NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|26354775|dbj|BAC41014|]
View 

unnamed protein product [Mus musculus]

Protein Classification

SCP_GAPR-1_like domain-containing protein (domain architecture ID 10143546)

SCP_GAPR-1_like domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CAP_GAPR1-like cd05382
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
8-139 2.18e-68

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of Golgi-associated plant pathogenesis-related protein 1 and similar proteins; Golgi-associated plant pathogenesis related protein 1 (GAPR1), also called Golgi-associated PR-1 protein or glioma pathogenesis-related protein 2 (GLIPR-2), forms amyloid-like fibrils in the presence of liposomes containing acidic phospholipids. It has been identified in mice as an up-regulated protein in kidney fibrosis, and is involved in epithelial to mesenchymal transition and in generating a pool of myofibroblasts contributing to fibrosis. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


:

Pssm-ID: 349401  Cd Length: 132  Bit Score: 202.83  E-value: 2.18e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775   8 QFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKRSPESSrgqCGENLAWAS---YDQAGKDVADRWY 84
Cdd:cd05382   1 VFQKECLKAHNEYRALHGAPPLKLDKELSKEAQKWAEKLASSGTLQHSSPSS---YGENLAYFSgsgYDLTGEEAVDSWY 77
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*
gi 26354775  85 SEIKSYNFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNI 139
Cdd:cd05382  78 NEIKNYNFNKPGFQSGTGHFTQVVWKSSTELGVGVAKSKDGCVYVVARYSPAGNV 132
 
Name Accession Description Interval E-value
CAP_GAPR1-like cd05382
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
8-139 2.18e-68

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of Golgi-associated plant pathogenesis-related protein 1 and similar proteins; Golgi-associated plant pathogenesis related protein 1 (GAPR1), also called Golgi-associated PR-1 protein or glioma pathogenesis-related protein 2 (GLIPR-2), forms amyloid-like fibrils in the presence of liposomes containing acidic phospholipids. It has been identified in mice as an up-regulated protein in kidney fibrosis, and is involved in epithelial to mesenchymal transition and in generating a pool of myofibroblasts contributing to fibrosis. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


Pssm-ID: 349401  Cd Length: 132  Bit Score: 202.83  E-value: 2.18e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775   8 QFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKRSPESSrgqCGENLAWAS---YDQAGKDVADRWY 84
Cdd:cd05382   1 VFQKECLKAHNEYRALHGAPPLKLDKELSKEAQKWAEKLASSGTLQHSSPSS---YGENLAYFSgsgYDLTGEEAVDSWY 77
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*
gi 26354775  85 SEIKSYNFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNI 139
Cdd:cd05382  78 NEIKNYNFNKPGFQSGTGHFTQVVWKSSTELGVGVAKSKDGCVYVVARYSPAGNV 132
SCP smart00198
SCP / Tpx-1 / Ag5 / PR-1 / Sc7 family of extracellular domains; Human glioma ...
11-135 3.39e-24

SCP / Tpx-1 / Ag5 / PR-1 / Sc7 family of extracellular domains; Human glioma pathogenesis-related protein GliPR and the plant pathogenesis-related protein represent functional links between plant defense systems and human immune system. This family has no known function.


Pssm-ID: 214553 [Multi-domain]  Cd Length: 144  Bit Score: 90.91  E-value: 3.39e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775     11 NEVLKAHNEYRAQHGV-----PPLKLCKKL--NREAQQYSEALASTRILKRSPesSRGQCGENLAWAS-----YDQAGKD 78
Cdd:smart00198   4 QEILDAHNKLRSQVAGgflaaPAASNMLKLtwDCELASSAQNWANQCPFGHST--PRPGYGENLAWWSsstalPDTYASA 81
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 26354775     79 VADRWYSEIKSYNFQQPGFT---SGTGHFTAMVWKNTKKIGVGKASASDGSS---FVVARYFP 135
Cdd:smart00198  82 AVQLWYDEFQDYGYSSNTCKdtnGKIGHYTQVVWAKTYKVGCGVANCPDGTKkktVVVCNYDP 144
CAP pfam00188
Cysteine-rich secretory protein family; This is a large family of cysteine-rich secretory ...
14-130 9.17e-20

Cysteine-rich secretory protein family; This is a large family of cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins (CAP) that are found in a wide range of organisms, including prokaryotes and non-vertebrate eukaryotes, The nine subfamilies of the mammalian CAP 'super'family include: the human glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), cysteine-rich secretory proteins (CRISPs), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), mannose receptor like and the R3H domain containing like proteins. Members are most often secreted and have an extracellular endocrine or paracrine function and are involved in processes including the regulation of extracellular matrix and branching morphogenesis, potentially as either proteases or protease inhibitors; in ion channel regulation in fertility; as tumor suppressor or pro-oncogenic genes in tissues including the prostate; and in cell-cell adhesion during fertilisation. The overall protein structural conservation within the CAP 'super'family results in fundamentally similar functions for the CAP domain in all members, yet the diversity outside of this core region dramatically alters the target specificity and, thus, the biological consequences. The Ca++-chelating function would fit with the various signalling processes (e.g. the CRISP proteins) that members of this family are involved in, and also the sequence and structural evidence of a conserved pocket containing two histidines and a glutamate. It also may explain how the cysteine-rich venom protein helothermine blocks the Ca++ transporting ryanodine receptors.


Pssm-ID: 333910  Cd Length: 117  Bit Score: 78.79  E-value: 9.17e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775    14 LKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTrilkrSPESSRGQCGENLAW----------ASYDQAGKDVADRW 83
Cdd:pfam00188   1 LDLHNELRAAAGLPPLSWDNTLAAAAQDHAKYCADN-----GSHNHRSPYGGNIYArvvaagyeniAAGDDSAEDAVNGW 75
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 26354775    84 YSEIKSYNfqqpgftsgTGHFTAMVWKNTKKIGVGKASASDGSSFVV 130
Cdd:pfam00188  76 YDSPGTYN---------CGHRTNLLWPKSTKVGCAVATCGDGGYGFV 113
YkwD COG2340
Uncharacterized conserved protein YkwD, contains CAP (CSP/antigen 5/PR1) domain [Function ...
2-118 1.03e-08

Uncharacterized conserved protein YkwD, contains CAP (CSP/antigen 5/PR1) domain [Function unknown];


Pssm-ID: 225218 [Multi-domain]  Cd Length: 207  Bit Score: 51.80  E-value: 1.03e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775   2 GKSASKQFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALAstrilKRSPESSRGQCGENLAWAsYDQAGkdVAD 81
Cdd:COG2340  73 SQSTLAQFEKAVVAETNQERAKHGLPPLAWNATLAKAARNHARDMA-----KNGYFSHTSPTGETPADR-LKKYG--ISG 144
                        90       100       110       120
                ....*....|....*....|....*....|....*....|...
gi 26354775  82 RWYSEIKSYNFQQP------GFTSGTGHFTAMVWKNTKKIGVG 118
Cdd:COG2340 145 ATAGENIAYGSNDPpeaavdGWLNSPGHRKNLLNPAYTEIGVG 187
 
Name Accession Description Interval E-value
CAP_GAPR1-like cd05382
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
8-139 2.18e-68

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of Golgi-associated plant pathogenesis-related protein 1 and similar proteins; Golgi-associated plant pathogenesis related protein 1 (GAPR1), also called Golgi-associated PR-1 protein or glioma pathogenesis-related protein 2 (GLIPR-2), forms amyloid-like fibrils in the presence of liposomes containing acidic phospholipids. It has been identified in mice as an up-regulated protein in kidney fibrosis, and is involved in epithelial to mesenchymal transition and in generating a pool of myofibroblasts contributing to fibrosis. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


Pssm-ID: 349401  Cd Length: 132  Bit Score: 202.83  E-value: 2.18e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775   8 QFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKRSPESSrgqCGENLAWAS---YDQAGKDVADRWY 84
Cdd:cd05382   1 VFQKECLKAHNEYRALHGAPPLKLDKELSKEAQKWAEKLASSGTLQHSSPSS---YGENLAYFSgsgYDLTGEEAVDSWY 77
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*
gi 26354775  85 SEIKSYNFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNI 139
Cdd:cd05382  78 NEIKNYNFNKPGFQSGTGHFTQVVWKSSTELGVGVAKSKDGCVYVVARYSPAGNV 132
CAP cd00168
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
11-134 2.18e-51

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain family; The CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain, also called SCP (sperm-coating glycoprotein), is found in eukaryotes and prokaryotes. This family includes plant pathogenesis-related protein 1 (PR-1), which accumulates after infections with pathogens, and may act as an anti-fungal agent or be involved in cell wall loosening. This family also includes CRISPs (cysteine-rich secretory proteins), which combine the CAP/SCP domain with a C-terminal cysteine rich domain, and allergen 5 from vespid venom. Roles for CRISP, in response to pathogens, fertilization, and sperm maturation have been proposed. One member, Tex31 from the venom duct of Conus textile, has been shown to possess proteolytic activity sensitive to serine protease inhibitors. The human GAPR-1 protein has been reported to dimerize, and such a dimer may form an active site containing a catalytic triad. CAP/SCP has also been proposed to be a Ca++ chelating serine protease. The Ca++-chelating function would fit with various signaling processes that members of this family, such as the CRISPs, are involved in, and is supported by sequence and structural evidence of a conserved pocket containing two histidines and a glutamate. It also may explain how helothermine, a toxic peptide secreted by the beaded lizard, blocks Ca++ transporting ryanodine receptors. Little is known about the biological roles of the bacterial and archaeal CAP/SCP domains.


Pssm-ID: 349397  Cd Length: 128  Bit Score: 159.71  E-value: 2.18e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  11 NEVLKAHNEYRAQH-----GVPPLKLCKKLNREAQQYSEALastrILKRSPESSRGQCGENLAWASYDQAGKDVADRWYS 85
Cdd:cd00168   2 QEILDLHNSYRSSVsppasNMPLMAWDQELADVAIGYAKDC----IFSHSSPTSRQLAGENIAASSYDMDGVAALQAWHN 77
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|.
gi 26354775  86 EIKSYNFQ--QPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYF 134
Cdd:cd00168  78 EIKNYNFGtaQPGFNSGTGHYTQMVWEKTTKLGCGVADCSDNSKFVVCNYI 128
CAP_PRY1-like cd05384
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
8-141 4.57e-34

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of pathogen-related yeast 1 (PRY1) protein and similar fungal proteins; PRY1, also called pathogenesis-related protein 1, is a yeast protein that is up-regulated in core ESCRT mutants. It is a secreted protein required for efficient export of lipids such as acetylated sterols, and acts in detoxification of hydrophobic compounds. This PRY1-like group also contains fruiting body proteins SC7/14 from Schizophyllum commune. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


Pssm-ID: 349403  Cd Length: 129  Bit Score: 115.89  E-value: 4.57e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775   8 QFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKRSPessrGQCGENLAwASYdQAGKDVADRWYSEI 87
Cdd:cd05384   1 SFASSILDAHNKKRALHGTQPLTWNDTLAEYAQDYADSYDCSGNLVHSG----GPYGENLA-LGY-SSGAAAVDAWYDEI 74
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*
gi 26354775  88 KSYNFQQPGFTSGTGHFTAMVWKNTKKIGVG-KASASDGSSFVVARYFPAGNIVN 141
Cdd:cd05384  75 SDYDYSNPGFSESTGHFTQLVWKSTTQVGCAyKDCGGAWGLYIVCEYDPAGNVIG 129
CAP_PR-1 cd05381
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
12-142 3.59e-29

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of pathogenesis-related protein 1 (PR-1) family proteins; Members of pathogenesis-related protein 1 (PR-1) family are among the most abundantly produced proteins in plants on pathogen attack. They are considered hallmarks of hypersensitive response/defense pathways and may act as anti-fungal agents or be involved in cell wall loosening.


Pssm-ID: 349400  Cd Length: 136  Bit Score: 103.48  E-value: 3.59e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  12 EVLKAHNEYRAQHGVPPLKLCKKLNREAQQYsealASTRILKRSPESSRGQCGENLAWASYDQ-AGKDVADRWYSEIKSY 90
Cdd:cd05381   3 DFLDAHNQARAAVGVPPLVWDDTLAAYAQKY----ANQRRGDCSLVHSNGPYGENLFWGSGDNwSPADAVKSWVDEKPYY 78
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  91 NfqqpgFTSGT-------GHFTAMVWKNTKKIGVGKASAS-DGSSFVVARYFPAGNIVNQ 142
Cdd:cd05381  79 D-----YASNTcvggkmcGHYTQVVWRNSTRLGCARVVCDnNGGTFVICNYDPPGNYIGE 133
SCP smart00198
SCP / Tpx-1 / Ag5 / PR-1 / Sc7 family of extracellular domains; Human glioma ...
11-135 3.39e-24

SCP / Tpx-1 / Ag5 / PR-1 / Sc7 family of extracellular domains; Human glioma pathogenesis-related protein GliPR and the plant pathogenesis-related protein represent functional links between plant defense systems and human immune system. This family has no known function.


Pssm-ID: 214553 [Multi-domain]  Cd Length: 144  Bit Score: 90.91  E-value: 3.39e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775     11 NEVLKAHNEYRAQHGV-----PPLKLCKKL--NREAQQYSEALASTRILKRSPesSRGQCGENLAWAS-----YDQAGKD 78
Cdd:smart00198   4 QEILDAHNKLRSQVAGgflaaPAASNMLKLtwDCELASSAQNWANQCPFGHST--PRPGYGENLAWWSsstalPDTYASA 81
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 26354775     79 VADRWYSEIKSYNFQQPGFT---SGTGHFTAMVWKNTKKIGVGKASASDGSS---FVVARYFP 135
Cdd:smart00198  82 AVQLWYDEFQDYGYSSNTCKdtnGKIGHYTQVVWAKTYKVGCGVANCPDGTKkktVVVCNYDP 144
CAP_euk cd05380
Eukaryotic CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 ...
11-133 3.54e-24

Eukaryotic CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins; The CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain is found mainly in eukaryotes. This family includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), and allergen 5 from vespid venom.


Pssm-ID: 349399  Cd Length: 144  Bit Score: 90.98  E-value: 3.54e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  11 NEVLKAHNEYRAQH------------GVPPLKLCKKLNREAQQYsealASTRILKRSPESSRGQCGENLAWASY-----D 73
Cdd:cd05380   2 QEILDAHNELRSKVakgklkglppaaNMPKLKWDCELAKLAQNW----AKTCVFAHSPCRNTGGVGQNLASVSSsgkdlK 77
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 26354775  74 QAGKDVADRWYSEIKSYNFQQ---PGFTSGTGHFTAMVWKNTKKIGVGKASASDGS---SFVVARY 133
Cdd:cd05380  78 ELIEDAVNAWFDELKDYGFGSnpnNNFNSGIGHFTQMVWAKTTKVGCAVARCPKGGgnkTYVVCNY 143
CAP pfam00188
Cysteine-rich secretory protein family; This is a large family of cysteine-rich secretory ...
14-130 9.17e-20

Cysteine-rich secretory protein family; This is a large family of cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins (CAP) that are found in a wide range of organisms, including prokaryotes and non-vertebrate eukaryotes, The nine subfamilies of the mammalian CAP 'super'family include: the human glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), cysteine-rich secretory proteins (CRISPs), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), mannose receptor like and the R3H domain containing like proteins. Members are most often secreted and have an extracellular endocrine or paracrine function and are involved in processes including the regulation of extracellular matrix and branching morphogenesis, potentially as either proteases or protease inhibitors; in ion channel regulation in fertility; as tumor suppressor or pro-oncogenic genes in tissues including the prostate; and in cell-cell adhesion during fertilisation. The overall protein structural conservation within the CAP 'super'family results in fundamentally similar functions for the CAP domain in all members, yet the diversity outside of this core region dramatically alters the target specificity and, thus, the biological consequences. The Ca++-chelating function would fit with the various signalling processes (e.g. the CRISP proteins) that members of this family are involved in, and also the sequence and structural evidence of a conserved pocket containing two histidines and a glutamate. It also may explain how the cysteine-rich venom protein helothermine blocks the Ca++ transporting ryanodine receptors.


Pssm-ID: 333910  Cd Length: 117  Bit Score: 78.79  E-value: 9.17e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775    14 LKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTrilkrSPESSRGQCGENLAW----------ASYDQAGKDVADRW 83
Cdd:pfam00188   1 LDLHNELRAAAGLPPLSWDNTLAAAAQDHAKYCADN-----GSHNHRSPYGGNIYArvvaagyeniAAGDDSAEDAVNGW 75
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 26354775    84 YSEIKSYNfqqpgftsgTGHFTAMVWKNTKKIGVGKASASDGSSFVV 130
Cdd:pfam00188  76 YDSPGTYN---------CGHRTNLLWPKSTKVGCAVATCGDGGYGFV 113
CAP_CRISP cd05383
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
11-136 8.07e-16

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of cysteine-rich secretory proteins; Cysteine-rich secretory proteins (CRISPs) are two-domain proteins with an evolutionary diverse and structurally conserved N-terminal CAP domain and a C-terminal cysteine-rich domain, which is comprised of a hinge and an ICR (ion channel regulator) region. CRISPs are involved in response to pathogens, fertilization, and sperm maturation. One member, Tex31 from the venom duct of Conus textile, has been shown to possess proteolytic activity sensitive to serine protease inhibitors. CRISP-1 has been shown to mediate gamete fusion by binding to the egg surface. Other members of the CRISP family secreted in the testis (CRISP2), epididymis (CRISP3-4), or during ejaculation (CRISP3), are also involved in sperm-egg interaction, supporting the existence of a functional redundancy and cooperation between homolog proteins ensuring the success of fertilization. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1) and allergen 5 from vespid venom, among others.


Pssm-ID: 349402  Cd Length: 139  Bit Score: 69.30  E-value: 8.07e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  11 NEVLKAHNEYRAQhGVPP----LKLckKLNREAQQYSEALASTRILKRSPESSR----GQCGENLAWASYDQAGKDVADR 82
Cdd:cd05383   4 QEIVDLHNALRRS-VNPPasnmLKM--SWNPEAAENAQRWANRCNFTHSPPNGRtipgIRCGENIFMSSYPASWSEVIQA 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 26354775  83 WYSEIKSYNFQ----QPGftSGTGHFTAMVWKNTKKIGVGKASASDGSS---FVVARYFPA 136
Cdd:cd05383  81 WYDEYKDFKYGvgakPPG--SVTGHYTQVVWYSSYLVGCAVAYCPSQGSlkyFYVCQYCPA 139
CAP_bacterial cd05379
Bacterial CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 ...
10-130 2.56e-12

Bacterial CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins; Little is known about bacterial and archaeal members of the CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain family. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others. Studies of eukaryotic proteins show that CAP domains have several functions, including the binding of cholesterol, lipids and heparan sulfate. This group includes Borrelia burgdorferi outer surface protein BB0689, which does not bind to cholesterol, lipids, or heparan sulfate, and whose function is unknown.


Pssm-ID: 349398  Cd Length: 120  Bit Score: 59.70  E-value: 2.56e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  10 NNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKRSPESSRGQC-----------GENLAWASYDqaGKD 78
Cdd:cd05379   1 EQEVLELINEYRAKAGLPPLSWDPRLEKAAQDHAEDMAANGYFSHTGPDGSSDRaaragywyrgaGENIAYGQGS--AEE 78
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|..
gi 26354775  79 VADRWYSEIksynfqqpgftsgtGHFTAMVWKNTKKIGVGKASASDGSSFVV 130
Cdd:cd05379  79 AVNQWINSP--------------GHRANILDPDFTEIGVGVAYNSSGGTYWT 116
CAP_PI16_HrTT-1 cd05559
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
13-118 2.71e-12

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of peptidase inhibitor 16 and HrTT-1 protein; Human peptidase inhibitor 16 (PI16) is also called cysteine-rich secretory protein 9 (CRISP-9) or PSP94-binding protein. Mouse PI16 is also called cysteine-rich protease inhibitor. PI16 is predominantly expressed by cardiac fibroblasts and is exposed to the interstitium via a glycophosphatidylinositol (-GPI) membrane anchor. It suppresses the activation of the chemokine chemerin in the myocardium, which may be a part of the cardiac stress response. At high endothelial shear stress, PI16 is an inflammation-regulated inhibitor of matrix metalloproteinase 2 (MMP2). Also included in this subfamily is the HrTT-1 protein, a tail-tip epidermis marker in ascidians. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


Pssm-ID: 349405  Cd Length: 134  Bit Score: 60.12  E-value: 2.71e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  13 VLKAHNEYRAQHGVPPLKLCK-KLNREAQQYSEALASTRILKRSPEssRGQCGENL-AWASYDQAGKDVADRWYSEIKSY 90
Cdd:cd05559   4 LVDLHNQYRSQVSPSAANMLKmTWDTELEALAKAYARKCIWEHNPD--RGRVGENLfASTGKPLDVELAVEDWHNEKEYY 81
                        90       100       110
                ....*....|....*....|....*....|
gi 26354775  91 NFQQPGFTSGT--GHFTAMVWKNTKKIGVG 118
Cdd:cd05559  82 NFETKTCAPGKmcGHYTQVVWANTEKIGCG 111
YkwD COG2340
Uncharacterized conserved protein YkwD, contains CAP (CSP/antigen 5/PR1) domain [Function ...
2-118 1.03e-08

Uncharacterized conserved protein YkwD, contains CAP (CSP/antigen 5/PR1) domain [Function unknown];


Pssm-ID: 225218 [Multi-domain]  Cd Length: 207  Bit Score: 51.80  E-value: 1.03e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775   2 GKSASKQFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALAstrilKRSPESSRGQCGENLAWAsYDQAGkdVAD 81
Cdd:COG2340  73 SQSTLAQFEKAVVAETNQERAKHGLPPLAWNATLAKAARNHARDMA-----KNGYFSHTSPTGETPADR-LKKYG--ISG 144
                        90       100       110       120
                ....*....|....*....|....*....|....*....|...
gi 26354775  82 RWYSEIKSYNFQQP------GFTSGTGHFTAMVWKNTKKIGVG 118
Cdd:COG2340 145 ATAGENIAYGSNDPpeaavdGWLNSPGHRKNLLNPAYTEIGVG 187
CAP_GLIPR1-like cd05385
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
9-137 4.35e-08

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of glioma pathogenesis-related protein 1 and similar proteins; Glioma pathogenesis-related protein 1 (GLIPR1) is also called related to testes-specific, vespid, and pathogenesis protein 1 (RTVP-1). The GLIPR1 gene has been identified as a p53 target gene and was shown to be methylated and down-regulated in prostate cancer. It is a novel broad-spectrum tumor suppressor whose proapoptotic properties are exerted in part through ROS-JNK signaling. GLIPR1 is composed of a signal peptide that directs its secretion, a CAP domain, and a transmembrane domain. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


Pssm-ID: 349404  Cd Length: 148  Bit Score: 48.94  E-value: 4.35e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775   9 FNNEVLKAHNEYRAqhGV-PPLKLCKKL--NREAQQYSEALASTRILKRSPESS-RGQC-------GENLaW--ASYDQA 75
Cdd:cd05385   2 FIDECVRIHNELRS--KVsPPAANMRYMswDKALAKTARAWARKCKFSHNICLKePGKChpnfttlGENI-WlgSIFSFS 78
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  76 GKDVADRWYSEIKSYNFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFV--------VARYFPAG 137
Cdd:cd05385  79 VESAITSWYNEVKDYNFKTNSCSRVCGHYTQVVWADSYKVGCAVHVCPNGGGFFsgsssaifVCNYGPAG 148
CAP_CRISPLD2 cd18816
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
12-116 8.15e-07

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of cysteine-rich secretory protein LCCL domain-containing 2; Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2) is also called cysteine-rich secretory protein 11 (CRSIP-11), LCCL domain-containing cysteine-rich secretory protein 2 (LCRISP2), or CAP and LCCL domain containing protein 2 (CAPLD2). It plays a role in the etiology of NSCLP (non-syndromic cleft lip with or without cleft palate). It is required for neural crest cell migration and cell viability during craniofacial development. The CRISPLD2 gene has been identified a glucocorticoid responsive gene that modulates cytokine function in airway smooth muscle cells. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


Pssm-ID: 349410  Cd Length: 146  Bit Score: 45.74  E-value: 8.15e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  12 EVLKAHNEYRAQhgVPPLKLCKKL---NREAQQYSEALASTRILKRSPESSRGQCGENLA--WASYDQAGKDVaDRWYSE 86
Cdd:cd18816   3 EILQLHNKLRGQ--VYPSASNMEYmtwDDELERSAEAWAQQCIWEHGPTSLLPSIGQNLAvhWGRYRSPAFHV-QSWYDE 79
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 26354775  87 IKSYNFQQPG--------FTSG--TGHFTAMVWKNTKKIG 116
Cdd:cd18816  80 VKDYTYPYPHecnpwcpeRCSGpmCTHYTQIVWATTNKVG 119
CAP_PI15-like cd18812
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
11-116 4.20e-06

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of peptidase inhibitor 15 and similar proteins; This family is composed of peptidase inhibitor 15 (PI15), peptidase inhibitor R3HDML, cysteine-rich secretory protein LCCL domain-containing 1 (CRISPLD1), and cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2). PI15 is a serine protease inhibitor which displays weak inhibitory activity against trypsin and may play a role in facial patterning during embryonic development. The PI15 gene is a candidate gene for abdominal aortic internal elastic lamina ruptures in the rat. R3HDML is a putative serine protease inhibitor, whose gene may be associated with clinical dimensions of schizophrenia. CRISPLD1 may play a role in NSCLP (nonsyndromic cleft lip with or without cleft palate) through the interaction with CRISPLD2 and folate pathway genes. plays a role in the etiology of NSCLP and is required for neural crest cell migration and cell viability during craniofacial development. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


Pssm-ID: 349406  Cd Length: 146  Bit Score: 43.74  E-value: 4.20e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  11 NEVLKAHNEYRAQHgVPPLKLCKKL--NREAQQYSEALASTRILKRSPESSRGQCGENLA--WASYDQAGkDVADRWYSE 86
Cdd:cd18812   2 NAILDYHNKLRGQV-YPPAANMEYMvwDKELARSAEAWATQCIWEHGPSSLLRSIGQNLSahWGRYRSPV-FLVKSWYDE 79
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 26354775  87 IKSYNFQQPG----------FTSGTGHFTAMVWKNTKKIG 116
Cdd:cd18812  80 VKDYLFPYPRdcnphcpwrcSGPMCTHYTQMVWATSNRIG 119
CAP_CRISPLD1 cd18813
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
13-116 3.19e-04

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of cysteine-rich secretory protein LCCL domain-containing 1; Cysteine-rich secretory protein LCCL domain-containing 1 (CRISPLD1) is also called cysteine-rich secretory protein 10 (CRISP-10), CocoaCrisp, LCCL domain-containing cysteine-rich secretory protein 1 (LCRISP1), or CAP and LCCL domain containing protein 1 (CAPLD1). CRISPLD1 is clearly distinct from CRISPs because they do not contain the 10 absolutely conserved cysteines or the ICR (ion channel regulator) domain of the CRISPs. It may play a role in NSCLP (nonsyndromic cleft lip with or without cleft palate) through the interaction with CRISPLD2 and folate pathway genes. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


Pssm-ID: 349407  Cd Length: 146  Bit Score: 38.45  E-value: 3.19e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  13 VLKAHNEYRAQHgVPPLKLCKKL--NREAQQYSEALASTRILKRSPESSRGQCGENLA--WASYDQAGKDVaDRWYSEIK 88
Cdd:cd18813   4 ILDLHNKLRGQV-YPPASNMEYMtwDVELERSAEAWAETCLWEHGPAHLLPSIGQNLGahWGRYRPPTFHV-QAWYDEVR 81
                        90       100       110
                ....*....|....*....|....*....|....*...
gi 26354775  89 SYNF---QQ-----PGFTSG--TGHFTAMVWKNTKKIG 116
Cdd:cd18813  82 DFSYpypQEcnpycPFRCSGpvCTHYTQVVWATSNRIG 119
CAP_PI15 cd18814
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
13-116 6.98e-04

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of peptidase inhibitor 15; Peptidase inhibitor 15 (PI15) is also called 25 kDa trypsin inhibitor (p25TI), cysteine-rich secretory protein 8 (CRISP-8), or SugarCrisp. It is a serine protease inhibitor which displays weak inhibitory activity against trypsin and may play a role in facial patterning during embryonic development. The PI15 gene is a candidate gene for abdominal aortic internal elastic lamina ruptures in the rat. PI15 may also participate in the regulation of drug resistance in ovarian cancer and serve as a potential target in targeted therapies. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


Pssm-ID: 349408  Cd Length: 146  Bit Score: 37.67  E-value: 6.98e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  13 VLKAHNEYRAQHgVPPLKLCKKL--NREAQQYSEALASTRILKRSPESSRGQCGENLA-----WASYDQAGKDvadrWYS 85
Cdd:cd18814   4 ILDYHNQVRGKV-FPPAANMEYMvwDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSvrtgrYRSILQLVKP----WYD 78
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 26354775  86 EIKSYNFQQPG----------FTSGTGHFTAMVWKNTKKIG 116
Cdd:cd18814  79 EVKDYAFPYPQdcnprcplrcYGPMCTHYTQMVWATSNRIG 119
CAP_R3HDML cd18815
CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain ...
11-124 2.14e-03

CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of peptidase inhibitor R3HDML; Peptidase inhibitor R3HDML, also called cysteine-rich secretory protein R3HDML, is a putative serine protease inhibitor. The R3HDML gene may be associated with clinical dimensions of schizophrenia. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.


Pssm-ID: 349409  Cd Length: 146  Bit Score: 36.03  E-value: 2.14e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354775  11 NEVLKAHNEYRAQHGVPPLKL-----CKKLNREAqqysEALASTRILKRSPESSRGQCGENLAWASydqaGK-----DVA 80
Cdd:cd18815   2 NALLDYHNRVRSQVFPPAANMeymvwDERLAKSA----EAWAAQCVWEHGPPQLMRYIGQNLSIHS----GRyrsivDLV 73
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....
gi 26354775  81 DRWYSEIKSY--------NFQQPGFTSGT--GHFTAMVWKNTKKIGVGKASASD 124
Cdd:cd18815  74 KSWYDERQHYsfphprecNPRCPSKCSGAvcSHYTQMVWASSNRIGCAVHTCSN 127
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH