIPSLQDQCAQFMISRLDPQNSI 127
BTB1_POZ_ABTB1_BPOZ1 cd18295
first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
61-144 4.92e-07

first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ankyrin repeat and BTB/POZ domain-containing protein 1 (ABTB1); ABTB1, also called elongation factor 1A-binding protein or bood POZ containing gene type 1 (BPOZ-1), is an anti-proliferative factor that may act as a mediator of the phosphatase and tensin homolog (PTEN) growth-suppressive signaling pathway. It may play a role in developmental processes. ABTB1 contains an ankyrin repeat and two BTB domains. This model corresponds to the first BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349604 [Multi-domain]  Cd Length: 119  Bit Score: 48.40  E-value: 4.92e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   61 QKLFLQGENSDIVLAACGREWRVHKLYLK-QTKFFESMFDGLWtesnSGRVQMEITDPNIDADGLNSVLGSLYHNEIEID 139
Cdd:cd18295  11 RRLLEQGSYSDVTFNVHGESFPAHRCILSaRSPYFAEMFETKW----KDKREINLKHPLVNPDAFRALLQYLYTGRLEIH 86

                ....*
gi 6425507  140 LDKIE 144
Cdd:cd18295  87 VDDVE 91
PHA03098 PHA03098
kelch-like protein; Provisional
82-210 4.96e-07

kelch-like protein; Provisional


Pssm-ID: 222983 [Multi-domain]  Cd Length: 534  Bit Score: 52.08  E-value: 4.96e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507    82 RVHKLYLKQ-TKFFESMFdglwtesNSGRVQMEITdPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAAASYIVLDSVTD 160
Cdd:PHA03098  24 KVHKIILSSsSEYFKKMF-------KNNFKENEIN-LNIDYDSFNEVIKYIYTGKINITSNNVKDILSIANYLIIDFLIN 95
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 6425507   161 RCSEMMIEALSTKNAVRFYDVSTKYGLEKVREKSMEVLLHQFWKIMTDRE 210
Cdd:PHA03098  96 LCINYIIKIIDDNNCIDIYRFSFFYGCKKLYSAAYNYIRNNIELIYNDPD 145
BTB_POZ_KLHL2-like cd18235
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
71-166 6.69e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins, KLHL2 and KLHL3; The family includes Kelch-like proteins, KLHL2 and KLHL3. KLHL2 is a novel actin-binding protein predominantly expressed in brain. It plays a role in the reorganization of the actin cytoskeleton, and promotes growth of cell projections in oligodendrocyte precursors. KLHL2 and KLHL3 each functions as a component of an E3 ubiquitin ligase complex that mediates the ubiquitination of target proteins. They contain a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349544 [Multi-domain]  Cd Length: 121  Bit Score: 47.81  E-value: 6.69e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18235  23 DVILVADGVEIPAHRVVLAScSPYFHAMFTGDLSESRANRVTLQ----DVDGKALLLLIDYVYTAEIQVTEENVQVLLPA 98
                        90
                ....*....|....*..
gi 6425507  150 ASYIVLDSVTDRCSEMM 166
Cdd:cd18235  99 ANLLQLTDVRDACCDFL 115
BTB_POZ_KLHL4 cd18336
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
71-176 1.59e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 4 (KLHL4); KLHL4 shares high identity and similarity with the Drosophila kelch protein, a component of ring canals. It may be associated with X-linked cleft palate (CPX) and is also a candidate gene in the impairment of mullerian duct development. In addition, it has been identified as a target of insulin-like growth factor binding protein 5 (IGFBP5). KLHL4 contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349645 [Multi-domain]  Cd Length: 126  Bit Score: 46.96  E-value: 1.59e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEITDPnidaDGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18336  21 DVLLIAGNLKIPAHRLVLSAvSDYFAAMFTNDVREAKQEEIKMEGVDP----DALKALVHYAYTGVLELKEDTIESLLAA 96
                        90       100
                ....*....|....*....|....*..
gi 6425507  150 ASYIVLDSVTDRCSEMMIEALSTKNAV 176
Cdd:cd18336  97 ACLLQLSQVIDVCCNFLMKQLHPSNCL 123
BTB_POZ_KLHL1-like cd18234
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-174 1.66e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins KLHL1, KLHL4 and KLHL5; This family contains the Kelch-like proteins: KLHL1, KLHL4 and KLHL5, all of which share high identity and similarity with the Drosophila kelch protein, a component of ring canals. KLHL1 is a neuronal actin-binding protein that modulates voltage-gated CaV2.1 (P/Q-type) and CaV3.2 (alpha1H T-type) calcium channels. Family members contain a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349543 [Multi-domain]  Cd Length: 105  Bit Score: 46.21  E-value: 1.66e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNsgrvQMEITDPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVA 148
Cdd:cd18234   2 CDVILIAGDRRIPAHRLVLSAvSDYFAAMFTNDVREAT----EEEIKLKDVDPDALWTLVQYCYTGRLELKEDNVESLLA 77
                        90       100
                ....*....|....*....|....*.
gi 6425507  149 AASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18234  78 TACLLQLSEVVEACCGFLMKQLHPSN 103
BTB2_POZ_BTBD8 cd18286
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
62-114 2.47e-06

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 8 (BTBD8); BTBD8 is a BTB-domain-containing Kelch-like protein that may play a role in developmental processes. It may also act as a protein-protein adaptor in a transcription complex and thus be involved in brain development. BTBD8 contains two BTB domains. This model corresponds to the second domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349595 [Multi-domain]  Cd Length: 121  Bit Score: 46.48  E-value: 2.47e-06
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....
gi 6425507   62 KLFLQGENSDIVLAACGREWRVHKLYLK-QTKFFESMFDGLWTESNSGRVQMEI 114
Cdd:cd18286  10 QLFLNGEDSDITIKVDGKTFKAHRCILCaRSSYFAAMLSGSWAESNSSEITLTG 63
BTB_POZ_KLHL18 cd18247
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
72-168 3.04e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 18 (KLHL18); KLHL18 acts as a substrate-specific adaptor for a Cullin3 E3 ubiquitin-protein ligase complex that regulates mitotic entry and ubiquitylates Aurora-A. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349556 [Multi-domain]  Cd Length: 116  Bit Score: 46.12  E-value: 3.04e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   72 IVLAACgrewrvhklylkqTKFFESMFDGLWTESNsgrvQMEITDPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAAAS 151
Cdd:cd18247  36 IVLAAT-------------IPYFHAMFTHDMVESK----QDEITMQGIEPSALEALINFAYSGRIAIDTSNVQSLLVGAS 98
                        90
                ....*....|....*..
gi 6425507  152 YIVLDSVTDRCSEMMIE 168
Cdd:cd18247  99 FLQLQSVKDACCEFLKE 115
BTB_POZ_KBTBD12 cd18276
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
68-176 3.96e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 12 (KBTBD12); KBTBD12, also called Kelch domain-containing protein 6 (KLHDC6), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349585 [Multi-domain]  Cd Length: 127  Bit Score: 45.95  E-value: 3.96e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   68 ENSDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLDKIEGT 146
Cdd:cd18276  20 ELTDVVLVAEGEKFPCHRLVLAAfSPYFKAMFTCGLMECSQREVVLH----DITAESVSIILNYMYSSDLHLTNSNVQGV 95
                        90       100       110
                ....*....|....*....|....*....|
gi 6425507  147 VAAASYIVLDSVTDRCSEMMIEALSTKNAV 176
Cdd:cd18276  96 ATAAFFLQMEDIFSVCQKYMMDHMDASNCL 125
BTB_POZ_KLHL17_actinfilin cd18246
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
71-170 4.03e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 17 (KLHL17); KLHL17, also called actinfilin, is a substrate-recognition component of some cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes. It acts as a Cullin 3 (Cul3) substrate adaptor that links GLUR6 to the E3 ubiquitin-ligase complex, and mediates the ubiquitination and subsequent degradation of GLUR6. It may play a role in actin-based neuronal function. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349555 [Multi-domain]  Cd Length: 139  Bit Score: 46.18  E-value: 4.03e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNsgrvQMEITDPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18246  41 DIVLHVGTKEIKAHKVVLAScSPYFHAMFTNEMSESR----QTHVTLHDIDPQALEQLVQYAYTAEIVVGEGNVQTLLPA 116
                        90       100
                ....*....|....*....|.
gi 6425507  150 ASYIVLDSVTDRCSEMMIEAL 170
Cdd:cd18246 117 ASLLQLNGVRDACCKFLLSQL 137
BTB_POZ_KLHL10 cd18240
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
59-174 4.68e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 10 (KLHL10); KLHL10 is a substrate-specific adaptor of a CUL3-based E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins specifically in the testis during spermatogenesis. Haploinsufficiency of Klhl10 causes infertility in male mice. KLHL10 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349549 [Multi-domain]  Cd Length: 120  Bit Score: 45.40  E-value: 4.68e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   59 VYQKLFLQGENSDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNsgrvQMEITDPNIDADGLNSVLGSLYHNEIE 137
Cdd:cd18240   7 VFNELRLEGKLCDVVIRVNGVEFPAHRNILCAcSPYFRALFTNGWNETE----KKVYKIPGVSPEMMELIIEYAYTRTVP 82
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 6425507  138 IDLDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18240  83 ITAENVEELLPAADQFNIMGIVKACCDFLEDQLCPEN 119
BTB_POZ_KLHL27_IPP cd18256
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
62-176 6.44e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in intracisternal A particle-promoted polypeptide (IPP); IPP, also called Kelch-like protein 27 (KLHL27) or actin-binding protein IPP, is an actin-binding protein that may play a role in organizing the actin cytoskeleton. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349565 [Multi-domain]  Cd Length: 125  Bit Score: 45.09  E-value: 6.44e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   62 KLFLQGENSDIVLAACGREWRVHKLYLKQTK-FFESMFDGLWTESNSGRVQMEITDPNIdadgLNSVLGSLYHNEIEIDL 140
Cdd:cd18256  13 KLRGQHEFCDVQLQVGMELFSVHRLVLAASSpYFAALFAGGMSESSKDVVQIHGVEPDI----FHILLDFIYTGVVEVTV 88
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 6425507  141 DKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKNAV 176
Cdd:cd18256  89 SNVQELLVAADMLQLTEVVEICCEFLKGQLHPSNCI 124
BTB_POZ_KLHL7 cd18237
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-174 8.45e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 7 (KLHL7); KLHL7 is a component of a Cul3-based E3 ubiquitin ligase complex and is involved in the ubiquitination of target proteins for proteasome-mediated degradation. Mutations in KLHL7 causes autosomal-dominant retinitis pigmentosa. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349546 [Multi-domain]  Cd Length: 126  Bit Score: 44.79  E-value: 8.45e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   66 QGENSDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEITDPNIdadgLNSVLGSLYHNEIEIDLDKIE 144
Cdd:cd18237  18 QKTLCDVILIVEGREIKAHRVVLAAaSHFFHLMFTSNMTESKSSEVELKDAEPDI----IELLVEFAYTARISVNSNNVQ 93
                        90       100       110
                ....*....|....*....|....*....|
gi 6425507  145 GTVAAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18237  94 SLLDAANQYQIEPVKKMCVDFLKEQLDASN 123
BTB_POZ_roadkill-like cd18345
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
63-175 1.28e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein roadkill and similar proteins; Drosophila melanogaster protein roadkill, also called Hh-induced MATH and BTB domain-containing protein (HIB), is a hedgehog-induced BTB protein that modulates hedgehog signaling by degrading Ci/Gli transcription factor. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349654 [Multi-domain]  Cd Length: 121  Bit Score: 44.45  E-value: 1.28e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   63 LFLQGENSDIVLAACGREWRVHKLYL-KQTKFFESMFDGLWTESNSGRVqmEITDpnIDADGLNSVLGSLYHNEIEiDLD 141
Cdd:cd18345  12 LFERSAFSDVTLCVGGREFQAHKAILaARSPVFNAMFEHEMEERKQNRV--EITD--VDHEVMREMLRFIYTGKAP-NLD 86
                        90       100       110
                ....*....|....*....|....*....|....*
gi 6425507  142 KI-EGTVAAASYIVLDSVTDRCSEMMIEALSTKNA 175
Cdd:cd18345  87 KMaDDLLAAADKYALERLKVMCEEALCSNLSVENV 121
BTB_POZ_KLHL8 cd18238
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
59-176 1.58e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 8 (KLHL8); KLHL8 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex required for the ubiquitination and degradation of rapsyn, a postsynaptic protein required for clustering of nicotinic acetylcholine receptors (nAChRs) at the neuromuscular junction. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349547 [Multi-domain]  Cd Length: 120  Bit Score: 43.82  E-value: 1.58e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   59 VYQKLFLQGENSDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVqmEITDpnIDADGLNSVLGSLYHNEIE 137
Cdd:cd18238   5 VLHQFYENGELCDVTLKVGEKSIHCHRLVLACvSPYFRAMFTSEMAESKQDSI--TIKD--IDEEAVELLVDFAYTGKLT 80
                        90       100       110
                ....*....|....*....|....*....|....*....
gi 6425507  138 IDLDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKNAV 176
Cdd:cd18238  81 LTVDNVQSLLYAASLLQVEEVAKACCEFMKDHLHPSNCL 119
BTB_POZ_SPOP-like cd18279
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-174 6.34e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in speckle-type POZ protein (SPOP) and similar proteins; This family includes speckle-type POZ protein (SPOP), speckle-type POZ protein-like (SPOPL), TD and POZ domain-containing proteins (TDPOZ), Drosophila melanogaster protein roadkill and similar proteins. Both, SPOP and SPOPL, serve as adaptors of cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes that mediate the ubiquitination and proteasomal degradation of target proteins. TDPOZ is a family of bipartite animal and plant proteins that contain a tumor necrosis factor receptor-associated factor (TRAF) domain (TD) and a POZ/BTB domains. TDPOZ proteins may be nuclear scaffold proteins probably involved in transcription regulation in early development and other cellular processes. Drosophila melanogaster protein roadkill, also called Hh-induced MATH and BTB domain-containing protein (HIB), is a hedgehog-induced BTB protein that modulates hedgehog signaling by degrading Ci/Gli transcription factor. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349588 [Multi-domain]  Cd Length: 120  Bit Score: 42.13  E-value: 6.34e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYL-KQTKFFESMFDGLWTESNSGRVqmEITDpnIDADGLNSVLGSLYHNEIEiDLDKI-EGTV 147
Cdd:cd18279  19 TDCCLCVGGQEFQAHKAILaARSPVFSAMFEHEMEESKKNRV--EIND--VDPEVFKEMMRFIYTGKAP-NLDKMaDDLL 93
                        90       100
                ....*....|....*....|....*..
gi 6425507  148 AAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18279  94 AAADKYALERLKVMCEDALCSNLSVEN 120
BTB_POZ_KLHL1 cd18335
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-176 7.19e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 1 (KLHL1); KLHL1 is a neuronal actin-binding protein that modulates voltage-gated CaV2.1 (P/Q-type) and CaV3.2 (alpha1H T-type) calcium channels. It may play a role in organizing the actin cytoskeleton the brain cells. KLHL1 contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349644 [Multi-domain]  Cd Length: 126  Bit Score: 42.34  E-value: 7.19e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   66 QGENSDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEITDPNidadGLNSVLGSLYHNEIEIDLDKIE 144
Cdd:cd18335  16 QQQLCDVILIAGNRKIPAHRLVLSAvSDYFAAMFTSDVCEAKQEEIKMEGIDPN----ALWDLVQFAYTGCLELKEDTIE 91
                        90       100       110
                ....*....|....*....|....*....|..
gi 6425507  145 GTVAAASYIVLDSVTDRCSEMMIEALSTKNAV 176
Cdd:cd18335  92 NLLAAACLLQLSQVVEVCCHFLMKLLHPSNCL 123
BTB_POZ_KLHL2_Mayven cd18338
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
71-170 1.12e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 2 (KLHL2); KLHL2, also called actin-binding protein Mayven, is a novel actin-binding protein predominantly expressed in the brain. It plays a role in the reorganization of the actin cytoskeleton, and promotes growth of cell projections in oligodendrocyte precursors. KLHL2 is a component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, such as NPTXR, leading most often to their proteasomal degradation. It contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349647 [Multi-domain]  Cd Length: 121  Bit Score: 41.60  E-value: 1.12e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18338  23 DVTIVAEDVEIAAHRVVLAAcSPYFHAMFTGEMSESRAKRVRIK----EVDGWTLKMLIDYVYTAEIQVTEENVQVLLPA 98
                        90       100
                ....*....|....*....|.
gi 6425507  150 ASYIVLDSVTDRCSEMMIEAL 170
Cdd:cd18338  99 AGLLQLQDVKKTCCEFLESQL 119
BTB_POZ_KLHL24_KRIP6 cd18253
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-174 1.16e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 24 (KLHL24); KLHL24, also called kainate receptor-interacting protein for GluR6 (KRIP6) or protein DRE1, is necessary to maintain the balance between intermediate filament stability and degradation, a process that is essential for skin integrity. KLHL24 is a component of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that mediates ubiquitination of KRT14 and controls its levels during keratinocyte differentiation. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349562 [Multi-domain]  Cd Length: 121  Bit Score: 41.74  E-value: 1.16e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLDKIEGTVA 148
Cdd:cd18253  19 TDVIICVEGREFPCHRAILSAcSSYFRAMFCNDHRESREMLVEIN----GILAEAMDCFLQYVYTGKVKITTENVQYLFE 94
                        90       100
                ....*....|....*....|....*.
gi 6425507  149 AASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18253  95 TSSLFQISPLRDACAKFLEEQLDPCN 120
BTB_POZ_KLHL35 cd18265
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-176 1.28e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 35 (KLHL35); KLHL35 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. Significant differences in DNA methylation of the KLHL35 gene in abdominal aortic aneurysm (AAA) patients compared to non-AAA controls suggest a potential role in AAA pathology. Hypermethylation of the KLHL35 gene has also been associated with the development of hepatocellular carcinoma. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349574 [Multi-domain]  Cd Length: 128  Bit Score: 41.68  E-value: 1.28e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLDKIEGTVA 148
Cdd:cd18265  24 TDVVLLVDGKDFPCHRATLSAnSAYFRAMFGGHLKESRQAVVEIQ----KVSAAAMEVLLDYMYGGGLRIQEDNVESVLE 99
                        90       100
                ....*....|....*....|....*...
gi 6425507  149 AASYIVLDSVTDRCSEMMIEALSTKNAV 176
Cdd:cd18265 100 ASDLLQVSKLREACVRFLEGQLHPCNCL 127
BTB_POZ_KLHL40_KBTBD5 cd18340
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
59-174 1.78e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 40 (KLHL40); KLHL40, also called Kelch repeat and BTB domain-containing protein 5 (KBTBD5) or sarcosynapsin, is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a key regulator of skeletal muscle development. Mutations in KLHL40 may cause severe autosomal-recessive nemaline myopathy. KLHL40 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349649 [Multi-domain]  Cd Length: 134  Bit Score: 41.36  E-value: 1.78e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   59 VYQKLFLQ---------GENSDIVLAACGREWRVHKLYLKQTK-FFESMFDGLWTESNSGRVQMEITDPNIdadgLNSVL 128
Cdd:cd18340   8 LYQQTLLQdglkdlldhNKFVDCVLKIKEKEFPCHRLVLAACSpYFRAMFLSDLEESKKREIVLEDVDPDV----MGKIL 83
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*.
gi 6425507  129 GSLYHNEIEIDLDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18340  84 HYIYTSEIEITEQNVQDIFAAANMFQIPSIFTVCVSFLQKRLCLSN 129
BTB_POZ_KLHL28_BTBD5 cd18257
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
60-170 1.88e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 28 (KLHL28); KLHL28, also called BTB/POZ domain-containing protein 5 (BTBD5), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349566 [Multi-domain]  Cd Length: 118  Bit Score: 40.99  E-value: 1.88e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   60 YQKLFLQGENS--------DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGS 130
Cdd:cd18257   1 HSEQLLQGLNLlrqhhelcDVVLRVGDVKIHAHKVVLAScSPYFKAMFTGNLSEKENSEVEFQ----CIDETALQAIVEY 76
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 6425507  131 LYHNEIEIDLDKIEGTVAAASYIVLDSVTDRCSEMMIEAL 170
Cdd:cd18257  77 AYTGTVFISQATVESLLPAANLLQIKLVLKECCDFLESQL 116
BTB_POZ_KLHL3 cd18339
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
71-166 1.90e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 3 (KLHL3); KLHL3 is a component of an E3 ubiquitin ligase complex that regulates blood pressure by targeting With-No-Lysine (WNK) kinases for degradation. It contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349648 [Multi-domain]  Cd Length: 121  Bit Score: 40.86  E-value: 1.90e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVqmEITDpnIDADGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18339  23 DVTIVAEDVEIEAHRVVLAAcSPYFCAMFTGDMSESKAKKI--EIKD--VDGQTLSKLIDYIYTAEIEVTEENVQVLLPA 98
                        90
                ....*....|....*..
gi 6425507  150 ASYIVLDSVTDRCSEMM 166
Cdd:cd18339  99 ASLLQLMDVRQNCCDFL 115
BTB_POZ_KLHL5 cd18337
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
71-176 2.89e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 5 (KLHL5); KLHL5 shares high identity and similarity with the Drosophila kelch protein, a component of ring canals. It is abundantly expressed in the ovary, adrenal gland, and thymus. It contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349646 [Multi-domain]  Cd Length: 130  Bit Score: 40.81  E-value: 2.89e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEITDPNidadGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18337  25 DVVLVAGDRRIPAHRLVLSSvSDYFAAMFTNDVREAKQEEIKMEGVEPN----ALWALVQYAYTGRLELKEDNIECLLST 100
                        90       100
                ....*....|....*....|....*..
gi 6425507  150 ASYIVLDSVTDRCSEMMIEALSTKNAV 176
Cdd:cd18337 101 ACLLQLSQVVEACCKFLMKQLHPSNCL 127
BTB_POZ_KLHL16_gigaxonin cd18245
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
71-166 3.38e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in gigaxonin; Gigaxonin, also called Kelch-like protein 16 (KLHL16), may be a cytoskeletal component that directly or indirectly plays an important role in neurofilament architecture. It may also act as a substrate-specific adaptor of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including tubulin folding cofactor B (TBCB), microtubule-associated protein MAP1B, and glial fibrillary acidic protein (GFAP). Gigaxonin is mutated in giant axonal neuropathy. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349554 [Multi-domain]  Cd Length: 111  Bit Score: 40.02  E-value: 3.38e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEITdpNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18245  16 DATLVVGGEEIPVQKNVLAAaSPYFRAKLNYNPPKDDGSTYKIELE--GISVEVMEEILDYIYTGQIKLSEDNIQDIVQA 93
                        90
                ....*....|....*..
gi 6425507  150 ASYIVLDSVTDRCSEMM 166
Cdd:cd18245  94 ADLLLMTDLKDLCCEFL 110
BTB_POZ_ARIA_plant cd18352
BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in ...
70-174 4.72e-04

BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in plant ARM repeat protein interacting with ABF2 (ARIA) and similar proteins; ARIA is an armadillo (ARM) repeat and BTB domain-containing protein that acts as a positive regulator of ABA response via the modulation of the transcriptional activity of ABF2, a transcription factor which controls ABA-dependent gene expression via the G-box-type ABA-responsive elements. ARIA is a novel abscisic acid signaling component. It negatively regulates seed germination and young seedling growth. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349661 [Multi-domain]  Cd Length: 116  Bit Score: 39.77  E-value: 4.72e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKL-YLKQTKFFESMFDGLWTESNSGRVQMeitdPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVA 148
Cdd:cd18352  14 SDVTFLVEGRRFYAHRIaLLASSDAFRAMFDGGYREKEARDIEI----PNIRWEVFELMMRFIYTGSVDITNDIAKDLLR 89
                        90       100
                ....*....|....*....|....*.
gi 6425507  149 AASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18352  90 AADQYLLEGLKRLCEYTIAQDLTLEN 115
BTB_POZ_KLHL6 cd18236
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
65-176 5.02e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 6 (KLHL6); KLHL6 is a BTB-kelch protein with a lymphoid tissue-restricted expression pattern. It is involved in B-lymphocyte antigen receptor signaling and germinal center formation. It belongs to the KLHL gene family, which is composed of an N-terminal BTB-POZ domain and four to six Kelch motifs in tandem. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349545 [Multi-domain]  Cd Length: 129  Bit Score: 39.83  E-value: 5.02e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   65 LQGENS--DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLD 141
Cdd:cd18236  18 LRLENSltDVILCVDSQEFSCHRVVLAAaSNYFRAMFCNDLKEKYEEKIIIK----GVDAETMQILLDYTYTSKVLITKQ 93
                        90       100       110
                ....*....|....*....|....*....|....*
gi 6425507  142 KIEGTVAAASYIVLDSVTDRCSEMMIEALSTKNAV 176
Cdd:cd18236  94 NVQRVLEAASLFQFLRMVDACASFLTEALHPENCV 128
BTB_POZ_ZBTB27-like cd18215
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-162 8.01e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in B-cell lymphoma 6 proteins, BCL-6 and BCL-6B; This family includes B-cell lymphoma 6 proteins, BCL-6 and BCL-6B. BCL-6 is a transcriptional repressor mainly required for germinal center (GC) formation and antibody affinity maturation, which have different mechanisms of action specific to the lineage and biological functions. BCL-6B is a sequence-specific transcriptional repressor in association with BCL-6. It may function in a narrow stage or be related to some events in the early B-cell development. Family members contain a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349524 [Multi-domain]  Cd Length: 113  Bit Score: 39.09  E-value: 8.01e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYLKQ-TKFFESMFdglwteSNSGRVQMEITD--PNIDADGLNSVLGSLYHNEIEIDLDKIEGT 146
Cdd:cd18215  20 TDVVLVVGREQFRAHKTVLMAcSGLFYSIF------TDQLKNNVSVINldPEIEPEGFRILLDFMYTSRLNLREGNIMAV 93
                        90
                ....*....|....*.
gi 6425507  147 VAAASYIVLDSVTDRC 162
Cdd:cd18215  94 MATAMYLQMEHVVDTC 109
BTB_POZ_KLHL15 cd18244
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
60-174 8.05e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 15 (KLHL15); KLHL15 is a substrate-specific adaptor for the Cullin3 E3 ubiquitin-protein ligase complex that targets the serine/threonine-protein phosphatase 2A (PP2A) subunit PPP2R5B for ubiquitination and subsequent proteasomal degradation, thus promoting exchange with other regulatory subunits. It also plays a key role in DNA damage response, favoring DNA double-strand repair through error-prone non-homologous end joining (NHEJ) over error-free, RBBP8-mediated homologous recombination (HR), by targeting the DNA-end resection factor RBBP8/CtIP for ubiquitination and subsequent proteasomal degradation. KLHL15 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349553 [Multi-domain]  Cd Length: 137  Bit Score: 39.55  E-value: 8.05e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   60 YQKLFLQGENSDIVLAACGREWRVHKLYL-KQTKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEI 138
Cdd:cd18244  21 FRALYEEGLLLDVTLVIEDHQFQAHKALLaTQSDYFRIMFTADMRERDQDKIHLK----GLTATGFSHVLQFMYYGTIEL 96
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 6425507  139 DLDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18244  97 SMLTVHEILQAAMYVQLTEVVKFCCSFLLAKICLDN 132
BTB_POZ_KBTBD4 cd18272
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-177 8.49e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 4 (KBTBD4); KBTBD4, also called BTB and kelch domain-containing protein 4 (BKLHD4), is a BTB-BACK-Kelch domain protein belonging to a large family of cullin-RING ubiquitin ligase adaptors that facilitate the ubiquitination of target substrates. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349581 [Multi-domain]  Cd Length: 140  Bit Score: 39.49  E-value: 8.49e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYLK-QTKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLDKIEGTVA 148
Cdd:cd18272  33 ADVTISVEGKEFQLHRLVLSaQSCFFRSMFTSNLKEARNRVIELK----DVSESVFQLLVDYIYHGTVKLRVEELQETYE 108
                        90       100
                ....*....|....*....|....*....
gi 6425507  149 AASYIVLDSVTDRCSEMMIEALSTKNAVR 177
Cdd:cd18272 109 VADMYQLTALFEECSRFLARTVQVRNCLQ 137
BTB_POZ_KLHL37_ENC1 cd18267
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
61-174 8.52e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ectoderm-neural cortex protein 1 (ENC-1); ENC-1 is also called Kelch-like protein 37 (KLHL37), nuclear matrix protein NRP/B, or p53-induced gene 10 protein. It is an actin-binding nuclear matrix protein that associates with p110(RB), and is involved in the regulation of neuronal process formation and in differentiation of neural crest cells. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349576 [Multi-domain]  Cd Length: 147  Bit Score: 39.59  E-value: 8.52e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   61 QKLFlqgenSDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMeitDPNIDADGLNSVLGSLYHNEIEID 139
Cdd:cd18267  37 QRLF-----TDVLLHAGNRSFPCHRAVLAAcSRYFEAMFSGGLKESQDSEVNF---HDSIHPEVLELLLDYAYSSRVIIN 108
                        90       100       110
                ....*....|....*....|....*....|....*
gi 6425507  140 LDKIEGTVAAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18267 109 EENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTN 143
BTB_POZ_BTBD17 cd18292
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
61-141 1.05e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 17 (BTBD17); BTBD17, also called galectin-3-binding protein-like, is a BTB domain-containing protein. Its function remains unclear. It may be associated with hepatocellular carcinoma. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349601 [Multi-domain]  Cd Length: 114  Bit Score: 38.81  E-value: 1.05e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   61 QKLFLQGENSDIVLAACGREWRVHKLYL-KQTKFFESMFDGLWTESNSgrvQMEIT---DPNIdADGLNSVLGSLYHNEI 136
Cdd:cd18292   9 AQLYNNEELSDIVLRVGGKVFHAHRLILaKSSDVFRVMLSNDWWSESK---QSEIElveDPEC-AAVFEKFLRYLYTGQI 84

                ....*
gi 6425507  137 EIDLD 141
Cdd:cd18292  85 SVNLE 89
BTB_POZ_KLHL38 cd18268
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-174 1.07e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 38 (KLHL38); KLHL38 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The KLHL38 gene is significantly up-regulated during diapause, a temporary arrest of development during early ontogeny. It may also function in preadipocyte differentiation in the chicken. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349577 [Multi-domain]  Cd Length: 129  Bit Score: 39.00  E-value: 1.07e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYL-KQTKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLDKIEGTVA 148
Cdd:cd18268  24 TDVILCTGDKEIPCHRNVLaSSSPYFRAMFCNNFRESSQAKVDLK----GIDSDVLDQIVDYVYTGEILITRDNVLPLME 99
                        90       100
                ....*....|....*....|....*.
gi 6425507  149 AASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18268 100 AASMLQYPKLFEACSLYLQDQLTPEN 125
BTB_POZ_KLHL21 cd18250
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-175 1.13e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 21 (KLHL21); KLHL21 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for efficient chromosome alignment and cytokinesis. The BCR(KLHL21) E3 ubiquitin ligase complex regulates localization of the chromosomal passenger complex (CPC) from chromosomes to the spindle midzone in anaphase and mediates the ubiquitination of aurora B. KLHL21 also targets IkappaB kinase-beta to regulate nuclear factor kappa-light chain enhancer of activated B cells (NF-kappaB) signaling negatively. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349559 [Multi-domain]  Cd Length: 124  Bit Score: 38.60  E-value: 1.13e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYL-KQTKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLDKIEGTVA 148
Cdd:cd18250  22 FDVTLCAGGREFPCHRTVLaAASSYFRAMFAGELRESRADRVVLH----GVSAEILGLLLDFSYTGRVTVTQDNVEALLR 97
                        90       100
                ....*....|....*....|....*..
gi 6425507  149 AASYIVLDSVTDRCSEMMIEALSTKNA 175
Cdd:cd18250  98 AADLFQFPSVKEACCAYLQQRLDVSNC 124
BTB_POZ_KLHL40-like cd18269
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
71-174 1.53e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins, KLHL40 and KLHL41; This family includes Kelch-like proteins, KLHL40 and KLHL41. KLHL40 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a key regulator of skeletal muscle development. KLHL41 is a novel kelch related protein that is involved in pseudopod elongation in transformed cells. They both contain a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349578 [Multi-domain]  Cd Length: 133  Bit Score: 38.54  E-value: 1.53e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   71 DIVLAACGREWRVHKLYLKQTK-FFESMFDGLWTESNSGRVQMEITDPNIdadgLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18269  29 DCVLKIGDKEFPCHRLVLAACSpYFRAMFLSDLEESKKKEVVLEDVDPDV----MGMILKYLYTSEIDLNDQNVQDIFAL 104
                        90       100
                ....*....|....*....|....*
gi 6425507  150 ASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18269 105 ASRFQIPSIFTVCVSYLQKRLSLSN 129
BTB_POZ_SPOPL cd18343
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-174 1.60e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in speckle-type POZ protein-like (SPOPL); SPOPL, also called HIB homolog 2 or Roadkill homolog 2, is a component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes that mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The complexes may contain homodimeric SPOPL or the heterodimers formed by speckle-type POZ protein (SPOP) and SPOPL, which are less efficient than ubiquitin ligase complexes containing only SPOP. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349652 [Multi-domain]  Cd Length: 123  Bit Score: 38.45  E-value: 1.60e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYLK-QTKFFESMFDGLWTESNSGRVQMEITDPNIdadgLNSVLGSLYHNEIEiDLDKI-EGTV 147
Cdd:cd18343  22 TDCSLFVGGQEFKAHKSILAaRSPVFNAMFEHEMEESKKNRVEINDVDPEV----FKEMMRFIYTGKAP-NLDKMaDNLL 96
                        90       100
                ....*....|....*....|....*..
gi 6425507  148 AAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18343  97 AAADKYALERLKVMCEEALCNNLSVEN 123
BTB_POZ_KLHL9_13 cd18239
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
83-174 2.09e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins KLHL9 and KLHL13; KLHL9 and KLHL13 (also called BTB and kelch domain-containing protein 2, or BKLHD2) are substrate-specific adaptors of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for mitotic progression and cytokinesis. The BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex mediates the ubiquitination of AURKB and controls the dynamic behavior of AURKB on mitotic chromosomes, thereby coordinating faithful mitotic progression and completion of cytokinesis. They contain a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349548 [Multi-domain]  Cd Length: 128  Bit Score: 38.25  E-value: 2.09e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   83 VHKLYLKQ-TKFFESMFDGLWTESNsgrvQMEITDPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAAASYIVLDSVTDR 161
Cdd:cd18239  39 VHRAMMASaSDYFKAMFTGGMKEQE----LMCIKLHGVSKIGLKNIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDF 114
                        90
                ....*....|...
gi 6425507  162 CSEMMIEALSTKN 174
Cdd:cd18239 115 CKVLLISGVTLEN 127
BTB_POZ_KLHL32 cd18261
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
71-174 2.09e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 32 (KLHL32); KLHL32, also called BTB and kelch domain-containing protein 5 (BKLHD5), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. Deletion of KLHL32 may be ssociated with Tourette syndrome and obsessive-compulsive disorder. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349570 [Multi-domain]  Cd Length: 133  Bit Score: 38.41  E-value: 2.09e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18261  30 DITLVAEEQKFHAHKAVLAAcSDYFRAMFSLCMVESEADEVNLH----GVTSLGLKQALDFAYTGQILLEPGVIQDVLAA 105
                        90       100
                ....*....|....*....|....*
gi 6425507  150 ASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18261 106 GSHLQLLELLSLCSHYLIQELNSFN 130
BTB_POZ_SPOP cd18342
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-175 3.16e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in speckle-type POZ protein (SPOP); SPOP, also called HIB homolog 1 or Roadkill homolog 1, is a novel nuclear speckle-type protein which serves as an adaptor of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and proteasomal degradation of target proteins, such as BRMS1, DAXX, PDX1/IPF1, GLI2 and GLI3. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349651 [Multi-domain]  Cd Length: 125  Bit Score: 37.39  E-value: 3.16e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYLK-QTKFFESMFDGLWTESNSGRVQMEITDPNIdadgLNSVLGSLYHNEIEiDLDKI-EGTV 147
Cdd:cd18342  23 TDCCLCVAGQEFQAHKAILAaRSPVFSAMFEHEMEESKKNRVEINDVEPEV----FKEMMCFIYTGKAP-NLDKMaDDLL 97
                        90       100
                ....*....|....*....|....*...
gi 6425507  148 AAASYIVLDSVTDRCSEMMIEALSTKNA 175
Cdd:cd18342  98 AAADKYALERLKVMCEDALCSNLSVENA 125
BTB_POZ_KLHL31_KBTBD1 cd18260
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
71-174 3.25e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 31 (KLHL31); KLHL31 is also called BTB and kelch domain-containing protein 6 (BKLHD6), Kelch repeat and BTB domain-containing protein 1 (KBTBD1), or Kelch-like protein KLHL. It is a transcriptional repressor in the MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE). It is also a novel modulator of canonical Wnt signaling, which is important for vertebrate myogenesis. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349569 [Multi-domain]  Cd Length: 120  Bit Score: 37.49  E-value: 3.25e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   71 DIVLAACGREWRVHKLYLKQ-TKFFESMFDglwTESNSGRVQMEitdpNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18260  20 DLTIATKTKSFDVHKVVMAScSEYFRNILK---KDPSLQRVELN----DISPLGLATVITYAYTGKLTLSLYTIGSTISA 92
                        90       100
                ....*....|....*....|....*
gi 6425507  150 ASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18260  93 ASYLQIHALVKMCCDFLMQEMNVEN 117
BTB_POZ_KBTBD6_7 cd18273
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
73-179 4.64e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing proteins KBTBD6 and KBTBD7; KBTBD6 and KBTBD7 are substrate adaptors of a cullin-3 RING ubiquitin ligase complex that mediates ubiquitylation and proteasomal degradation of T-lymphoma and metastasis gene 1 (TIAM1), a RAC1-specific guanine exchange factor (GEF), by cooperating with gamma-aminobutyric acid receptor-associated proteins (GABARAP). KBTBD7 may also act as a new transcriptional activator in mitogen-activated protein kinase (MAPK) signaling. They both contain a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349582 [Multi-domain]  Cd Length: 142  Bit Score: 37.50  E-value: 4.64e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   73 VLAACgrewrvhklylkqTKFFESMFDGLWTESnsgrVQMEITDPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAAASY 152
Cdd:cd18273  52 VLAAA-------------SPYFKSMFTGGLYES----KQETVTIHDVDSESMALIIDYCYTGRVTLSEANVQRLYAAANM 114
                        90       100
                ....*....|....*....|....*..
gi 6425507  153 IVLDSVTDRCSEMMIEALSTKNAVRFY 179
Cdd:cd18273 115 LQLEYVREACASFLARRLDLSNCVGIL 141
BTB_POZ_ZBTB27_BCL6 cd18331
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-162 4.64e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in B-cell lymphoma 6 protein (BCL-6); BCL-6 is also called B-cell lymphoma 5 protein (BCL-5), zinc finger and BTB domain-containing protein 27 (ZBTB27), protein LAZ-3, or zinc finger protein 51 (ZNF51). It is a transcriptional repressor mainly required for germinal center (GC) formation and antibody affinity maturation, which have different mechanisms of action specific to the lineage and biological functions. It represses its target genes by binding directly to the DNA sequence 5'-TTCCTAGAA-3' or indirectly by repressing the transcriptional activity of transcription factors. It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349640 [Multi-domain]  Cd Length: 118  Bit Score: 36.76  E-value: 4.64e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   70 SDIVLAACGREWRVHKLYLKQTkffESMFDGLWTESNSGRVQMEITDPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAA 149
Cdd:cd18331  25 TDVVIVVSREQFRAHKTVLMAC---SGLFYSIFTDQLKCNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMAT 101
                        90
                ....*....|...
gi 6425507  150 ASYIVLDSVTDRC 162
Cdd:cd18331 102 AMYLQMEHVVDTC 114
BTB_POZ_KBTBD3_BKLHD3 cd18271
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
73-174 4.73e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 3 (KBTBD3); KBTBD3, also called BTB and kelch domain-containing protein 3 (BKLHD3), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349580 [Multi-domain]  Cd Length: 130  Bit Score: 37.12  E-value: 4.73e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   73 VLAACgrewrvhklylkqTKFFESMFDGLWTESNSGRVqmeiTDPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAAASY 152
Cdd:cd18271  42 VLAAC-------------SDFFRAMFEVNMKERDDGSV----TISNLSPKAVKAFLDYAYTGKAEITDDNVEMFFQMSSF 104
                        90       100
                ....*....|....*....|..
gi 6425507  153 IVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18271 105 LQVSLLSKACSDFLIKSIDLTN 126
BTB_POZ_KLHL20_KLEIP cd18249
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
68-174 6.19e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 20 (KLHL20); KLHL20, also called Kelch-like ECT2-interacting protein (KLEIP) or Kelch-like protein X, is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex involved in interferon response and anterograde Golgi to endosome transport. KLHL20 plays a role in actin assembly at cell-cell contact sites of Madin-Darby canine kidney cells. It also controls endothelial migration and sprouting angiogenesis. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349558 [Multi-domain]  Cd Length: 128  Bit Score: 36.66  E-value: 6.19e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507   68 ENSDIVLAACGREWRVHKLYLKQ-TKFFESMFDGLWTESNsgrvQMEITDPNIDADGLNSVLGSLYHNEIEIDLDKIEGT 146
Cdd:cd18249  22 ELCDVVLVVGAKKIYAHRVILSAcSPYFRAMFTGELAESR----QTEVTIRDIDERAMELLIDFAYTSQITVEEGNVQTL 97
                        90       100
                ....*....|....*....|....*...
gi 6425507  147 VAAASYIVLDSVTDRCSEMMIEALSTKN 174
Cdd:cd18249  98 LPAACLLQLAEIQEVCCEFLKRQLDPSN 125
BACK_BTBD17 cd18493
BACK (BTB and C-terminal Kelch) domain found in BTB/POZ domain-containing protein 17 (BTBD17); ...
171-246 8.36e-03

BACK (BTB and C-terminal Kelch) domain found in BTB/POZ domain-containing protein 17 (BTBD17); BTBD17, also termed galectin-3-binding protein-like, is a BTB-domain-containing Kelch-like protein. Its function remains unclear. It may be involved in hepatocellular carcinoma development and progression.


Pssm-ID: 350568  Cd Length: 74  Bit Score: 34.86  E-value: 8.36e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 6425507  171 STKNAVRFYDVSTKYGLEKVREKSMEVLLHQFWKIMTDREKLNeVDRQLFVTLLNSPNLlIIEGEFDLYKVVKSWI 246
Cdd:cd18493   1 SVNHAVSWLQYAKMCGHKELAEACLEFIAWNFEKVLKSPDWLN-LDLDLLVSLLQSSDL-VVEDEYTLFQAVEKWL 74
BACK_BTBD16 cd18492
BACK (BTB and C-terminal Kelch) domain found in BTB/POZ domain-containing protein 16 (BTBD16); ...
170-252 8.61e-03

BACK (BTB and C-terminal Kelch) domain found in BTB/POZ domain-containing protein 16 (BTBD16); BTBD16 is a BTB-domain-containing Kelch-like protein. Its function remains unclear. BTBD16 SNPs may be bipolar disorder (BD) genetic susceptibility variants exhibiting genetic background-dependent effects.


Pssm-ID: 350567  Cd Length: 97  Bit Score: 35.73  E-value: 8.61e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6425507  170 LSTKNAVRFYDVSTKYGLEKVR---EKSMEV-LLHQfwkiMTDREKLNEVDRQLFVTLLNSPNLLIIEgEFDLYKVVKSW 245
Cdd:cd18492   1 IKSSTVCKFHRAACKYKQESLAtacERWLELnLVPQ----LSSQIYLRDLPLELLHKILKSPRLFTFN-EYSLYKTLCYW 75

                ....*..
gi 6425507  246 IYMREVP 252
Cdd:cd18492  76 VFLQLNP 82
BTB_POZ_BPM_plant cd18280
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
62-119 9.97e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in plant BTB/POZ-MATH (BPM) protein family; The BPM protein family includes Arabidopsis thaliana BTB/POZ and MATH domain-containing proteins, AtBPM1-6, and similar proteins from other plants. BPM protein, also called protein BTB-POZ and MATH domain, may act as a substrate-specific adaptor of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349589 [Multi-domain]  Cd Length: 121  Bit Score: 36.15  E-value: 9.97e-03
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 6425507   62 KLFLQGENSDIVLAACGREWRVHKLYLK-QTKFFESMFDGLWTESNSGRVQMEITDPNI 119
Cdd:cd18280   7 ALLESEEGADVTFNVDGEKFRAHKLVLAaRSPVFRSMLFGPMREENEGEIVIEDVEPPV 65
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH