NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|27372877|dbj|BAC53764|]
View 

phosphodiesterase 8B3 [Homo sapiens]

Protein Classification

PDE8 and HDc domain-containing protein (domain architecture ID 12095211)

protein containing domains PDE8, PAS, and HDc

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PDEase_I pfam00233
3'5'-cyclic nucleotide phosphodiesterase;
559-806 2.69e-99

3'5'-cyclic nucleotide phosphodiesterase;


:

Pssm-ID: 333946  Cd Length: 236  Bit Score: 307.93  E-value: 2.69e-99
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   559 YHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAF 638
Cdd:pfam00233   1 YHNWRHAADVAQTMYYLLKKGGLKNVLTDLEILALLIAALCHDVDHPGTNNAFLINTKSPLAILYNDRSVLENHHCATAF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   639 QLtVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFvnsinKPMAAEIEGSDcecnpagKNFPENQILIK 718
Cdd:pfam00233  81 KI-LSKEECNILSNLSADEYQEFRKLIIDLILATDMAKHFELLKKF-----KELVKISEKNL-------LNTEEDRLLLL 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   719 RMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVmPVFDRNTCSIPKSQISFIDYFITDMFDAW-DAFA 797
Cdd:pfam00233 148 QLLIKAADISNPTRPWEISKRWAERLMEEFFRQGDLEKELGLPVS-PLMDREKTNLPKSQIGFIDFIVLPLFEALaDLFP 226

                  ....*....
gi 27372877   798 HLPALMQHL 806
Cdd:pfam00233 227 ELQPLLDNL 235
PDE8 pfam08629
PDE8 phosphodiesterase; This region is found in members of the PDE8 phosphodiesterase family. ...
1-47 3.94e-28

PDE8 phosphodiesterase; This region is found in members of the PDE8 phosphodiesterase family. It is found with pfam00233.


:

Pssm-ID: 285793  Cd Length: 47  Bit Score: 106.61  E-value: 3.94e-28
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
gi 27372877     1 MGCAPSIHVSQSGVIYCRDSDESSSPRQTTSVSQGPAAPLPGLFVQT 47
Cdd:pfam08629   1 MGCAPSIHVSQSGVIYCRDSDESTSPNQTTTMSQGNAAPLPGLFIKT 47
PAS_9 pfam13426
PAS domain;
280-377 1.32e-12

PAS domain;


:

Pssm-ID: 338733 [Multi-domain]  Cd Length: 102  Bit Score: 64.41  E-value: 1.32e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   280 EAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTcikKGKEWQGVYYARRKSGDSIQQHV 359
Cdd:pfam13426   2 DGILITDEDGRIIYVNPAALRLLGYTREELLGKSLTDLFGEPEASEALEEALRE---GREVREVEVVLYRKDGEPFWVLV 78
                          90
                  ....*....|....*...
gi 27372877   360 KITPVIGQGGKIRHFVSL 377
Cdd:pfam13426  79 SASPIRDDGGELVGIIAI 96
PAS COG2202
PAS domain [Signal transduction mechanisms];
148-375 2.99e-08

PAS domain [Signal transduction mechanisms];


:

Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 55.24  E-value: 2.99e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 148 FWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRqtqnfDAEAVCRSIRATNPSEHTVILAVVSRVSDDHEEASVL 227
Cdd:COG2202   1 LILVLDRDGRIIYANEAAEELLGYSAEELLGLLLALHP-----EDRDRLRELLRRLLAGEELLSEELRLVRKDGEERWVE 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 228 PLLHAGFNRRF-MENSSIIACYNELIQIEHGEVRSQFKLRAcnsvftALDHCHEAIEITSDDHVIQYVNPAFERMMGYHK 306
Cdd:COG2202  76 LSAAPLRDGEGrVLGLLGLRDITERKRAEEALRESEERLRA------LLEASPDGIWVLDEDGRILYANPAAEELLGYSP 149
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 27372877 307 GELLGKELADL-PKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQ-HVKITPVIGQgGKIRHFV 375
Cdd:COG2202 150 EEELGRGLSDLiHPEDEERRELELARALAEGRGGPLEIEYRVRRKDGERVRWiLSRISPVRDD-GEIVGVV 219
 
Name Accession Description Interval E-value
PDEase_I pfam00233
3'5'-cyclic nucleotide phosphodiesterase;
559-806 2.69e-99

3'5'-cyclic nucleotide phosphodiesterase;


Pssm-ID: 333946  Cd Length: 236  Bit Score: 307.93  E-value: 2.69e-99
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   559 YHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAF 638
Cdd:pfam00233   1 YHNWRHAADVAQTMYYLLKKGGLKNVLTDLEILALLIAALCHDVDHPGTNNAFLINTKSPLAILYNDRSVLENHHCATAF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   639 QLtVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFvnsinKPMAAEIEGSDcecnpagKNFPENQILIK 718
Cdd:pfam00233  81 KI-LSKEECNILSNLSADEYQEFRKLIIDLILATDMAKHFELLKKF-----KELVKISEKNL-------LNTEEDRLLLL 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   719 RMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVmPVFDRNTCSIPKSQISFIDYFITDMFDAW-DAFA 797
Cdd:pfam00233 148 QLLIKAADISNPTRPWEISKRWAERLMEEFFRQGDLEKELGLPVS-PLMDREKTNLPKSQIGFIDFIVLPLFEALaDLFP 226

                  ....*....
gi 27372877   798 HLPALMQHL 806
Cdd:pfam00233 227 ELQPLLDNL 235
PDE8 pfam08629
PDE8 phosphodiesterase; This region is found in members of the PDE8 phosphodiesterase family. ...
1-47 3.94e-28

PDE8 phosphodiesterase; This region is found in members of the PDE8 phosphodiesterase family. It is found with pfam00233.


Pssm-ID: 285793  Cd Length: 47  Bit Score: 106.61  E-value: 3.94e-28
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
gi 27372877     1 MGCAPSIHVSQSGVIYCRDSDESSSPRQTTSVSQGPAAPLPGLFVQT 47
Cdd:pfam08629   1 MGCAPSIHVSQSGVIYCRDSDESTSPNQTTTMSQGNAAPLPGLFIKT 47
PAS_9 pfam13426
PAS domain;
280-377 1.32e-12

PAS domain;


Pssm-ID: 338733 [Multi-domain]  Cd Length: 102  Bit Score: 64.41  E-value: 1.32e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   280 EAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTcikKGKEWQGVYYARRKSGDSIQQHV 359
Cdd:pfam13426   2 DGILITDEDGRIIYVNPAALRLLGYTREELLGKSLTDLFGEPEASEALEEALRE---GREVREVEVVLYRKDGEPFWVLV 78
                          90
                  ....*....|....*...
gi 27372877   360 KITPVIGQGGKIRHFVSL 377
Cdd:pfam13426  79 SASPIRDDGGELVGIIAI 96
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
284-376 6.11e-10

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 56.87  E-value: 6.11e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 284 ITSDDHVIQYVNPAFERMMGYHKGELLGKELADL-PKSDknRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKIT 362
Cdd:cd00130   7 VLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLiHPED--REELRERLENLLSGGEPVTLEVRLRRKDGSVIWVLVSLT 84
                        90
                ....*....|....
gi 27372877 363 PVIGQGGKIRHFVS 376
Cdd:cd00130  85 PIRDEGGEVIGLLG 98
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
273-376 1.65e-08

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions]


Pssm-ID: 272971 [Multi-domain]  Cd Length: 124  Bit Score: 53.45  E-value: 1.65e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   273 TALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDkNRADLLDTINTCIKKGKEWQGVYYA-RRKS 351
Cdd:TIGR00229   7 AIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVLELIPEE-DREEVRERIERRLEGEPEPVSEERRvRRKD 85
                          90       100
                  ....*....|....*....|....*
gi 27372877   352 GDSIQQHVKITPVIGQGGkIRHFVS 376
Cdd:TIGR00229  86 GSEIWVEVSVSPIRTNGG-ELGVVG 109
PAS COG2202
PAS domain [Signal transduction mechanisms];
148-375 2.99e-08

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 55.24  E-value: 2.99e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 148 FWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRqtqnfDAEAVCRSIRATNPSEHTVILAVVSRVSDDHEEASVL 227
Cdd:COG2202   1 LILVLDRDGRIIYANEAAEELLGYSAEELLGLLLALHP-----EDRDRLRELLRRLLAGEELLSEELRLVRKDGEERWVE 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 228 PLLHAGFNRRF-MENSSIIACYNELIQIEHGEVRSQFKLRAcnsvftALDHCHEAIEITSDDHVIQYVNPAFERMMGYHK 306
Cdd:COG2202  76 LSAAPLRDGEGrVLGLLGLRDITERKRAEEALRESEERLRA------LLEASPDGIWVLDEDGRILYANPAAEELLGYSP 149
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 27372877 307 GELLGKELADL-PKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQ-HVKITPVIGQgGKIRHFV 375
Cdd:COG2202 150 EEELGRGLSDLiHPEDEERRELELARALAEGRGGPLEIEYRVRRKDGERVRWiLSRISPVRDD-GEIVGVV 219
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
559-749 3.80e-07

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032 [Multi-domain]  Cd Length: 145  Bit Score: 50.03  E-value: 3.80e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 559 YHNSTHAADVLHATAFFLGKERvkgsLDQLDEVAALIAATVHDVDHPGRTNSFlcnagselavlYNDTAVLESHHTALAF 638
Cdd:cd00077   1 EHRFEHSLRVAQLARRLAEELG----LSEEDIELLRLAALLHDIGKPGTPDAI-----------TEEESELEKDHAIVGA 65
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 639 QLtvkdtkcnifknIDRNHYRTLRQAIIDMVLATEMtKHFEHVNKFvnsinkpmaaeiegsdcecnPAGKNFPENQILIK 718
Cdd:cd00077  66 EI------------LRELLLEEVIKLIDELILAVDA-SHHERLDGL--------------------GYPDGLKGEEITLE 112
                       170       180       190
                ....*....|....*....|....*....|...
gi 27372877 719 RMMIKCADV--ANPCRPLDLCIEWAGRISEEYF 749
Cdd:cd00077 113 ARIVKLADRldALRRDSREKRRRIAEEDLEELL 145
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
273-317 5.97e-06

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 44.31  E-value: 5.97e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*
gi 27372877    273 TALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADL 317
Cdd:smart00091   5 AILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLEL 49
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic ...
557-655 7.44e-05

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679 [Multi-domain]  Cd Length: 124  Bit Score: 43.05  E-value: 7.44e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877    557 NAYHNSTHAADVLHaTAFFLGKErvkgsLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELavlyndtavlesHHTAL 636
Cdd:smart00471   1 SDYHVFEHSLRVAQ-LAAALAEE-----LGLLDIELLLLAALLHDIGKPGTPDSFLVKTSVLE------------DHHFI 62
                           90
                   ....*....|....*....
gi 27372877    637 AFQLTVKDTKCNIFKNIDR 655
Cdd:smart00471  63 GAEILLEEEEPRILEEILR 81
PRK13558 PRK13558
bacterio-opsin activator; Provisional
274-375 1.51e-04

bacterio-opsin activator; Provisional


Pssm-ID: 237426 [Multi-domain]  Cd Length: 665  Bit Score: 45.21  E-value: 1.51e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877  274 ALDHCHEAIEI---TSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNrADLLDTINTCIKKGKEWQGVYYARRK 350
Cdd:PRK13558 153 ALDEAPVGITIadaTLPDEPLIYINDAFERITGYSPDEVLGRNCRFLQGEDTN-EERVAELREAIDEERPTSVELRNYRK 231
                         90       100
                 ....*....|....*....|....*
gi 27372877  351 SGDSIQQHVKITPVIGQGGKIRHFV 375
Cdd:PRK13558 232 DGSTFWNQVDIAPIRDEDGTVTHYV 256
 
Name Accession Description Interval E-value
PDEase_I pfam00233
3'5'-cyclic nucleotide phosphodiesterase;
559-806 2.69e-99

3'5'-cyclic nucleotide phosphodiesterase;


Pssm-ID: 333946  Cd Length: 236  Bit Score: 307.93  E-value: 2.69e-99
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   559 YHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAF 638
Cdd:pfam00233   1 YHNWRHAADVAQTMYYLLKKGGLKNVLTDLEILALLIAALCHDVDHPGTNNAFLINTKSPLAILYNDRSVLENHHCATAF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   639 QLtVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFvnsinKPMAAEIEGSDcecnpagKNFPENQILIK 718
Cdd:pfam00233  81 KI-LSKEECNILSNLSADEYQEFRKLIIDLILATDMAKHFELLKKF-----KELVKISEKNL-------LNTEEDRLLLL 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   719 RMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVmPVFDRNTCSIPKSQISFIDYFITDMFDAW-DAFA 797
Cdd:pfam00233 148 QLLIKAADISNPTRPWEISKRWAERLMEEFFRQGDLEKELGLPVS-PLMDREKTNLPKSQIGFIDFIVLPLFEALaDLFP 226

                  ....*....
gi 27372877   798 HLPALMQHL 806
Cdd:pfam00233 227 ELQPLLDNL 235
PDE8 pfam08629
PDE8 phosphodiesterase; This region is found in members of the PDE8 phosphodiesterase family. ...
1-47 3.94e-28

PDE8 phosphodiesterase; This region is found in members of the PDE8 phosphodiesterase family. It is found with pfam00233.


Pssm-ID: 285793  Cd Length: 47  Bit Score: 106.61  E-value: 3.94e-28
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
gi 27372877     1 MGCAPSIHVSQSGVIYCRDSDESSSPRQTTSVSQGPAAPLPGLFVQT 47
Cdd:pfam08629   1 MGCAPSIHVSQSGVIYCRDSDESTSPNQTTTMSQGNAAPLPGLFIKT 47
PAS_9 pfam13426
PAS domain;
280-377 1.32e-12

PAS domain;


Pssm-ID: 338733 [Multi-domain]  Cd Length: 102  Bit Score: 64.41  E-value: 1.32e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   280 EAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTcikKGKEWQGVYYARRKSGDSIQQHV 359
Cdd:pfam13426   2 DGILITDEDGRIIYVNPAALRLLGYTREELLGKSLTDLFGEPEASEALEEALRE---GREVREVEVVLYRKDGEPFWVLV 78
                          90
                  ....*....|....*...
gi 27372877   360 KITPVIGQGGKIRHFVSL 377
Cdd:pfam13426  79 SASPIRDDGGELVGIIAI 96
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
284-376 6.11e-10

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 56.87  E-value: 6.11e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 284 ITSDDHVIQYVNPAFERMMGYHKGELLGKELADL-PKSDknRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKIT 362
Cdd:cd00130   7 VLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLiHPED--REELRERLENLLSGGEPVTLEVRLRRKDGSVIWVLVSLT 84
                        90
                ....*....|....
gi 27372877 363 PVIGQGGKIRHFVS 376
Cdd:cd00130  85 PIRDEGGEVIGLLG 98
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
273-375 6.85e-09

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 334337 [Multi-domain]  Cd Length: 112  Bit Score: 53.95  E-value: 6.85e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   273 TALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADL-PKSDknRADLLDTINTCIKKGKEWQGVYYA-RRK 350
Cdd:pfam00989   5 AILESLPDGIFVVDEDGRILYVNAAAEELLGLSREEVIGKSLLDLiPEDD--DAEVVELLRQALRQGEESRGFEVTfKLP 82
                          90       100
                  ....*....|....*....|....*
gi 27372877   351 SGDSIQQHVKITPVIGQGGKIRHFV 375
Cdd:pfam00989  83 DGRPRHVEVRASPVRDAGGEILGFL 107
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
273-376 1.65e-08

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions]


Pssm-ID: 272971 [Multi-domain]  Cd Length: 124  Bit Score: 53.45  E-value: 1.65e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   273 TALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDkNRADLLDTINTCIKKGKEWQGVYYA-RRKS 351
Cdd:TIGR00229   7 AIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVLELIPEE-DREEVRERIERRLEGEPEPVSEERRvRRKD 85
                          90       100
                  ....*....|....*....|....*
gi 27372877   352 GDSIQQHVKITPVIGQGGkIRHFVS 376
Cdd:TIGR00229  86 GSEIWVEVSVSPIRTNGG-ELGVVG 109
nifL_nitrog TIGR02938
nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation ...
274-379 1.66e-08

nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation positive regulator protein NifA, and is therefore a negative regulator. It binds NifA. NifA and NifL are encoded by adjacent genes. [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, Protein interactions]


Pssm-ID: 131984 [Multi-domain]  Cd Length: 494  Bit Score: 57.61  E-value: 1.66e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   274 ALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRaDLLDTINTCIKKGKEWQGVYYARRKSGD 353
Cdd:TIGR02938   9 TVDQAPLAISITDLKANILYANDAFTRITGYTKEEIIGKNESVLSNHTTPP-EVYQALWGSLAEQKPWAGKLLNRRKDGE 87
                          90       100
                  ....*....|....*....|....*.
gi 27372877   354 SIQQHVKITPVIGQGGKIRHFVSLKK 379
Cdd:TIGR02938  88 LYLAELTVAPVLNEAGETTHFLGMHR 113
PAS COG2202
PAS domain [Signal transduction mechanisms];
148-375 2.99e-08

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 55.24  E-value: 2.99e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 148 FWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRqtqnfDAEAVCRSIRATNPSEHTVILAVVSRVSDDHEEASVL 227
Cdd:COG2202   1 LILVLDRDGRIIYANEAAEELLGYSAEELLGLLLALHP-----EDRDRLRELLRRLLAGEELLSEELRLVRKDGEERWVE 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 228 PLLHAGFNRRF-MENSSIIACYNELIQIEHGEVRSQFKLRAcnsvftALDHCHEAIEITSDDHVIQYVNPAFERMMGYHK 306
Cdd:COG2202  76 LSAAPLRDGEGrVLGLLGLRDITERKRAEEALRESEERLRA------LLEASPDGIWVLDEDGRILYANPAAEELLGYSP 149
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 27372877 307 GELLGKELADL-PKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQ-HVKITPVIGQgGKIRHFV 375
Cdd:COG2202 150 EEELGRGLSDLiHPEDEERRELELARALAEGRGGPLEIEYRVRRKDGERVRWiLSRISPVRDD-GEIVGVV 219
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
293-376 1.73e-07

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 337058 [Multi-domain]  Cd Length: 89  Bit Score: 49.26  E-value: 1.73e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   293 YVNPAFERMMGYHKGELLGK--ELADLPKSDkNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKITPVIGQGGK 370
Cdd:pfam08447   3 YWSPRFEEILGYTPEELLGKgeSWLDLVHPD-DRERVREALWEALKGGEPYSGEYRIRRKDGEYRWVEARARPIRDENGK 81

                  ....*.
gi 27372877   371 IRHFVS 376
Cdd:pfam08447  82 PVRVIG 87
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
559-749 3.80e-07

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032 [Multi-domain]  Cd Length: 145  Bit Score: 50.03  E-value: 3.80e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 559 YHNSTHAADVLHATAFFLGKERvkgsLDQLDEVAALIAATVHDVDHPGRTNSFlcnagselavlYNDTAVLESHHTALAF 638
Cdd:cd00077   1 EHRFEHSLRVAQLARRLAEELG----LSEEDIELLRLAALLHDIGKPGTPDAI-----------TEEESELEKDHAIVGA 65
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877 639 QLtvkdtkcnifknIDRNHYRTLRQAIIDMVLATEMtKHFEHVNKFvnsinkpmaaeiegsdcecnPAGKNFPENQILIK 718
Cdd:cd00077  66 EI------------LRELLLEEVIKLIDELILAVDA-SHHERLDGL--------------------GYPDGLKGEEITLE 112
                       170       180       190
                ....*....|....*....|....*....|...
gi 27372877 719 RMMIKCADV--ANPCRPLDLCIEWAGRISEEYF 749
Cdd:cd00077 113 ARIVKLADRldALRRDSREKRRRIAEEDLEELL 145
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
273-317 5.97e-06

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 44.31  E-value: 5.97e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*
gi 27372877    273 TALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADL 317
Cdd:smart00091   5 AILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLEL 49
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic ...
557-655 7.44e-05

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679 [Multi-domain]  Cd Length: 124  Bit Score: 43.05  E-value: 7.44e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877    557 NAYHNSTHAADVLHaTAFFLGKErvkgsLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELavlyndtavlesHHTAL 636
Cdd:smart00471   1 SDYHVFEHSLRVAQ-LAAALAEE-----LGLLDIELLLLAALLHDIGKPGTPDSFLVKTSVLE------------DHHFI 62
                           90
                   ....*....|....*....
gi 27372877    637 AFQLTVKDTKCNIFKNIDR 655
Cdd:smart00471  63 GAEILLEEEEPRILEEILR 81
PAS_8 pfam13188
PAS domain;
273-331 1.25e-04

PAS domain;


Pssm-ID: 338623 [Multi-domain]  Cd Length: 65  Bit Score: 40.61  E-value: 1.25e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877   273 TALDHCHEAIEITSDDHVIQYVNPAFERMMGY-HKGELLGKELADLPKSDKNRADLLDTI 331
Cdd:pfam13188   5 ALFESSPDGILVLDRGGRIIYANPAALELLGYeLLGELLGELLPDLDPLLEDLLELLRAL 64
PRK13558 PRK13558
bacterio-opsin activator; Provisional
274-375 1.51e-04

bacterio-opsin activator; Provisional


Pssm-ID: 237426 [Multi-domain]  Cd Length: 665  Bit Score: 45.21  E-value: 1.51e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27372877  274 ALDHCHEAIEI---TSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNrADLLDTINTCIKKGKEWQGVYYARRK 350
Cdd:PRK13558 153 ALDEAPVGITIadaTLPDEPLIYINDAFERITGYSPDEVLGRNCRFLQGEDTN-EERVAELREAIDEERPTSVELRNYRK 231
                         90       100
                 ....*....|....*....|....*
gi 27372877  351 SGDSIQQHVKITPVIGQGGKIRHFV 375
Cdd:PRK13558 232 DGSTFWNQVDIAPIRDEDGTVTHYV 256
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH