NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|26354661|dbj|BAC40957|]
View 

unnamed protein product [Mus musculus]

Protein Classification

SPRY_SOCS1-2-4 and SOCS domain-containing protein (domain architecture ID 10191528)

SPRY_SOCS1-2-4 and SOCS domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SPRY_SOCS1-2-4 cd12906
SPRY domain in the suppressor of cytokine signaling 1, 2, 4 families (SOCS1, SOCS2, SOCS4); ...
54-227 5.74e-139

SPRY domain in the suppressor of cytokine signaling 1, 2, 4 families (SOCS1, SOCS2, SOCS4); The SPRY domain-containing SOCS box protein family (SPSB1-4, also known as SSB-1 to -4) is composed of a central SPRY protein interaction domain and a C-terminal SOCS box. All four SPSB proteins interact with c-Met, the hepatocyte growth factor receptor, but only SPSB1, SPSB2, and SPSB4 interact with prostate apoptosis response protein 4 (Par-4). They are negative regulators that recruit the ECS E3 ubiquitin ligase complex to polyubiquitinate inducible nitric-oxide synthase (iNOS), resulting in its proteasomal degradation, thus contributing to protection against the cytotoxic effect of iNOS in activated macrophages. It has been shown that SPSB1 and SPSB4 induce the degradation of iNOS more strongly than SPSB2. The Drosophila melanogaster SPSB1 homolog, GUSTAVUS, interacts with the DEAD box RNA helicase Vasa. Suppressor of cytokine signaling (SOCS) proteins negatively regulate signaling from JAK-associated cytokine receptor complexes, and play key roles in the regulation of immune homeostasis.


:

Pssm-ID: 293963  Cd Length: 174  Bit Score: 388.14  E-value: 5.74e-139
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  54 HSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLRSVGYTTLV 133
Cdd:cd12906   1 HAWNPDDRSLNIFVKEDDPLTFHRHPVAQSTDCIRGKVGYSRGLHVWEITWPTRQRGTHAVVGVATKDAPLHCVGYTSLV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661 134 GNNHESWGWDLGHNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVV 213
Cdd:cd12906  81 GSNEESWGWDIGRNKLYHDSKNQPGWTYPAFLEPDENFVVPDKFLVVLDMDEGTLSFVVDGQYLGVAFRGLKGKKLYPIV 160
                       170
                ....*....|....
gi 26354661 214 SAVWGHCEIRMRYL 227
Cdd:cd12906 161 SAVWGHCEVTMKYI 174
SOCS super family cl02533
SOCS (suppressors of cytokine signaling) box. The SOCS box is found in the C-terminal region ...
232-273 9.76e-23

SOCS (suppressors of cytokine signaling) box. The SOCS box is found in the C-terminal region of CIS/SOCS family proteins (in combination with a SH2 domain), ASBs (ankyrin repeat-containing proteins with a SOCS box), SSBs (SPRY domain-containing proteins with a SOCS box), and WSBs (WD40 repeat-containing proteins with a SOCS box), as well as, other miscellaneous proteins. The function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


The actual alignment was detected with superfamily member cd03744:

Pssm-ID: 351789  Cd Length: 42  Bit Score: 87.73  E-value: 9.76e-23
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 26354661 232 PEPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03744   1 PEPLPLMDLCRRSVRLALGRERLSEIHTLPLPASLKNYLLYQ 42
 
Name Accession Description Interval E-value
SPRY_SOCS1-2-4 cd12906
SPRY domain in the suppressor of cytokine signaling 1, 2, 4 families (SOCS1, SOCS2, SOCS4); ...
54-227 5.74e-139

SPRY domain in the suppressor of cytokine signaling 1, 2, 4 families (SOCS1, SOCS2, SOCS4); The SPRY domain-containing SOCS box protein family (SPSB1-4, also known as SSB-1 to -4) is composed of a central SPRY protein interaction domain and a C-terminal SOCS box. All four SPSB proteins interact with c-Met, the hepatocyte growth factor receptor, but only SPSB1, SPSB2, and SPSB4 interact with prostate apoptosis response protein 4 (Par-4). They are negative regulators that recruit the ECS E3 ubiquitin ligase complex to polyubiquitinate inducible nitric-oxide synthase (iNOS), resulting in its proteasomal degradation, thus contributing to protection against the cytotoxic effect of iNOS in activated macrophages. It has been shown that SPSB1 and SPSB4 induce the degradation of iNOS more strongly than SPSB2. The Drosophila melanogaster SPSB1 homolog, GUSTAVUS, interacts with the DEAD box RNA helicase Vasa. Suppressor of cytokine signaling (SOCS) proteins negatively regulate signaling from JAK-associated cytokine receptor complexes, and play key roles in the regulation of immune homeostasis.


Pssm-ID: 293963  Cd Length: 174  Bit Score: 388.14  E-value: 5.74e-139
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  54 HSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLRSVGYTTLV 133
Cdd:cd12906   1 HAWNPDDRSLNIFVKEDDPLTFHRHPVAQSTDCIRGKVGYSRGLHVWEITWPTRQRGTHAVVGVATKDAPLHCVGYTSLV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661 134 GNNHESWGWDLGHNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVV 213
Cdd:cd12906  81 GSNEESWGWDIGRNKLYHDSKNQPGWTYPAFLEPDENFVVPDKFLVVLDMDEGTLSFVVDGQYLGVAFRGLKGKKLYPIV 160
                       170
                ....*....|....
gi 26354661 214 SAVWGHCEIRMRYL 227
Cdd:cd12906 161 SAVWGHCEVTMKYI 174
SOCS_SSB1 cd03744
SOCS (suppressors of cytokine signaling) box of SSB1 (SPRY domain-containing SOCS box proteins) ...
232-273 9.76e-23

SOCS (suppressors of cytokine signaling) box of SSB1 (SPRY domain-containing SOCS box proteins)-like proteins. SSB proteins contain a central SPRY domain and a C-terminal SOCS. SSB1 has been shown to bind to MET, the receptor protein-tyrosine kinase for hepatocyte growth factor (HGF), both the absence and the presence of HGF and enhances the HGF-MET-induced mitogen-activated protein kinases Erk-transcription factor Elk-1-serum response elements (SRE) pathway. SSB1, like SSB2 and SSB4, also interacts with prostate apoptosis response protein-4. Both types of interactions are mediated through the SPRY domain. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239713  Cd Length: 42  Bit Score: 87.73  E-value: 9.76e-23
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 26354661 232 PEPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03744   1 PEPLPLMDLCRRSVRLALGRERLSEIHTLPLPASLKNYLLYQ 42
SPRY pfam00622
SPRY domain; SPRY Domain is named from SPla and the RYanodine Receptor. Domain of unknown ...
98-228 2.29e-19

SPRY domain; SPRY Domain is named from SPla and the RYanodine Receptor. Domain of unknown function. Distant homologs are domains in butyrophilin/marenostrin/pyrin homologs.


Pssm-ID: 334177  Cd Length: 121  Bit Score: 81.22  E-value: 2.29e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661    98 HVWQITWaMRQRGTHAVVGVATADAPLRSVGYttlVGNNHESWGWDLGHNRLYHDGKNQPskTYPAFLEPdetfivPDSF 177
Cdd:pfam00622   2 HYFEVEI-FGQDPGGWRVGWATKDYPRKGERF---LGDDSGSWGYDGWNGKKYWASTSPL--TGLPLFEP------GDVI 69
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 26354661   178 LVALDMDDGTLSFIVDGQYMGVAFRGLKG-KKLYPVVSAVWGHCEIRMRYLN 228
Cdd:pfam00622  70 GCFLDYEEGTISFTKNGKSLGYAFRDVPFtGPLFPAVSLGSGEGLQFNLGLR 121
SPRY smart00449
Domain in SPla and the RYanodine Receptor; Domain of unknown function. Distant homologues are ...
95-226 3.30e-19

Domain in SPla and the RYanodine Receptor; Domain of unknown function. Distant homologues are domains in butyrophilin/marenostrin/pyrin homologues.


Pssm-ID: 214669  Cd Length: 122  Bit Score: 80.80  E-value: 3.30e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661     95 RGLHVWQITWamrQRGTHAVVGVATADAPLrsvGYTTLVGNNHESWGWDLGHNRLYHDGKnqpSKTYPAFLEPDetfivP 174
Cdd:smart00449   1 SGRHYFEVEI---GDGGHWRVGVATKSVPR---GYFALLGEDKGSWGYDGDGGKKYHNST---GPEYGLPLQEP-----G 66
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....
gi 26354661    175 DSFLVALDMDDGTLSFIVDGQY-MGVAFRGLK-GKKLYPVVSaVWGHCEIRMRY 226
Cdd:smart00449  67 DVIGCFLDLEAGTISFYKNGKYlHGLAFFDVKfSGPLYPAFS-LGSGNSVRLNF 119
SOCS_box pfam07525
SOCS box; The SOCS box acts as a bridge between specific substrate- binding domains and more ...
234-271 2.73e-12

SOCS box; The SOCS box acts as a bridge between specific substrate- binding domains and more generic proteins that comprise a large family of E3 ubiquitin protein ligases.


Pssm-ID: 336723  Cd Length: 38  Bit Score: 59.70  E-value: 2.73e-12
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 26354661   234 PLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLL 271
Cdd:pfam07525   1 PRSLQHLCRLAIRRALGKRRLHGIDKLPLPPRLKDYLL 38
SOCS_box smart00969
The SOCS box acts as a bridge between specific substrate- binding domains and more generic ...
235-273 7.91e-08

The SOCS box acts as a bridge between specific substrate- binding domains and more generic proteins that comprise a large family of E3 ubiquitin protein ligases;


Pssm-ID: 198037  Cd Length: 34  Bit Score: 47.40  E-value: 7.91e-08
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 26354661    235 LPLMDLCRRSVRlalgkERLGAIPALPLPASLKAYLLYQ 273
Cdd:smart00969   1 RSLQHLCRLAIR-----RSLGGIDKLPLPPRLKDYLLYY 34
 
Name Accession Description Interval E-value
SPRY_SOCS1-2-4 cd12906
SPRY domain in the suppressor of cytokine signaling 1, 2, 4 families (SOCS1, SOCS2, SOCS4); ...
54-227 5.74e-139

SPRY domain in the suppressor of cytokine signaling 1, 2, 4 families (SOCS1, SOCS2, SOCS4); The SPRY domain-containing SOCS box protein family (SPSB1-4, also known as SSB-1 to -4) is composed of a central SPRY protein interaction domain and a C-terminal SOCS box. All four SPSB proteins interact with c-Met, the hepatocyte growth factor receptor, but only SPSB1, SPSB2, and SPSB4 interact with prostate apoptosis response protein 4 (Par-4). They are negative regulators that recruit the ECS E3 ubiquitin ligase complex to polyubiquitinate inducible nitric-oxide synthase (iNOS), resulting in its proteasomal degradation, thus contributing to protection against the cytotoxic effect of iNOS in activated macrophages. It has been shown that SPSB1 and SPSB4 induce the degradation of iNOS more strongly than SPSB2. The Drosophila melanogaster SPSB1 homolog, GUSTAVUS, interacts with the DEAD box RNA helicase Vasa. Suppressor of cytokine signaling (SOCS) proteins negatively regulate signaling from JAK-associated cytokine receptor complexes, and play key roles in the regulation of immune homeostasis.


Pssm-ID: 293963  Cd Length: 174  Bit Score: 388.14  E-value: 5.74e-139
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  54 HSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLRSVGYTTLV 133
Cdd:cd12906   1 HAWNPDDRSLNIFVKEDDPLTFHRHPVAQSTDCIRGKVGYSRGLHVWEITWPTRQRGTHAVVGVATKDAPLHCVGYTSLV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661 134 GNNHESWGWDLGHNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVV 213
Cdd:cd12906  81 GSNEESWGWDIGRNKLYHDSKNQPGWTYPAFLEPDENFVVPDKFLVVLDMDEGTLSFVVDGQYLGVAFRGLKGKKLYPIV 160
                       170
                ....*....|....
gi 26354661 214 SAVWGHCEIRMRYL 227
Cdd:cd12906 161 SAVWGHCEVTMKYI 174
SPRY_SOCS_Fbox cd12875
SPRY domain in Fbxo45 and suppressors of cytokine signaling (SOCS) proteins; This family ...
54-227 1.44e-106

SPRY domain in Fbxo45 and suppressors of cytokine signaling (SOCS) proteins; This family consists of the SPRY domain-containing SOCS box protein family (SPSB1-4, also known as SSB-1 to -4) as well as F-box protein 45 (Fbxo45), a novel synaptic E3 and ubiquitin ligase. The SPSB protein is composed of a central SPRY protein interaction domain and a C-terminal SOCS box. SPSB1, SPSB2, and SPSB4 interact with prostate apoptosis response protein 4 (Par-4) and are negative regulators that recruit the ECS E3 ubiquitin ligase complex to polyubiquitinate inducible nitric-oxide synthase (iNOS), resulting in its proteasomal degradation. Fbxo45 is related to this family; it is located N-terminal to the SPRY domain, and known to induce the degradation of a synaptic vesicle-priming factor, Munc13-1, via the SPRY domain, thus playing an important role in the regulation of neurotransmission by modulating Munc13-1 at the synapse. Suppressor of cytokine signaling (SOCS) proteins negatively regulate signaling from JAK-associated cytokine receptor complexes, and play key roles in the regulation of immune homeostasis.


Pssm-ID: 293935  Cd Length: 169  Bit Score: 305.92  E-value: 1.44e-106
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  54 HSWNNNDRSLNVFVKEDdKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLRSVGYTTLV 133
Cdd:cd12875   1 HGWNPADCSKNIYIKED-GLTFHRRPVAQSTDAIRGKKGYTRGLHAWEVKWISRPRGSHAVVGVATKDAPLQCDGYVTLL 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661 134 GNNHESWGWDLGHNRLYHDGKnQPSKTYPAFLepdETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVV 213
Cdd:cd12875  80 GSNSESWGWDLGDNKLYHNGK-KVIGSYPAKS---ENYQVPDRILVILDMEDGTLAFEANGEYLGVAFRGLPGKLLYPAV 155
                       170
                ....*....|....
gi 26354661 214 SAVWGHCEIRMRYL 227
Cdd:cd12875 156 SAVYGNCEIRLIYL 169
SPRY_Fbox cd12907
SPRY domain in the F-box family Fbxo45; Fbxo45 is a novel synaptic E3 and ubiquitin ligase, ...
54-227 6.51e-61

SPRY domain in the F-box family Fbxo45; Fbxo45 is a novel synaptic E3 and ubiquitin ligase, related to the suppressor of cytokine signaling (SOCS) proteins and located N-terminal to a SPRY (SPla and the ryanodine receptor) domain. Fbxo45 induces the degradation of a synaptic vesicle-priming factor, Munc13-1, via the SPRY domain, thus playing an important role in the regulation of neurotransmission by modulating Munc13-1 at the synapse. F-box motifs are found in proteins that function as the substrate recognition component of SCF E3 complexes.


Pssm-ID: 293964  Cd Length: 175  Bit Score: 190.29  E-value: 6.51e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  54 HSWNNNDRSLNVFVKEDDkLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAmRQRGTHAVVGVATADAPLRSVGYTTLV 133
Cdd:cd12907   1 HAWNPNDCSRNIYIKPNG-FTLHRNPVAQSTDGARGKIGFSSGRHAWEVWWE-GPLGTVAVVGIATKHAPLQCQGYVALL 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661 134 GNNHESWGWDLGHNRLYHDGKNQpsKTYPAFLEPdETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVV 213
Cdd:cd12907  79 GSDDQSWGWNLVDNHLLHNGDSQ--GNYPQCNNA-PKYQVGERIRVILDCEDNTLAFERGYEFLGVAFRGLPPTKLYPAV 155
                       170
                ....*....|....
gi 26354661 214 SAVWGHCEIRMRYL 227
Cdd:cd12907 156 SAVYGNTEVSMVYL 169
SPRY_SOCS3 cd12876
SPRY domain in the suppressor of cytokine signaling 3 (SOCS3) family; The SPRY ...
55-246 1.06e-26

SPRY domain in the suppressor of cytokine signaling 3 (SOCS3) family; The SPRY domain-containing SOCS box protein family (SPSB1-4, also known as SSB-1 to -4) is composed of a central SPRY protein interaction domain and a C-terminal SOCS box. All four SPSB proteins interact with c-Met, the hepatocyte growth factor receptor, but SOCS3 regulates cellular response to a variety of cytokines such as leukemia inhibitory factor (LIF) and interleukin 6. SOCS3, along with SOCS1, are expressed by immune cells and cells of the central nervous system (CNS) and have the potential to impact immune processes within the CNS. In non-small cell lung cancer (NSCLC), SOCS3 is silenced and proline-rich tyrosine kinase 2 (Pyk2) is over-expressed; it has been suggested that SOCS3 could be an effective way to prevent the progression of NSCLC due to its role in regulating Pyk2 expression.


Pssm-ID: 293936  Cd Length: 185  Bit Score: 102.24  E-value: 1.06e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  55 SWNNNDRSLNV-FVKEDDKLIFHRHpVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLRSVGY--TT 131
Cdd:cd12876   3 TWDERDKSPAVqLSDNNREVYFHPD-YSCGTAAVRGTKPLTNGQHYWEIKMSSPVYGTDMMVGVGTKKADLHAYRYefCS 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661 132 LVGNNHESWGwdLGHN-RLYHDGKNQPsktypaFLEP--DETFIVPdsflVALDMDDGTLSFIVDGQYMGVAFRGLKG-K 207
Cdd:cd12876  82 LLGEDEESWG--LSYKgLLWHDGQSRP------YTSPfgNQGTIIG----VHLDMWRGTLTFYKNGKPLGVAFTGLNGvK 149
                       170       180       190       200
                ....*....|....*....|....*....|....*....|...
gi 26354661 208 KLYPVVSAVWGHCEIRM----RYLNGLDpeplplmDLCRRSVR 246
Cdd:cd12876 150 PLYPMVSSTAAKSEMKLinsrSFPVSLQ-------DRCCAALR 185
SOCS_SSB1 cd03744
SOCS (suppressors of cytokine signaling) box of SSB1 (SPRY domain-containing SOCS box proteins) ...
232-273 9.76e-23

SOCS (suppressors of cytokine signaling) box of SSB1 (SPRY domain-containing SOCS box proteins)-like proteins. SSB proteins contain a central SPRY domain and a C-terminal SOCS. SSB1 has been shown to bind to MET, the receptor protein-tyrosine kinase for hepatocyte growth factor (HGF), both the absence and the presence of HGF and enhances the HGF-MET-induced mitogen-activated protein kinases Erk-transcription factor Elk-1-serum response elements (SRE) pathway. SSB1, like SSB2 and SSB4, also interacts with prostate apoptosis response protein-4. Both types of interactions are mediated through the SPRY domain. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239713  Cd Length: 42  Bit Score: 87.73  E-value: 9.76e-23
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 26354661 232 PEPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03744   1 PEPLPLMDLCRRSVRLALGRERLSEIHTLPLPASLKNYLLYQ 42
SOCS_SSB1_4 cd03718
SOCS (suppressors of cytokine signaling) box of SSB1 and SSB4 (SPRY domain-containing SOCS box ...
232-273 2.59e-22

SOCS (suppressors of cytokine signaling) box of SSB1 and SSB4 (SPRY domain-containing SOCS box proteins)-like proteins. SSB proteins contain a central SPRY domain and a C-terminal SOCS. SSB1 and SSB4 has been shown to bind to MET, the receptor protein-tyrosine kinase for hepatocyte growth factor (HGF) and also interacts with prostate apoptosis response protein-4. Both types of interactions are mediated through the SPRY domain. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239688  Cd Length: 42  Bit Score: 86.59  E-value: 2.59e-22
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 26354661 232 PEPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03718   1 PEPLPLMDLCRRRVRVALGRDRLEEIEQLPLPPSLKNYLLYQ 42
SPRY pfam00622
SPRY domain; SPRY Domain is named from SPla and the RYanodine Receptor. Domain of unknown ...
98-228 2.29e-19

SPRY domain; SPRY Domain is named from SPla and the RYanodine Receptor. Domain of unknown function. Distant homologs are domains in butyrophilin/marenostrin/pyrin homologs.


Pssm-ID: 334177  Cd Length: 121  Bit Score: 81.22  E-value: 2.29e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661    98 HVWQITWaMRQRGTHAVVGVATADAPLRSVGYttlVGNNHESWGWDLGHNRLYHDGKNQPskTYPAFLEPdetfivPDSF 177
Cdd:pfam00622   2 HYFEVEI-FGQDPGGWRVGWATKDYPRKGERF---LGDDSGSWGYDGWNGKKYWASTSPL--TGLPLFEP------GDVI 69
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 26354661   178 LVALDMDDGTLSFIVDGQYMGVAFRGLKG-KKLYPVVSAVWGHCEIRMRYLN 228
Cdd:pfam00622  70 GCFLDYEEGTISFTKNGKSLGYAFRDVPFtGPLFPAVSLGSGEGLQFNLGLR 121
SPRY smart00449
Domain in SPla and the RYanodine Receptor; Domain of unknown function. Distant homologues are ...
95-226 3.30e-19

Domain in SPla and the RYanodine Receptor; Domain of unknown function. Distant homologues are domains in butyrophilin/marenostrin/pyrin homologues.


Pssm-ID: 214669  Cd Length: 122  Bit Score: 80.80  E-value: 3.30e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661     95 RGLHVWQITWamrQRGTHAVVGVATADAPLrsvGYTTLVGNNHESWGWDLGHNRLYHDGKnqpSKTYPAFLEPDetfivP 174
Cdd:smart00449   1 SGRHYFEVEI---GDGGHWRVGVATKSVPR---GYFALLGEDKGSWGYDGDGGKKYHNST---GPEYGLPLQEP-----G 66
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....
gi 26354661    175 DSFLVALDMDDGTLSFIVDGQY-MGVAFRGLK-GKKLYPVVSaVWGHCEIRMRY 226
Cdd:smart00449  67 DVIGCFLDLEAGTISFYKNGKYlHGLAFFDVKfSGPLYPAFS-LGSGNSVRLNF 119
SPRY cd11709
SPRY domain; SPRY domains, first identified in the SP1A kinase of Dictyostelium and rabbit ...
96-223 5.98e-19

SPRY domain; SPRY domains, first identified in the SP1A kinase of Dictyostelium and rabbit Ryanodine receptor (hence the name), are homologous to B30.2. SPRY domains have been identified in at least 11 protein families, covering a wide range of functions, including regulation of cytokine signaling (SOCS), RNA metabolism (DDX1 and hnRNP), immunity to retroviruses (TRIM5alpha), intracellular calcium release (ryanodine receptors or RyR) and regulatory and developmental processes (HERC1 and Ash2L). B30.2 also contains residues in the N-terminus that form a distinct PRY domain structure; i.e. B30.2 domain consists of PRY and SPRY subdomains. B30.2 domains comprise the C-terminus of three protein families: BTNs (receptor glycoproteins of immunoglobulin superfamily); several TRIM proteins (composed of RING/B-box/coiled-coil or RBCC core); Stonutoxin (secreted poisonous protein of the stonefish Synanceia horrida). TRIM/RBCC proteins are involved in a variety of processes, including apoptosis, cell cycle regulation, cell growth, senescence, viral response, meiosis, cell differentiation, and vesicular transport. Genes belonging to this family are implicated in several human diseases that vary from cancer to rare genetic syndromes. The PRY-SPRY domain in these TRIM families is suggested to serve as the target binding site. While SPRY domains are evolutionarily ancient, B30.2 domains are a more recent adaptation where the SPRY/PRY combination is a possible component of immune defense. Mutations found in the SPRY-containing proteins have shown to cause Mediterranean fever and Opitz syndrome.


Pssm-ID: 293931  Cd Length: 118  Bit Score: 79.78  E-value: 5.98e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  96 GLHVWQITWaMRQRGTHAVVGVATADAPLRSvgyTTLVGNNHESWGWDLGHNRLYHDGKNQPSktypaflepDETFIVPD 175
Cdd:cd11709   1 GKWYWEVRV-DSGNGGLIQVGWATKSFSLDG---EGGVGDDEESWGYDGSRLRKGHGGSSGPG---------GRPWKSGD 67
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|.
gi 26354661 176 SFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKK--LYPVVSAVWGH-CEIR 223
Cdd:cd11709  68 VVGCLLDLDEGTLSFSLNGKDLGVAFTNLFLKGggLYPAVSLGSGQgVTIN 118
SOCS_SSB4 cd03743
SOCS (suppressors of cytokine signaling) box of SSB4 (SPRY domain-containing SOCS box ...
232-273 1.46e-17

SOCS (suppressors of cytokine signaling) box of SSB4 (SPRY domain-containing SOCS box proteins)-like proteins. SSB proteins contain a central SPRY domain and a C-terminal SOCS. SSB4 has been shown to bind to MET, the receptor protein-tyrosine kinase for hepatocyte growth factor (HGF). SSB4, like SSB2 and SSB1, also interacts with prostate apoptosis response protein-4. Both types of interactions are mediated through the SPRY domain. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239712  Cd Length: 42  Bit Score: 74.22  E-value: 1.46e-17
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 26354661 232 PEPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03743   1 PEPLPLMDLCRRSARQALGRHRLHHIQSLPLPQTLKNYLQYQ 42
SOCS_ASB_like cd03716
SOCS (suppressors of cytokine signaling) box of ASB (ankyrin repeat and SOCS box) and SSB ...
232-273 4.61e-16

SOCS (suppressors of cytokine signaling) box of ASB (ankyrin repeat and SOCS box) and SSB (SPRY domain-containing SOCS box proteins) protein families. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence of a variable number of repeats. SSB proteins contain a central SPRY domain and a C-terminal SOCS. Recently, it has been shown that all four SSB proteins interact with the MET, the receptor protein-tyrosine kinase for hepatocyte growth factor (HGF), and that SSB-1, SSB-2, and SSB-4 interact with prostate apoptosis response protein-4. Both types of interactions are mediated through the SPRY domain.


Pssm-ID: 239686  Cd Length: 42  Bit Score: 69.83  E-value: 4.61e-16
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 26354661 232 PEPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03716   1 STPRSLQHLCRLAIRRCLGRRRLELIKKLPLPPRLKDYLLYE 42
SOCS cd03587
SOCS (suppressors of cytokine signaling) box. The SOCS box is found in the C-terminal region ...
233-273 5.81e-14

SOCS (suppressors of cytokine signaling) box. The SOCS box is found in the C-terminal region of CIS/SOCS family proteins (in combination with a SH2 domain), ASBs (ankyrin repeat-containing proteins with a SOCS box), SSBs (SPRY domain-containing proteins with a SOCS box), and WSBs (WD40 repeat-containing proteins with a SOCS box), as well as, other miscellaneous proteins. The function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239641  Cd Length: 41  Bit Score: 64.41  E-value: 5.81e-14
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
gi 26354661 233 EPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03587   1 NPRSLQHLCRLAIRRCLGKRRLDLIDKLPLPPRLKDYLLYK 41
SOCS_box pfam07525
SOCS box; The SOCS box acts as a bridge between specific substrate- binding domains and more ...
234-271 2.73e-12

SOCS box; The SOCS box acts as a bridge between specific substrate- binding domains and more generic proteins that comprise a large family of E3 ubiquitin protein ligases.


Pssm-ID: 336723  Cd Length: 38  Bit Score: 59.70  E-value: 2.73e-12
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 26354661   234 PLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLL 271
Cdd:pfam07525   1 PRSLQHLCRLAIRRALGKRRLHGIDKLPLPPRLKDYLL 38
SOCS_SSB2 cd03719
SOCS (suppressors of cytokine signaling) box of SSB2 (SPRY domain-containing SOCS box proteins) ...
233-273 2.42e-09

SOCS (suppressors of cytokine signaling) box of SSB2 (SPRY domain-containing SOCS box proteins)-like proteins. SSB proteins contain a central SPRY domain and a C-terminal SOCS. SSB2 has been shown to bind to MET, the receptor protein-tyrosine kinase for hepatocyte growth factor (HGF). SSB2, like SSB4 and SSB1, also interacts with prostate apoptosis response protein-4. Both types of interactions are mediated through the SPRY domain. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239689  Cd Length: 42  Bit Score: 51.56  E-value: 2.42e-09
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
gi 26354661 233 EPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03719   2 EPHSLLHLSRLCVRHALGDTRLGQVSALPLPPAMKRYLLYQ 42
SPRY_HERC1 cd12881
SPRY domain in HERC1; This SPRY domain is found in the HERC1, a large protein related to ...
91-214 7.22e-09

SPRY domain in HERC1; This SPRY domain is found in the HERC1, a large protein related to chromosome condensation regulator RCC1. It is widely expressed in many tissues, playing an important role in intracellular membrane trafficking in the cytoplasm as well as Golgi apparatus. HERC1 also interacts with tuberous sclerosis 2 (TSC2, tuberin), which suppresses cell growth, and results in the destabilization of TSC2. However, the biological function of HERC1 has yet to be defined.


Pssm-ID: 293939  Cd Length: 162  Bit Score: 53.51  E-value: 7.22e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  91 VGYTRGlhVWQITWAMRQ--RGTHA-VVGVATAdaPLRSVGYTTlvgnNHESWGWDLGHNRLYHDGKnQPSKTYPAFLEP 167
Cdd:cd12881  37 IGISSG--CYQWKFYLVKenRGNEGtCVGVSRK--PVTDFNYRT----SSDMWLYRAYNGNLYHNGE-QLLRLSSKFHQG 107
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
gi 26354661 168 DETFIVpdsflvaLDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVS 214
Cdd:cd12881 108 DYITVV-------LDMEEGTLSFGKNGEEPGVAFEDVDATELYPCVM 147
SOCS_ASB1 cd03720
SOCS (suppressors of cytokine signaling) box of ASB1-like proteins. ASB family members have a ...
234-273 1.92e-08

SOCS (suppressors of cytokine signaling) box of ASB1-like proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239690  Cd Length: 42  Bit Score: 49.34  E-value: 1.92e-08
                        10        20        30        40
                ....*....|....*....|....*....|....*....|
gi 26354661 234 PLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03720   3 PRSLLSLCRIAVRRALGKQRLSLICSLPLPDPIKKFLLHE 42
SOCS_box smart00969
The SOCS box acts as a bridge between specific substrate- binding domains and more generic ...
235-273 7.91e-08

The SOCS box acts as a bridge between specific substrate- binding domains and more generic proteins that comprise a large family of E3 ubiquitin protein ligases;


Pssm-ID: 198037  Cd Length: 34  Bit Score: 47.40  E-value: 7.91e-08
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 26354661    235 LPLMDLCRRSVRlalgkERLGAIPALPLPASLKAYLLYQ 273
Cdd:smart00969   1 RSLQHLCRLAIR-----RSLGGIDKLPLPPRLKDYLLYY 34
SPRY_PRY_TRIM67_9 cd12889
PRY/SPRY domain in tripartite motif-containing proteins, TRIM9 and TRIM67; This domain, ...
89-214 1.49e-07

PRY/SPRY domain in tripartite motif-containing proteins, TRIM9 and TRIM67; This domain, consisting of the distinct N-terminal PRY subdomain followed by the SPRY subdomain, is found at the C-terminus of TRIM9 proteins. TRIM9 protein is expressed mainly in the cerebral cortex, and functions as an E3 ubiquitin ligase. It has been shown that TRIM9 is localized to the neurons in the normal human brain and its immunoreactivity in affected brain areas in Parkinson's disease and dementia with Lewy bodies is severely decreased, possibly playing an important role in the regulation of neuronal function and participating in pathological process of Lewy body disease through its ligase. TRIM67 negatively regulates Ras activity via degradation of 80K-H, leading to neural differentiation, including neuritogenesis.


Pssm-ID: 293947  Cd Length: 172  Bit Score: 49.93  E-value: 1.49e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  89 GKVGYTRGLHVWQITWAMRQRGTHAVVGVATADaplrsVGYTTLVGNNHESWGWDLGHNR--LYHDGKNQpSKTypafle 166
Cdd:cd12889  42 GSVGFSRGVHYWEVTIDRYDGHPDPAFGVARID-----VNKDKMLGKDDKGWSMYIDNNRswFLHNNEHS-NRT------ 109
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|
gi 26354661 167 pdETFIVPDSFL-VALDMDDGTLSFIVDGQYMG-VAFRGLKGkKLYPVVS 214
Cdd:cd12889 110 --EGGITVGSVVgVLLDLDRHTLSFYVNDEPQGpIAFRNLPG-VFYPAVS 156
SOCS_ASB2 cd03721
SOCS (suppressors of cytokine signaling) box of ASB2-like proteins. ASB family members have a ...
234-273 6.94e-07

SOCS (suppressors of cytokine signaling) box of ASB2-like proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. ASB2 targets specific proteins to destruction by the proteasome in leukemia cells that have been induced to differentiate. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239691  Cd Length: 45  Bit Score: 44.86  E-value: 6.94e-07
                        10        20        30        40
                ....*....|....*....|....*....|....*....|
gi 26354661 234 PLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03721   3 PRPLAHLCRLKVRTLIGINRIKLIDTLPLPPRLIRYLNHQ 42
SPRY_RanBP_like cd12885
SPRY domain in Ran binding proteins, SSH4, HECT E3 and SPRYD3; This family includes SPRY ...
109-223 2.35e-06

SPRY domain in Ran binding proteins, SSH4, HECT E3 and SPRYD3; This family includes SPRY domains found in Ran binding proteins (RBP or RanBPM) 9 and 10, SSH4 (suppressor of SHR3 null mutation protein 4), SPRY domain-containing protein 3 (SPRYD3) as well as HECT, a C-terminal catalytic domain of a subclass of ubiquitin-protein ligase (E3). RanBP9 and RanBP10 act as androgen receptor (AR) coactivators. Both consist of the N-terminal proline- and glutamine-rich regions, the SPRY domain, and LisH-CTLH and CRA motifs. The SPRY domain in SSH4 may be involved in cargo recognition, either directly or by combination with other adaptors, possibly leading to a higher selectivity. SPRYD3 is highly expressed in most tissues in humans, possibly involved in important cellular processes. HECT E3 mediates the direct transfer of ubiquitin from E2 to substrate.


Pssm-ID: 293943  Cd Length: 132  Bit Score: 45.73  E-value: 2.35e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661 109 RGTHAVVGVATADAPLRSvgyttLVGNNHESWGWDLGHNRLYHdGKNQPSKTYPaflepdeTFIVPDSFLVALDMDDGTL 188
Cdd:cd12885  27 EKGIVSIGFCTSGFPLNR-----MPGWEDGSYGYHGDDGRVYL-GGGEGENYGP-------PFGTGDVVGCGINFKTGEV 93
                        90       100       110
                ....*....|....*....|....*....|....*
gi 26354661 189 SFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIR 223
Cdd:cd12885  94 FFTKNGELLGTAFENVVKGRLYPTVGLGSPGVKVR 128
SOCS_ASB13 cd03729
SOCS (suppressors of cytokine signaling) box of ASB13-like proteins. ASB family members have a ...
234-272 9.15e-06

SOCS (suppressors of cytokine signaling) box of ASB13-like proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239699  Cd Length: 42  Bit Score: 41.69  E-value: 9.15e-06
                        10        20        30
                ....*....|....*....|....*....|....*....
gi 26354661 234 PLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLY 272
Cdd:cd03729   3 PLSLQQLCRINLRKALGTRALEKIAKLNIPNRIIDYLSY 41
SOCS_ASB4_ASB18 cd03723
SOCS (suppressors of cytokine signaling) box of ASB4 and ASB18 proteins. ASB family members ...
234-271 1.59e-05

SOCS (suppressors of cytokine signaling) box of ASB4 and ASB18 proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. Asb4 was identified as imprinted gene in mice. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239693  Cd Length: 48  Bit Score: 41.27  E-value: 1.59e-05
                        10        20        30
                ....*....|....*....|....*....|....*...
gi 26354661 234 PLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLL 271
Cdd:cd03723   3 PRSLQHLCRCAIRKLLGSRCHKLVPQLSLPTSLKNYLL 40
SPRY_RNF123 cd12882
SPRY domain at N-terminus of ring finger protein 123; This SPRY domain is found at the ...
133-221 1.69e-05

SPRY domain at N-terminus of ring finger protein 123; This SPRY domain is found at the N-terminus of RING finger protein 123 domain (also known as E3 ubiquitin-protein ligase RNF123). The ring finger domain motif is present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. RNF123 displays E3 ubiquitin ligase activity toward the cyclin-dependent kinase inhibitor p27 (Kip1).


Pssm-ID: 293940  Cd Length: 128  Bit Score: 43.08  E-value: 1.69e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661 133 VGNNHESWGWDLGHNRLYHDGknqpSKTYpaflepDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAF---RGLKGKKL 209
Cdd:cd12882  42 VGDTRDSYAYDGNRVRKWNVS----TQKY------GEPWVAGDVIGCCIDLDKGTISFYRNGRSLGVAFdnvRRGPGLAY 111
                        90
                ....*....|...
gi 26354661 210 YPVVS-AVWGHCE 221
Cdd:cd12882 112 FPAVSlSFGERLE 124
SOCS_ASB5 cd03724
SOCS (suppressors of cytokine signaling) box of ASB5-like proteins. ASB family members have a ...
234-273 3.66e-05

SOCS (suppressors of cytokine signaling) box of ASB5-like proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. ASB5 has been implicated in the initiation of arteriogenesis. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239694  Cd Length: 42  Bit Score: 39.86  E-value: 3.66e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|
gi 26354661 234 PLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03724   3 PSSLCQLCRLCIRNYIGRSRLHLIPQLQLPTLLKNFLQYR 42
SOCS_SOCS_like cd03717
SOCS (suppressors of cytokine signaling) box of SOCS-like proteins. The CIS/SOCS family of ...
233-273 3.88e-05

SOCS (suppressors of cytokine signaling) box of SOCS-like proteins. The CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. These intracellular proteins regulate the responses of immune cells to cytokines. Identified as negative regulators of the cytokine-JAK-STAT pathway, they seem to play a role in many immunological and pathological processes. The function of the SOCS box is the recruitment of the ubiquitin-transferase system. Related SOCS boxes are also present in Rab40-like proteins and insect proteins of unknown function that also contain a NEUZ (domain in neuralized proteins) domain.


Pssm-ID: 239687  Cd Length: 39  Bit Score: 39.89  E-value: 3.88e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
gi 26354661 233 EPLPLMDLCRRSVRLALGKErlgAIPALPLPASLKAYLLYQ 273
Cdd:cd03717   2 SVRSLQHLCRFVIRQCTRRD---LIDQLPLPRRLKDYLKEY 39
SOCS_ASB3 cd03722
SOCS (suppressors of cytokine signaling) box of ASB3-like proteins. ASB family members have a ...
237-272 4.73e-05

SOCS (suppressors of cytokine signaling) box of ASB3-like proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. ABS3 has been shown to be negative regulator of TNF-R2-mediated cellular responses to TNF-alpha by direct targeting of tumor necrosis factor receptor II (TNF-R2) for ubiquitination and proteasome-mediated degradation. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239692  Cd Length: 51  Bit Score: 39.77  E-value: 4.73e-05
                        10        20        30
                ....*....|....*....|....*....|....*....
gi 26354661 237 LMDLCRRSVRLALGKERLGA---IPALPLPASLKAYLLY 272
Cdd:cd03722   6 LTHLCRLEIRSSLKSERLRSdsfICQLPLPRSLQDYLLY 44
SPRY_PRY_C-II cd13734
PRY/SPRY domain in tripartite motif-containing proteins 1, 9, 18, 36, 46, 67,76 (TRIM1, TRIM9, ...
85-191 7.53e-05

PRY/SPRY domain in tripartite motif-containing proteins 1, 9, 18, 36, 46, 67,76 (TRIM1, TRIM9, TRIM18, TRIM36, TRIM46, TRIM67, TRIM76); This domain, consisting of the distinct N-terminal PRY subdomain followed by the SPRY subdomain, is found at the C-terminus of several Class I TRIM proteins, including TRIM1, TRIM9, TRIM18, TRIM36, TRIM46, TRIM67 and TRIM76. TRIM1 (also known as MID2) and its close homolog, TRIM18 (also known as MID1), both contain a B30.2-like domain at their C-terminus and a single fibronectin type III (FN3) motif between it and their N-terminal RBCC domain. Their coiled-coil motifs mediate both homo- and heterodimerization, a prerequisite for association of the rapamycin-sensitive PP2A regulatory subunit Alpha 4 with microtubules. Mutations in TRIM18 have shown to cause Opitz syndrome, a disorder causing congenital anomalies such as cleft lip and palate as well as heart defects. TRIM9 is expressed mainly in the cerebral cortex, and functions as an E3 ubiquitin ligase. Its immunoreactivity is severely decreased in affected brain areas in Parkinson's disease and dementia with Lewy bodies, possibly playing an important role in the regulation of neuronal function and participating in pathological process of Lewy body disease through its ligase. TRIM36 interacts with centromere protein-H, one of the kinetochore proteins and possibly associates with chromosome segregation; an excess of TRIM36 may cause chromosomal instability. TRIM46 has not yet been characterized. TRIM67 negatively regulates Ras activity via degradation of 80K-H, leading to neural differentiation, including neuritogenesis. TRIM76 (also known as cardiomyopathy-associated protein 5 or CMYA5) is a muscle-specific member of the TRIM superfamily, but lacks the RING domain. It is possibly involved in protein kinase A signaling as well as vesicular trafficking. It has also been implicated in Duchenne muscular dystrophy and cardiac disease. The PRY-SPRY domain in these TRIM families is suggested to serve as the target binding site.


Pssm-ID: 293969  Cd Length: 166  Bit Score: 41.88  E-value: 7.53e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  85 DAIRGKVGYTRGLHVWQITwamRQRGTHAVVGVATADAPLRSvgyttLVGNNHESWGWDLGHNRLY--HDGKnqpskTYP 162
Cdd:cd13734  43 PAVLGDVAISSGRHYWEVS---VSRSTSYRVGVAYKSAPRDE-----DLGKNSTSWCLSRDNNRYTarHDGK-----VVD 109
                        90       100
                ....*....|....*....|....*....
gi 26354661 163 AFLEPDetfivPDSFLVALDMDDGTLSFI 191
Cdd:cd13734 110 LRVTGH-----PARIGVLLDYDNGTLSFY 133
SOCS_ASB14 cd03730
SOCS (suppressors of cytokine signaling) box of ASB14-like proteins. ASB family members have a ...
234-273 1.21e-04

SOCS (suppressors of cytokine signaling) box of ASB14-like proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239700  Cd Length: 57  Bit Score: 39.06  E-value: 1.21e-04
                        10        20        30        40
                ....*....|....*....|....*....|....*....|...
gi 26354661 234 PLPLMDLCRRSVRLALGKERLGA---IPALPLPASLKAYLLYQ 273
Cdd:cd03730   3 PRSLKHLCRLKIRACMGRLRLRCpvfMSFLPLPNRLKAYILYK 45
SPRY_like cd12886
SPRY domain-like in bacteria; This family contains SPRY-like domains that are found only in ...
96-214 1.38e-04

SPRY domain-like in bacteria; This family contains SPRY-like domains that are found only in bacterial and are mostly uncharacterized. SPRY domains, first identified in the SP1A kinase of Dictyostelium and rabbit Ryanodine receptor (hence the name), are homologous to B30.2. SPRY domains have been identified in at least 11 eukaryotic protein families, covering a wide range of functions, including regulation of cytokine signaling (SOCS), RNA metabolism (DDX1 and hnRNP), immunity to retroviruses (TRIM5alpha), intracellular calcium release (ryanodine receptors or RyR) and regulatory and developmental processes (HERC1 and Ash2L).


Pssm-ID: 293944  Cd Length: 129  Bit Score: 40.57  E-value: 1.38e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661  96 GLHVWQITWAMRQRGTHAVVGVATADAPlrsvGYTTLVGNNHESWGWDLGhnrLYHDGKNQPSKTYPAFlepDETFIVPD 175
Cdd:cd12886   1 GKWYWEVTVVSSAASTYAGIGVANAAAT----GNNGLNGIELSSIGYSLG---VYSGNKLSNGSSVATY---GAGFTAGD 70
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*
gi 26354661 176 SFLVALDMDDGTLSFIVDG--QYMGVAFRG----LKGKKLYPVVS 214
Cdd:cd12886  71 VIGVALDLDAGKIWFYKNGvwQGGGDPAPGtnpaFAGTAMYPAVT 115
SOCS_ASB_9_11 cd03728
SOCS (suppressors of cytokine signaling) box of ASB9 and 11 proteins. ASB family members have ...
234-273 1.59e-04

SOCS (suppressors of cytokine signaling) box of ASB9 and 11 proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239698  Cd Length: 42  Bit Score: 38.23  E-value: 1.59e-04
                        10        20        30        40
                ....*....|....*....|....*....|....*....|
gi 26354661 234 PLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ 273
Cdd:cd03728   3 PPSLMQLCRLCIRKCFGRKQHHKIHKLHLPEPLKHFLLYR 42
SOCS smart00253
suppressors of cytokine signalling; suppressors of cytokine signalling
233-272 5.36e-04

suppressors of cytokine signalling; suppressors of cytokine signalling


Pssm-ID: 128549  Cd Length: 43  Bit Score: 36.89  E-value: 5.36e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 26354661    233 EPLPLMDLCRRSVRlalGKERLGAIPALPLPASLKAYLLY 272
Cdd:smart00253   6 NVPSLQHLCRFTIR---RCTRTDQIKTLPLPPKLKDYLSY 42
SPRY_RanBP9_10 cd12909
SPRY domain in Ran binding proteins 9 and 10; This family includes SPRY domain in Ran binding ...
185-213 6.67e-04

SPRY domain in Ran binding proteins 9 and 10; This family includes SPRY domain in Ran binding protein (RBP or RanBPM) 9 and 10, and similar proteins. RanBP9 (also known as RanBPM), a binding partner of Ran, is a small Ras-like GTPase that exerts multiple functions via interactions with various proteins. RanBP9 and RanBP10 also act as androgen receptor (AR) coactivators. Both consist of the N-terminal proline- and glutamine-rich regions, the SPRY domain, and LisH-CTLH and CRA motifs. SPRY domain of RanBPM forms a complex with CD39, a prototypic member of the NTPDase family, thus down-regulating activity substantially. RanBP10 enhances the transcriptional activity of AR in a ligand-dependent manner and exhibits a protein expression pattern different from RanBPM in various cell lines. RanBP10 is highly expressed in AR-positive prostate cancer LNCaP cells, while RanBPM is abundant in WI-38 and MCF-7 cells.


Pssm-ID: 293966  Cd Length: 144  Bit Score: 39.04  E-value: 6.67e-04
                        10        20
                ....*....|....*....|....*....
gi 26354661 185 DGTLSFIVDGQYMGVAFRGLKGKKLYPVV 213
Cdd:cd12909 101 DNTAFYTKNGVNLGIAFRDIKKGNLYPTV 129
SOCS_ASB8 cd03727
SOCS (suppressors of cytokine signaling) box of ASB8-like proteins. ASB family members have a ...
234-271 6.82e-04

SOCS (suppressors of cytokine signaling) box of ASB8-like proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. Human ASB8 is highly transcribed in skeletal muscle and in lung carcinoma cell lines. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239697  Cd Length: 43  Bit Score: 36.35  E-value: 6.82e-04
                        10        20        30
                ....*....|....*....|....*....|....*....
gi 26354661 234 PLPLMDLCRRSVRLALGKERL-GAIPALPLPASLKAYLL 271
Cdd:cd03727   3 PGTLKALARYAVRRSLGVQYLpEAVKQLPLPRSVKEYLL 41
SPRY_hnRNP cd12884
SPRY domain in heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1; This domain, ...
110-213 8.79e-04

SPRY domain in heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1; This domain, consisting of the distinct N-terminal PRY subdomain followed by the SPRY subdomain, is found at the C-terminus of heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1 (also known as HNRPUL1 ) which is a major constituent of nuclear matrix or scaffold and binds directly to DNA sequences through the N-terminal acidic region named serum amyloid P (SAP). Its function is specifically modulated by E1B-55kDa in adenovirus-infected cells. HNRPUL1 also participates in ATR protein kinase signaling pathways during adenovirus infection. Two transcript variants encoding different isoforms have been found for this gene. When associated with bromodomain-containing protein 7 (BRD7), it activates transcription of glucocorticoid-responsive promoter in the absence of ligand-stimulation.


Pssm-ID: 293942  Cd Length: 177  Bit Score: 39.11  E-value: 8.79e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661 110 GTHAV-VGVATADAPLRsVGYTTLvgnnheSWGWDlGHNRLYHDGKnqpsktypaFLEPDETFIVPDSFLVALDMD--DG 186
Cdd:cd12884  68 DPHVVrVGWSVDSSSLQ-LGEEEF------SYGYG-STGKKSTNCK---------FEDYGEPFGENDVIGCYLDFEsePV 130
                        90       100       110
                ....*....|....*....|....*....|.
gi 26354661 187 TLSFIVDGQYMGVAFR----GLKGKKLYPVV 213
Cdd:cd12884 131 EISFSKNGKDLGVAFKiskeELGGKALFPHV 161
SPRY_NHR_like cd12887
SPRY domain in neuralized homology repeat; This family contains the neuralized homology repeat ...
115-221 9.32e-04

SPRY domain in neuralized homology repeat; This family contains the neuralized homology repeat 1 (NHR1) domain similar to the SPRY domain (known to mediate specific protein-protein interactions) at the C-terminus of a conserved region within eukaryotic neuralized and neuralized-like proteins. In Drosophila, the neuralized protein (Neur) belongs to a group of ubiquitin ligases and is required in a subset of Notch pathway-mediated cell fate decisions during development of the nervous system. Neur binds to the Notch receptor ligand Delta through its first NHR1 domain and mediates its ubiquitination for endocytosis. Multiple copies of this region are found in some members of the family.


Pssm-ID: 293945  Cd Length: 161  Bit Score: 38.64  E-value: 9.32e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26354661 115 VGVaTADAPLRSVGYTTLVGNNHESWGWDlgHNRLYHDGKNQPSKtYPAFLEpdeTFIVPDSFLVALDmDDGTLSFIVDG 194
Cdd:cd12887  60 IGV-TTLNPETLDLPPSATDLKSGTWILS--GSSVFKNGNKIREN-YGPDLD---RLRVGDRVGVMRT-SDGTLHFYVNG 131
                        90       100
                ....*....|....*....|....*..
gi 26354661 195 QYMGVAFRGLkGKKLYPVVSaVWGHCE 221
Cdd:cd12887 132 EDQGVAASNV-PQPVYAVVD-LYGQCE 156
SOCS_ASB15 cd03731
SOCS (suppressors of cytokine signaling) box of ASB15-like proteins. ASB family members have a ...
234-273 1.05e-03

SOCS (suppressors of cytokine signaling) box of ASB15-like proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. Human ASB15 is expressed predominantly in skeletal muscle and participates in the regulation of protein turnover and muscle cell development by stimulating protein synthesis and regulating differentiation of muscle cells. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.


Pssm-ID: 239701  Cd Length: 56  Bit Score: 36.35  E-value: 1.05e-03
                        10        20        30        40
                ....*....|....*....|....*....|....*....|...
gi 26354661 234 PLPLMDLCRRSVRLALGKERL---GAIPALPLPASLKAYLLYQ 273
Cdd:cd03731   3 PRPLKHLCRLKIRKLMGLQKLqqpSSMKKLPLPPALKRYILYK 45
SPRY_DDX1 cd12873
SPRY domain associated with DEAD box gene DDX1; This SPRY domain is associated with the DEAD ...
181-214 7.93e-03

SPRY domain associated with DEAD box gene DDX1; This SPRY domain is associated with the DEAD box gene, DDX1, an RNA-dependent ATPase involved in HIV-1 Rev function and virus replication. It is suggested that DDX1 acts as a cellular cofactor by promoting oligomerization of Rev on the Rev response element (RRE). DDX1 RNA is overexpressed in breast cancer, data showing a strong and independent association between poor prognosis and deregulation of the DEAD box protein DDX1, thus potentially serving as an effective prognostic biomarker for early recurrence in primary breast cancer. DDX1 also interacts with RelA and enhances nuclear factor kappaB-mediated transcription. DEAD-box proteins are associated with all levels of RNA metabolism and function, and have been implicated in translation initiation, transcription, RNA splicing, ribosome assembly, RNA transport, and RNA decay.


Pssm-ID: 293933  Cd Length: 155  Bit Score: 36.01  E-value: 7.93e-03
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 26354661 181 LDMDDGTLSFIVDGQYMGVAFR---GLKGKKLYPVVS 214
Cdd:cd12873 105 LDLDNGTISFSKNGKDLGKAFDippHLRNSALFPAVC 141
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH