NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4008447|emb|CAA22454|]
View 

Transcription elongation factor 1 homolog [Caenorhabditis elegans]

Protein Classification

Elf1 domain-containing protein (domain architecture ID 10523973)

Elf1 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Elf1 pfam05129
Transcription elongation factor Elf1 like; This family of short proteins contains a putative ...
7-79 2.22e-37

Transcription elongation factor Elf1 like; This family of short proteins contains a putative zinc binding domain with four conserved cysteines. ELF1 has been identified as a transcription elongation factor in Saccharomyces cerevisiae.


:

Pssm-ID: 336020  Cd Length: 73  Bit Score: 119.59  E-value: 2.22e-37
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 4008447     7 KRKAPTKAKAVMPLDTQFNCPFCNHERVCEVKMDREKNVGYISCRVCSEDFQTNINYLSEPIDVYSDWVDACE 79
Cdd:pfam05129  1 SKPKKPKKKKKPKLPTVFDCPFCNHEKSVEVKIDKKDGIGILSCGVCGLSYQTEINPLSEPVDVYSDWIDACE 73
 
Name Accession Description Interval E-value
Elf1 pfam05129
Transcription elongation factor Elf1 like; This family of short proteins contains a putative ...
7-79 2.22e-37

Transcription elongation factor Elf1 like; This family of short proteins contains a putative zinc binding domain with four conserved cysteines. ELF1 has been identified as a transcription elongation factor in Saccharomyces cerevisiae.


Pssm-ID: 336020  Cd Length: 73  Bit Score: 119.59  E-value: 2.22e-37
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 4008447     7 KRKAPTKAKAVMPLDTQFNCPFCNHERVCEVKMDREKNVGYISCRVCSEDFQTNINYLSEPIDVYSDWVDACE 79
Cdd:pfam05129  1 SKPKKPKKKKKPKLPTVFDCPFCNHEKSVEVKIDKKDGIGILSCGVCGLSYQTEINPLSEPVDVYSDWIDACE 73
Elf1 COG4888
Transcription elongation factor Elf1, contains Zn-ribbon domain [Transcription];
1-83 8.13e-26

Transcription elongation factor Elf1, contains Zn-ribbon domain [Transcription];


Pssm-ID: 227225  Cd Length: 104  Bit Score: 91.41  E-value: 8.13e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4008447    1 MGKRKSKRKAPTKAKAvMPLDTQFNCPFCNHERVCEVKMDREKNVGYISCRVCSEDFQTNINYLSEPIDVYSDWVDACEQ 80
Cdd:COG4888   1 MGRRRRKRRKIIKRRP-QVLPKTFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSFECEVPELSEPVDVYSAWVDAYLE 79

                ...
gi 4008447   81 ANN 83
Cdd:COG4888  80 GRG 82
PRK14892 PRK14892
putative transcription elongation factor Elf1; Provisional
1-77 2.89e-07

putative transcription elongation factor Elf1; Provisional


Pssm-ID: 184886  Cd Length: 99  Bit Score: 43.89  E-value: 2.89e-07
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 4008447    1 MGKRKSKRKAPTKAKAVMPldTQFNCPFCNHERVcEVKMdrEKNVGYISCRVCSEDFQTNINYLSEPIDVYSDWVDA 77
Cdd:PRK14892  1 MGRRRKKRKKIIRPKPKLP--KIFECPRCGKVSI-SVKI--KKNIAIITCGNCGLYTEFEVPSVYDEVDVYNKFIDL 72
 
Name Accession Description Interval E-value
Elf1 pfam05129
Transcription elongation factor Elf1 like; This family of short proteins contains a putative ...
7-79 2.22e-37

Transcription elongation factor Elf1 like; This family of short proteins contains a putative zinc binding domain with four conserved cysteines. ELF1 has been identified as a transcription elongation factor in Saccharomyces cerevisiae.


Pssm-ID: 336020  Cd Length: 73  Bit Score: 119.59  E-value: 2.22e-37
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 4008447     7 KRKAPTKAKAVMPLDTQFNCPFCNHERVCEVKMDREKNVGYISCRVCSEDFQTNINYLSEPIDVYSDWVDACE 79
Cdd:pfam05129  1 SKPKKPKKKKKPKLPTVFDCPFCNHEKSVEVKIDKKDGIGILSCGVCGLSYQTEINPLSEPVDVYSDWIDACE 73
Elf1 COG4888
Transcription elongation factor Elf1, contains Zn-ribbon domain [Transcription];
1-83 8.13e-26

Transcription elongation factor Elf1, contains Zn-ribbon domain [Transcription];


Pssm-ID: 227225  Cd Length: 104  Bit Score: 91.41  E-value: 8.13e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4008447    1 MGKRKSKRKAPTKAKAvMPLDTQFNCPFCNHERVCEVKMDREKNVGYISCRVCSEDFQTNINYLSEPIDVYSDWVDACEQ 80
Cdd:COG4888   1 MGRRRRKRRKIIKRRP-QVLPKTFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSFECEVPELSEPVDVYSAWVDAYLE 79

                ...
gi 4008447   81 ANN 83
Cdd:COG4888  80 GRG 82
PRK14892 PRK14892
putative transcription elongation factor Elf1; Provisional
1-77 2.89e-07

putative transcription elongation factor Elf1; Provisional


Pssm-ID: 184886  Cd Length: 99  Bit Score: 43.89  E-value: 2.89e-07
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 4008447    1 MGKRKSKRKAPTKAKAVMPldTQFNCPFCNHERVcEVKMdrEKNVGYISCRVCSEDFQTNINYLSEPIDVYSDWVDA 77
Cdd:PRK14892  1 MGRRRKKRKKIIRPKPKLP--KIFECPRCGKVSI-SVKI--KKNIAIITCGNCGLYTEFEVPSVYDEVDVYNKFIDL 72
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH