NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|26329219|dbj|BAC28348|]
View 

unnamed protein product [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
WD40 super family cl29593
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
171-511 3.06e-34

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


The actual alignment was detected with superfamily member cd00200:

Pssm-ID: 356469 [Multi-domain]  Cd Length: 289  Bit Score: 130.92  E-value: 3.06e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 171 YSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFHKFKSIKARDVGWsvldVAFTPDGNhFLYSSWSDyiHICNIYGE 250
Cdd:cd00200   8 HTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRD----VAASADGT-YLASGSSD--KTIRLWDL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 251 GDTHTALDLRPDErrFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFaDISSQILFSGGDDA 330
Cdd:cd00200  81 ETGECVRTLTGHT--SYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAF-SPDGTFVASSSQDG 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 331 ICKVWDRRTMreddpKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRrfssregmeasrlaatqqnwdyrwq 410
Cdd:cd00200 158 TIKLWDLRTG-----KCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLS------------------------- 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 411 qvpkiawkklklpGDSSLMTYRGHgvLHTLIRCRFSPahstGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVS 490
Cdd:cd00200 208 -------------TGKCLGTLRGH--ENGVNSVAFSP----DGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTSLA 268
                       330       340
                ....*....|....*....|.
gi 26329219 491 WHPFEEKIVSSSWDGNLRLWQ 511
Cdd:cd00200 269 WSPDGKRLASGSADGTIRIWD 289
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
171-511 3.06e-34

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 130.92  E-value: 3.06e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 171 YSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFHKFKSIKARDVGWsvldVAFTPDGNhFLYSSWSDyiHICNIYGE 250
Cdd:cd00200   8 HTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRD----VAASADGT-YLASGSSD--KTIRLWDL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 251 GDTHTALDLRPDErrFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFaDISSQILFSGGDDA 330
Cdd:cd00200  81 ETGECVRTLTGHT--SYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAF-SPDGTFVASSSQDG 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 331 ICKVWDRRTMreddpKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRrfssregmeasrlaatqqnwdyrwq 410
Cdd:cd00200 158 TIKLWDLRTG-----KCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLS------------------------- 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 411 qvpkiawkklklpGDSSLMTYRGHgvLHTLIRCRFSPahstGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVS 490
Cdd:cd00200 208 -------------TGKCLGTLRGH--ENGVNSVAFSP----DGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTSLA 268
                       330       340
                ....*....|....*....|.
gi 26329219 491 WHPFEEKIVSSSWDGNLRLWQ 511
Cdd:cd00200 269 WSPDGKRLASGSADGTIRIWD 289
WD40 COG2319
WD40 repeat [General function prediction only];
176-539 1.03e-24

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 107.10  E-value: 1.03e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 176 FCGIYSKDGQIFMSACQDQTIRLYDCRYGRfHKFKSIKARDVGWSVLDVAFTPDGNHFLYSSWSD--YIHICNIYGEGDT 253
Cdd:COG2319  69 TSIAFSPDGELLLSGSSDGTIKLWDLDNGE-KLIKSLEGLHDSSVSKLALSSPDGNSILLASSSLdgTVKLWDLSTPGKL 147
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 254 HTALDLRPDErrfaVFSIAVSSDGRE-VLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFSGGDDAIC 332
Cdd:COG2319 148 IRTLEGHSES----VTSLAFSPDGKLlASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLLIASGSSDGTI 223
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 333 KVWDRRTMREDDPKpvgaLAGHQDGITFIDSKgDARYLISNSKDQTIKLWDIRRFSSregMEASRLAATQQNWDYRWQQV 412
Cdd:COG2319 224 RLWDLSTGKLLRST----LSGHSDSVVSSFSP-DGSLLASGSSDGTIRLWDLRSSSS---LLRTLSGHSSSVLSVAFSPD 295
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 413 PKIA-----------WkKLKLPGDSSLMTYRGHGvlHTLIRCRFSPahsTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTN 481
Cdd:COG2319 296 GKLLasgssdgtvrlW-DLETGKLLSSLTLKGHE--GPVSSLSFSP---DGSLLVSGGSDDGTIRLWDLRTGKPLKTLEG 369
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 26329219 482 HKAcVRDVSWHPFEEKIVSSSWDGNLRLWQYRQAEYFQDDMPESDMNRVCSSGPTPVP 539
Cdd:COG2319 370 HSN-VLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLRNLDGHTSRVTSLDFSPDGKS 426
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
141-384 5.13e-11

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 65.11  E-value: 5.13e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219  141 GLCHRGSFSlgeQSRVMSHFLPNDLsftdTYSQKAFCGI-YSKDGQIFMSACQDQTIRLYDCrygrfhkfKSI--KARDV 217
Cdd:PLN00181 458 GLCKYLSFS---KLRVKADLKQGDL----LNSSNLVCAIgFDRDGEFFATAGVNKKIKIFEC--------ESIikDGRDI 522
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219  218 GWSVLDVAFTPDGNHFLYSSW-------SDYIHICNIYGEGDTHTALDLRPDERRfaVFSIAVSSDGREVLG-GANDGCL 289
Cdd:PLN00181 523 HYPVVELASRSKLSGICWNSYiksqvasSNFEGVVQVWDVARSQLVTEMKEHEKR--VWSIDYSSADPTLLAsGSDDGSV 600
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219  290 YVFDREQNRRTLQIEShEDDVNAVAFADISSQILFSGGDDAICKVWDRRtmredDPK-PVGALAGHQDGITFIDSKgDAR 368
Cdd:PLN00181 601 KLWSINQGVSIGTIKT-KANICCVQFPSESGRSLAFGSADHKVYYYDLR-----NPKlPLCTMIGHSKTVSYVRFV-DSS 673
                        250
                 ....*....|....*.
gi 26329219  369 YLISNSKDQTIKLWDI 384
Cdd:PLN00181 674 TLVSSSTDNTLKLWDL 689
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
472-510 3.51e-07

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 46.54  E-value: 3.51e-07
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 26329219    472 SGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLW 510
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLW 39
WD40 pfam00400
WD domain, G-beta repeat;
473-510 5.13e-06

WD domain, G-beta repeat;


Pssm-ID: 334060 [Multi-domain]  Cd Length: 39  Bit Score: 43.12  E-value: 5.13e-06
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 26329219   473 GHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLW 510
Cdd:pfam00400   1 GKLLKTLEGHSSSVTSLAFSPDGKLLASGSDDGTVKVW 38
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
171-511 3.06e-34

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 130.92  E-value: 3.06e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 171 YSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFHKFKSIKARDVGWsvldVAFTPDGNhFLYSSWSDyiHICNIYGE 250
Cdd:cd00200   8 HTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRD----VAASADGT-YLASGSSD--KTIRLWDL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 251 GDTHTALDLRPDErrFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFaDISSQILFSGGDDA 330
Cdd:cd00200  81 ETGECVRTLTGHT--SYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAF-SPDGTFVASSSQDG 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 331 ICKVWDRRTMreddpKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRrfssregmeasrlaatqqnwdyrwq 410
Cdd:cd00200 158 TIKLWDLRTG-----KCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLS------------------------- 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 411 qvpkiawkklklpGDSSLMTYRGHgvLHTLIRCRFSPahstGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVS 490
Cdd:cd00200 208 -------------TGKCLGTLRGH--ENGVNSVAFSP----DGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTSLA 268
                       330       340
                ....*....|....*....|.
gi 26329219 491 WHPFEEKIVSSSWDGNLRLWQ 511
Cdd:cd00200 269 WSPDGKRLASGSADGTIRIWD 289
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
220-513 2.00e-29

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 117.44  E-value: 2.00e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 220 SVLDVAFTPDGNHFLYSSWSDYIHICNIYGEGDTHTaldlrPDERRFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRR 299
Cdd:cd00200  11 GVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRT-----LKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLETGEC 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 300 TLQIESHEDDVNAVAFADiSSQILFSGGDDAICKVWDRRTmreddPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTI 379
Cdd:cd00200  86 VRTLTGHTSYVSSVAFSP-DGRILSSSSRDKTIKVWDVET-----GKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTI 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 380 KLWDIRrfssregmeasrlaatqqnwdyrwqqvpkiawkklklpGDSSLMTYRGH--GVLHtlirCRFSPahsTGQQFIy 457
Cdd:cd00200 160 KLWDLR--------------------------------------TGKCVATLTGHtgEVNS----VAFSP---DGEKLL- 193
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 26329219 458 SGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLWQYR 513
Cdd:cd00200 194 SSSSDGTIKLWDLSTGKCLGTLRGHENGVNSVAFSPDGYLLASGSEDGTIRVWDLR 249
WD40 COG2319
WD40 repeat [General function prediction only];
176-539 1.03e-24

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 107.10  E-value: 1.03e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 176 FCGIYSKDGQIFMSACQDQTIRLYDCRYGRfHKFKSIKARDVGWSVLDVAFTPDGNHFLYSSWSD--YIHICNIYGEGDT 253
Cdd:COG2319  69 TSIAFSPDGELLLSGSSDGTIKLWDLDNGE-KLIKSLEGLHDSSVSKLALSSPDGNSILLASSSLdgTVKLWDLSTPGKL 147
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 254 HTALDLRPDErrfaVFSIAVSSDGRE-VLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFSGGDDAIC 332
Cdd:COG2319 148 IRTLEGHSES----VTSLAFSPDGKLlASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLLIASGSSDGTI 223
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 333 KVWDRRTMREDDPKpvgaLAGHQDGITFIDSKgDARYLISNSKDQTIKLWDIRRFSSregMEASRLAATQQNWDYRWQQV 412
Cdd:COG2319 224 RLWDLSTGKLLRST----LSGHSDSVVSSFSP-DGSLLASGSSDGTIRLWDLRSSSS---LLRTLSGHSSSVLSVAFSPD 295
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 413 PKIA-----------WkKLKLPGDSSLMTYRGHGvlHTLIRCRFSPahsTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTN 481
Cdd:COG2319 296 GKLLasgssdgtvrlW-DLETGKLLSSLTLKGHE--GPVSSLSFSP---DGSLLVSGGSDDGTIRLWDLRTGKPLKTLEG 369
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 26329219 482 HKAcVRDVSWHPFEEKIVSSSWDGNLRLWQYRQAEYFQDDMPESDMNRVCSSGPTPVP 539
Cdd:COG2319 370 HSN-VLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLRNLDGHTSRVTSLDFSPDGKS 426
WD40 COG2319
WD40 repeat [General function prediction only];
152-533 1.42e-21

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 97.47  E-value: 1.42e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 152 EQSRVMSHFLPNDLSFTDTYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFHKFKSikardvgwSVLDVAFTPDGN 231
Cdd:COG2319   7 TSSENKSKLLKKSELGPSLNSLSLLSLGSSESGILLLALLSDSLVSLPDLSSLLLRGHED--------SITSIAFSPDGE 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 232 HFLYSSWSDYIHICNIYGEGDTHTALDLRPDERRFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTL-QIESHEDDV 310
Cdd:COG2319  79 LLLSGSSDGTIKLWDLDNGEKLIKSLEGLHDSSVSKLALSSPDGNSILLASSSLDGTVKLWDLSTPGKLIrTLEGHSESV 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 311 NAVAFADISSQILFSGGDDAICKVWDRRTmreddPKPVGALAGHQDGITFIDSKGDARYLI-SNSKDQTIKLWDIR---- 385
Cdd:COG2319 159 TSLAFSPDGKLLASGSSLDGTIKLWDLRT-----GKPLSTLAGHTDPVSSLAFSPDGGLLIaSGSSDGTIRLWDLStgkl 233
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 386 RFSSREGMEASRLAATQQN---------------WDYRwqqvpkiawkklklPGDSSLMTYRGHGvlHTLIRCRFSPAHS 450
Cdd:COG2319 234 LRSTLSGHSDSVVSSFSPDgsllasgssdgtirlWDLR--------------SSSSLLRTLSGHS--SSVLSVAFSPDGK 297
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 451 tgqqFIYSGCSTGKVVVYDLLSGHIVKKLT--NHKACVRDVSWHPFEEKIVSS-SWDGNLRLWQYRQAEYFQDDMPESDM 527
Cdd:COG2319 298 ----LLASGSSDGTVRLWDLETGKLLSSLTlkGHEGPVSSLSFSPDGSLLVSGgSDDGTIRLWDLRTGKPLKTLEGHSNV 373

                ....*.
gi 26329219 528 NRVCSS 533
Cdd:COG2319 374 LSVSFS 379
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
302-534 5.34e-21

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 93.17  E-value: 5.34e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 302 QIESHEDDVNAVAFADiSSQILFSGGDDAICKVWDRRTMReddpkPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKL 381
Cdd:cd00200   4 TLKGHTGGVTCVAFSP-DGKLLATGSGDGTIKVWDLETGE-----LLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRL 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 382 WDIRrfssregmeasrlaatqqnwdyrwqqvpkiawkklklpGDSSLMTYRGH--GVLHtlirCRFSPAHstgqQFIYSG 459
Cdd:cd00200  78 WDLE--------------------------------------TGECVRTLTGHtsYVSS----VAFSPDG----RILSSS 111
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 26329219 460 CSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLWQYRQAEYFQD-DMPESDMNRVCSSG 534
Cdd:cd00200 112 SRDKTIKVWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVATlTGHTGEVNSVAFSP 187
WD40 COG2319
WD40 repeat [General function prediction only];
173-387 1.56e-19

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 91.30  E-value: 1.56e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 173 QKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFHKFKSIKARDvgwSVLDVAFTPDGNHFLYSSWSDYIHICNIYGEGD 252
Cdd:COG2319 242 SDSVVSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSS---SVLSVAFSPDGKLLASGSSDGTVRLWDLETGKL 318
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 253 THTaldLRPDERRFAVFSIAVSSDG-REVLGGANDGCLYVFDREQNRRTLQIESHeDDVNAVAFaDISSQILFSGGDDAI 331
Cdd:COG2319 319 LSS---LTLKGHEGPVSSLSFSPDGsLLVSGGSDDGTIRLWDLRTGKPLKTLEGH-SNVLSVSF-SPDGRVVSSGSTDGT 393
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 26329219 332 CKVWDRRTmreddPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRRF 387
Cdd:COG2319 394 VRLWDLST-----GSLLRNLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKTS 444
WD40 COG2319
WD40 repeat [General function prediction only];
163-339 1.73e-13

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 72.43  E-value: 1.73e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 163 NDLSFTDTYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFHKFKSIKARDVgwSVLDVAFTPDGNHFLYSSWSDyi 242
Cdd:COG2319 275 SLLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTLKGHEG--PVSSLSFSPDGSLLVSGGSDD-- 350
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 243 HICNIYgegDTHTALDLRPDERRFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFaDISSQI 322
Cdd:COG2319 351 GTIRLW---DLRTGKPLKTLEGHSNVLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLRNLDGHTSRVTSLDF-SPDGKS 426
                       170
                ....*....|....*..
gi 26329219 323 LFSGGDDAICKVWDRRT 339
Cdd:COG2319 427 LASGSSDNTIRLWDLKT 443
WD40 COG2319
WD40 repeat [General function prediction only];
303-536 7.42e-12

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 67.42  E-value: 7.42e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 303 IESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTMREDDPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLW 382
Cdd:COG2319  13 SKLLKKSELGPSLNSLSLLSLGSSESGILLLALLSDSLVSLPDLSSLLLRGHEDSITSIAFSPDGELLLSGSSDGTIKLW 92
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 383 D-------IRRFSSREGMEASRLAATQQNWDYRW--QQVPKIAWKKLKLPGDSS-LMTYRGHGvlHTLIRCRFSPahsTG 452
Cdd:COG2319  93 DldngeklIKSLEGLHDSSVSKLALSSPDGNSILlaSSSLDGTVKLWDLSTPGKlIRTLEGHS--ESVTSLAFSP---DG 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219 453 QQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEK-IVSSSWDGNLRLWQYRQAEYFQ---DDMPESDMN 528
Cdd:COG2319 168 KLLASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLlIASGSSDGTIRLWDLSTGKLLRstlSGHSDSVVS 247

                ....*...
gi 26329219 529 RVCSSGPT 536
Cdd:COG2319 248 SFSPDGSL 255
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
141-384 5.13e-11

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 65.11  E-value: 5.13e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219  141 GLCHRGSFSlgeQSRVMSHFLPNDLsftdTYSQKAFCGI-YSKDGQIFMSACQDQTIRLYDCrygrfhkfKSI--KARDV 217
Cdd:PLN00181 458 GLCKYLSFS---KLRVKADLKQGDL----LNSSNLVCAIgFDRDGEFFATAGVNKKIKIFEC--------ESIikDGRDI 522
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219  218 GWSVLDVAFTPDGNHFLYSSW-------SDYIHICNIYGEGDTHTALDLRPDERRfaVFSIAVSSDGREVLG-GANDGCL 289
Cdd:PLN00181 523 HYPVVELASRSKLSGICWNSYiksqvasSNFEGVVQVWDVARSQLVTEMKEHEKR--VWSIDYSSADPTLLAsGSDDGSV 600
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219  290 YVFDREQNRRTLQIEShEDDVNAVAFADISSQILFSGGDDAICKVWDRRtmredDPK-PVGALAGHQDGITFIDSKgDAR 368
Cdd:PLN00181 601 KLWSINQGVSIGTIKT-KANICCVQFPSESGRSLAFGSADHKVYYYDLR-----NPKlPLCTMIGHSKTVSYVRFV-DSS 673
                        250
                 ....*....|....*.
gi 26329219  369 YLISNSKDQTIKLWDI 384
Cdd:PLN00181 674 TLVSSSTDNTLKLWDL 689
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
472-510 3.51e-07

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 46.54  E-value: 3.51e-07
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 26329219    472 SGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLW 510
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLW 39
WD40 pfam00400
WD domain, G-beta repeat;
473-510 5.13e-06

WD domain, G-beta repeat;


Pssm-ID: 334060 [Multi-domain]  Cd Length: 39  Bit Score: 43.12  E-value: 5.13e-06
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 26329219   473 GHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLW 510
Cdd:pfam00400   1 GKLLKTLEGHSSSVTSLAFSPDGKLLASGSDDGTVKVW 38
WD40 pfam00400
WD domain, G-beta repeat;
346-383 3.15e-05

WD domain, G-beta repeat;


Pssm-ID: 334060 [Multi-domain]  Cd Length: 39  Bit Score: 40.81  E-value: 3.15e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 26329219   346 KPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWD 383
Cdd:pfam00400   2 KLLKTLEGHSSSVTSLAFSPDGKLLASGSDDGTVKVWD 39
PTZ00420 PTZ00420
coronin; Provisional
244-384 1.08e-04

coronin; Provisional


Pssm-ID: 240412 [Multi-domain]  Cd Length: 568  Bit Score: 44.94  E-value: 1.08e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219  244 ICNIYGEGDTHTALDLRPDERRFAVFSIAVSSD----GREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADIS 319
Cdd:PTZ00420   7 IKNLYPDPSNNLFDDLRICSRVIDSCGIACSSGfvavPWEVEGGGLIGAIRLENQMRKPPVIKLKGHTSSILDLQFNPCF 86
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 26329219  320 SQILFSGGDDAICKVWDRRTMRED-----DPKPVgaLAGHQDGITFIDSKGDARYLISNSK-DQTIKLWDI 384
Cdd:PTZ00420  87 SEILASGSEDLTIRVWEIPHNDESvkeikDPQCI--LKGHKKKISIIDWNPMNYYIMCSSGfDSFVNIWDI 155
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
344-383 1.40e-04

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 39.22  E-value: 1.40e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 26329219    344 DPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWD 383
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
303-336 6.50e-04

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 37.29  E-value: 6.50e-04
                           10        20        30
                   ....*....|....*....|....*....|....
gi 26329219    303 IESHEDDVNAVAFADiSSQILFSGGDDAICKVWD 336
Cdd:smart00320   8 LKGHTGPVTSVAFSP-DGKYLASGSDDGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
303-336 9.29e-04

WD domain, G-beta repeat;


Pssm-ID: 334060 [Multi-domain]  Cd Length: 39  Bit Score: 36.96  E-value: 9.29e-04
                          10        20        30
                  ....*....|....*....|....*....|....
gi 26329219   303 IESHEDDVNAVAFADiSSQILFSGGDDAICKVWD 336
Cdd:pfam00400   7 LEGHSSSVTSLAFSP-DGKLLASGSDDGTVKVWD 39
PTZ00421 PTZ00421
coronin; Provisional
301-403 5.08e-03

coronin; Provisional


Pssm-ID: 173611 [Multi-domain]  Cd Length: 493  Bit Score: 39.49  E-value: 5.08e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26329219  301 LQIESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTmreddPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIK 380
Cdd:PTZ00421 119 VHLQGHTKKVGIVSFHPSAMNVLASAGADMVVNVWDVER-----GKAVEVIKCHSDQITSLEWNLDGSLLCTTSKDKKLN 193
                         90       100
                 ....*....|....*....|...
gi 26329219  381 LWDIRRFSSREGMEASRLAATQQ 403
Cdd:PTZ00421 194 IIDPRDGTIVSSVEAHASAKSQR 216
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH