NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|531106|emb|CAA55792|]
View 

SYT [Homo sapiens]

Protein Classification

SSXT and Med3 domain-containing protein (domain architecture ID 12059999)

SSXT and Med3 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SSXT pfam05030
SSXT protein (N-terminal region); The SSXT or SS18 protein is involved in synovial sarcoma in ...
18-77 1.10e-25

SSXT protein (N-terminal region); The SSXT or SS18 protein is involved in synovial sarcoma in humans. A SYT-SSX fusion gene resulting from the chromosomal translocation t(X;18) (p11;q11) is characteristic of synovial sarcomas. This translocation fuses the SSXT (SYT) gene from chromosome 18 to either of two homologous genes at Xp11, SSX1 or SSX2.


:

Pssm-ID: 335988  Cd Length: 60  Bit Score: 98.13  E-value: 1.10e-25
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 531106      18 GEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQS 77
Cdd:pfam05030   1 PPVNQATIQKLLDENSQLIQCIVEYQNKGRAQECMQYQQILHRNLVYLATIADSNQNIQQ 60
Med3 super family cl26459
Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is ...
73-221 4.32e-05

Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator subunit Hrs1/Med3 is a physical target for Cyc8-Tup1, a yeast transcriptional co-repressor.


The actual alignment was detected with superfamily member pfam11593:

Pssm-ID: 314474  Cd Length: 393  Bit Score: 45.12  E-value: 4.32e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 531106      73 QNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNM--PSDGMvggGPPAPHMQNQMNGQMPGpNHMPMQGPGPNQLNMT 150
Cdd:pfam11593 224 QAQQQQVQTPITAQGIATNPSMNAALPNPTPGMINSvsPTNVM---GTPLTNMMSPMGAVMAG-NAYSMPAGNQGGQFDM 299
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 531106     151 NSSMNMPSSSHGSMGGynhsvpssqsMPVQNQMTMSQGQP-----MGNYGPRPNMSMQPNQGPMMHQQPPSQQYNM 221
Cdd:pfam11593 300 QQSNGDNPNNNTNMNN----------TPLQSQLNLNNITPanilsMNTVGDPMNNDFQQQQQQQQSQQQPQNQYNM 365
 
Name Accession Description Interval E-value
SSXT pfam05030
SSXT protein (N-terminal region); The SSXT or SS18 protein is involved in synovial sarcoma in ...
18-77 1.10e-25

SSXT protein (N-terminal region); The SSXT or SS18 protein is involved in synovial sarcoma in humans. A SYT-SSX fusion gene resulting from the chromosomal translocation t(X;18) (p11;q11) is characteristic of synovial sarcomas. This translocation fuses the SSXT (SYT) gene from chromosome 18 to either of two homologous genes at Xp11, SSX1 or SSX2.


Pssm-ID: 335988  Cd Length: 60  Bit Score: 98.13  E-value: 1.10e-25
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 531106      18 GEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQS 77
Cdd:pfam05030   1 PPVNQATIQKLLDENSQLIQCIVEYQNKGRAQECMQYQQILHRNLVYLATIADSNQNIQQ 60
Med3 pfam11593
Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is ...
73-221 4.32e-05

Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator subunit Hrs1/Med3 is a physical target for Cyc8-Tup1, a yeast transcriptional co-repressor.


Pssm-ID: 314474  Cd Length: 393  Bit Score: 45.12  E-value: 4.32e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 531106      73 QNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNM--PSDGMvggGPPAPHMQNQMNGQMPGpNHMPMQGPGPNQLNMT 150
Cdd:pfam11593 224 QAQQQQVQTPITAQGIATNPSMNAALPNPTPGMINSvsPTNVM---GTPLTNMMSPMGAVMAG-NAYSMPAGNQGGQFDM 299
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 531106     151 NSSMNMPSSSHGSMGGynhsvpssqsMPVQNQMTMSQGQP-----MGNYGPRPNMSMQPNQGPMMHQQPPSQQYNM 221
Cdd:pfam11593 300 QQSNGDNPNNNTNMNN----------TPLQSQLNLNNITPanilsMNTVGDPMNNDFQQQQQQQQSQQQPQNQYNM 365
 
Name Accession Description Interval E-value
SSXT pfam05030
SSXT protein (N-terminal region); The SSXT or SS18 protein is involved in synovial sarcoma in ...
18-77 1.10e-25

SSXT protein (N-terminal region); The SSXT or SS18 protein is involved in synovial sarcoma in humans. A SYT-SSX fusion gene resulting from the chromosomal translocation t(X;18) (p11;q11) is characteristic of synovial sarcomas. This translocation fuses the SSXT (SYT) gene from chromosome 18 to either of two homologous genes at Xp11, SSX1 or SSX2.


Pssm-ID: 335988  Cd Length: 60  Bit Score: 98.13  E-value: 1.10e-25
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 531106      18 GEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQS 77
Cdd:pfam05030   1 PPVNQATIQKLLDENSQLIQCIVEYQNKGRAQECMQYQQILHRNLVYLATIADSNQNIQQ 60
Med3 pfam11593
Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is ...
73-221 4.32e-05

Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator subunit Hrs1/Med3 is a physical target for Cyc8-Tup1, a yeast transcriptional co-repressor.


Pssm-ID: 314474  Cd Length: 393  Bit Score: 45.12  E-value: 4.32e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 531106      73 QNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNM--PSDGMvggGPPAPHMQNQMNGQMPGpNHMPMQGPGPNQLNMT 150
Cdd:pfam11593 224 QAQQQQVQTPITAQGIATNPSMNAALPNPTPGMINSvsPTNVM---GTPLTNMMSPMGAVMAG-NAYSMPAGNQGGQFDM 299
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 531106     151 NSSMNMPSSSHGSMGGynhsvpssqsMPVQNQMTMSQGQP-----MGNYGPRPNMSMQPNQGPMMHQQPPSQQYNM 221
Cdd:pfam11593 300 QQSNGDNPNNNTNMNN----------TPLQSQLNLNNITPanilsMNTVGDPMNNDFQQQQQQQQSQQQPQNQYNM 365
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH