NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|27808602|gb|AAO24581|]
View 

At3g29770 [Arabidopsis thaliana]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Abhydrolase super family cl21494
alpha/beta hydrolases; A functionally diverse superfamily containing proteases, lipases, ...
138-385 1.53e-62

alpha/beta hydrolases; A functionally diverse superfamily containing proteases, lipases, peroxidases, esterases, epoxide hydrolases and dehalogenases. The catalytic apparatus typically involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine, and often the mechanism involves a nucleophilic attack on a carbonyl carbon atom.


The actual alignment was detected with superfamily member PLN02965:

Pssm-ID: 354836  Cd Length: 255  Bit Score: 201.30  E-value: 1.53e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  138 HFVLVHGGSFGAWCWYKTIALLEEDGFKVTAIDLAGCGINSININGIASLSQYVKPLTDILEKLPIGEKVILVGHDFGGA 217
Cdd:PLN02965   5 HFVFVHGASHGAWCWYKLATLLDAAGFKSTCVDLTGAGISLTDSNTVSSSDQYNRPLFALLSDLPPDHKVILVGHSIGGG 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  218 CISYAMELFPSKISKAVFLAAAMLTNGQ-STLDMFSLKAGQNDLMRkaqiFIYTNGNENPPTAIDLDKSLLKDLLFNQSP 296
Cdd:PLN02965  85 SVTEALCKFTDKISMAIYVAAAMVKPGSiISPRLKNVMEGTEKIWD----YTFGEGPDKPPTGIMMKPEFVRHYYYNQSP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  297 SKDVALASVSMRSIPFAPVLEKLSLSDA-NYGSVRRYYIETLEDNAIPVTLQENMINSSPPEKVYRLKGADHAPFFSKPQ 375
Cdd:PLN02965 161 LEDYTLSSKLLRPAPVRAFQDLDKLPPNpEAEKVPRVYIKTAKDNLFDPVRQDVMVENWPPAQTYVLEDSDHSAFFSVPT 240
                        250
                 ....*....|
gi 27808602  376 ALHKLLLEIA 385
Cdd:PLN02965 241 TLFQYLLQAV 250
 
Name Accession Description Interval E-value
PLN02965 PLN02965
Probable pheophorbidase
138-385 1.53e-62

Probable pheophorbidase


Pssm-ID: 178549  Cd Length: 255  Bit Score: 201.30  E-value: 1.53e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  138 HFVLVHGGSFGAWCWYKTIALLEEDGFKVTAIDLAGCGINSININGIASLSQYVKPLTDILEKLPIGEKVILVGHDFGGA 217
Cdd:PLN02965   5 HFVFVHGASHGAWCWYKLATLLDAAGFKSTCVDLTGAGISLTDSNTVSSSDQYNRPLFALLSDLPPDHKVILVGHSIGGG 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  218 CISYAMELFPSKISKAVFLAAAMLTNGQ-STLDMFSLKAGQNDLMRkaqiFIYTNGNENPPTAIDLDKSLLKDLLFNQSP 296
Cdd:PLN02965  85 SVTEALCKFTDKISMAIYVAAAMVKPGSiISPRLKNVMEGTEKIWD----YTFGEGPDKPPTGIMMKPEFVRHYYYNQSP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  297 SKDVALASVSMRSIPFAPVLEKLSLSDA-NYGSVRRYYIETLEDNAIPVTLQENMINSSPPEKVYRLKGADHAPFFSKPQ 375
Cdd:PLN02965 161 LEDYTLSSKLLRPAPVRAFQDLDKLPPNpEAEKVPRVYIKTAKDNLFDPVRQDVMVENWPPAQTYVLEDSDHSAFFSVPT 240
                        250
                 ....*....|
gi 27808602  376 ALHKLLLEIA 385
Cdd:PLN02965 241 TLFQYLLQAV 250
Abhydrolase_1 pfam00561
alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.
137-374 2.15e-17

alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.


Pssm-ID: 334145 [Multi-domain]  Cd Length: 245  Bit Score: 80.63  E-value: 2.15e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602   137 NHFVLVHGGSFGAWCWYKTIALLEEDGFKVTAIDLAGCGINSININGIA-SLSQYVKPLTDILEKLPIgEKVILVGHDFG 215
Cdd:pfam00561   1 PPVLLLHGLPGSSDLWRKLAPALARDGFRVIALDLRGFGKSSRPPAQDDyRTDDLAEDLEYILDALGL-EKVNLVGHSMG 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602   216 GACISYAMELFPSKISKAVFLAAAMLTNGQSTLDMFslkAGQNDLMRKAQIFIY-TNGNENPPTAIDLDKSLLKDLLFNQ 294
Cdd:pfam00561  80 GLIALAYAAKYPDRVKALVLLGTLDPPHELDEADRF---ILALFPGFFDGYVADfAPNPLGRLVAKLLALLLLRLRLLKA 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602   295 SPSKDVALASVSmRSIPFAPVLEKLSL-----SDANYGSVRRYYIETL-----EDNAIPVTLQENMINSSPPEKVYRLKG 364
Cdd:pfam00561 157 LPLLNKRFPSED-YALAKSLVTGALLFieqwsTELRRKFLGRLDEPTLviwgdQDPLVPPQALEKLAQLFPNARLVVIPD 235
                         250
                  ....*....|
gi 27808602   365 ADHAPFFSKP 374
Cdd:pfam00561 236 AGHFAFLEGP 245
MhpC COG0596
Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General ...
140-388 1.77e-12

Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only];


Pssm-ID: 223669 [Multi-domain]  Cd Length: 282  Bit Score: 66.96  E-value: 1.77e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602 140 VLVHG--GSFGAWCWYKTIALLEEDGFKVTAIDLAGCGINSINIngiASLSQYVKPLTDILEKLPIgEKVILVGHDFGGA 217
Cdd:COG0596  25 VLLHGfpGSSSVWRPVFKVLPALAARYRVIAPDLRGHGRSDPAG---YSLSAYADDLAALLDALGL-EKVVLVGHSMGGA 100
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602 218 CISYAMELFPSKISKAVFLAAAMLTNGQSTLDMFSLKAGQNDLMRKAQIFIYTNGNENPPTAIDLDKSLLKDLLFNQSPS 297
Cdd:COG0596 101 VALALALRHPDRVRGLVLIGPAPPPGLLEAALRQPAGAAPLAALADLLLGLDAAAFAALLAALGLLAALAAAARAGLAEA 180
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602 298 KDVALASVSMRSIPFAPVLEKLSLSDANYGSVRRYYIETLE----------DNAIPVTLQENMINSSPPE-KVYRLKGAD 366
Cdd:COG0596 181 LRAPLLGAAAAAFARAARADLAAALLALLDRDLRAALARITvptliihgedDPVVPAELARRLAAALPNDaRLVVIPGAG 260
                       250       260
                ....*....|....*....|..
gi 27808602 367 HAPFFSKPQALHKLLLEIARIS 388
Cdd:COG0596 261 HFPHLEAPEAFAAALLAFLERL 282
 
Name Accession Description Interval E-value
PLN02965 PLN02965
Probable pheophorbidase
138-385 1.53e-62

Probable pheophorbidase


Pssm-ID: 178549  Cd Length: 255  Bit Score: 201.30  E-value: 1.53e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  138 HFVLVHGGSFGAWCWYKTIALLEEDGFKVTAIDLAGCGINSININGIASLSQYVKPLTDILEKLPIGEKVILVGHDFGGA 217
Cdd:PLN02965   5 HFVFVHGASHGAWCWYKLATLLDAAGFKSTCVDLTGAGISLTDSNTVSSSDQYNRPLFALLSDLPPDHKVILVGHSIGGG 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  218 CISYAMELFPSKISKAVFLAAAMLTNGQ-STLDMFSLKAGQNDLMRkaqiFIYTNGNENPPTAIDLDKSLLKDLLFNQSP 296
Cdd:PLN02965  85 SVTEALCKFTDKISMAIYVAAAMVKPGSiISPRLKNVMEGTEKIWD----YTFGEGPDKPPTGIMMKPEFVRHYYYNQSP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  297 SKDVALASVSMRSIPFAPVLEKLSLSDA-NYGSVRRYYIETLEDNAIPVTLQENMINSSPPEKVYRLKGADHAPFFSKPQ 375
Cdd:PLN02965 161 LEDYTLSSKLLRPAPVRAFQDLDKLPPNpEAEKVPRVYIKTAKDNLFDPVRQDVMVENWPPAQTYVLEDSDHSAFFSVPT 240
                        250
                 ....*....|
gi 27808602  376 ALHKLLLEIA 385
Cdd:PLN02965 241 TLFQYLLQAV 250
PLN02211 PLN02211
methyl indole-3-acetate methyltransferase
138-385 1.63e-59

methyl indole-3-acetate methyltransferase


Pssm-ID: 215128  Cd Length: 273  Bit Score: 193.95  E-value: 1.63e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  138 HFVLVHGGSFGAWCWYKTIALLEEDGFKVTAIDLAGCGINSININGIASLSQYVKPLTDILEKLPIGEKVILVGHDFGGA 217
Cdd:PLN02211  20 HFVLIHGISGGSWCWYKIRCLMENSGYKVTCIDLKSAGIDQSDADSVTTFDEYNKPLIDFLSSLPENEKVILVGHSAGGL 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  218 CISYAMELFPSKISKAVFLAAAMLTNGQSTLDMFslKAGQNDLMRKAQIFI--YTNGNENPPTAIDLDKSLLKDLLFNQS 295
Cdd:PLN02211 100 SVTQAIHRFPKKICLAVYVAATMLKLGFQTDEDM--KDGVPDLSEFGDVYElgFGLGPDQPPTSAIIKKEFRRKILYQMS 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  296 PSKDVALASVSMRSIPF-APVLEKLSLSDANYGSVRRYYIETLEDNAIPVTLQENMINSSPPEKVYRLKgADHAPFFSKP 374
Cdd:PLN02211 178 PQEDSTLAAMLLRPGPIlALRSARFEEETGDIDKVPRVYIKTLHDHVVKPEQQEAMIKRWPPSQVYELE-SDHSPFFSTP 256
                        250
                 ....*....|.
gi 27808602  375 QALHKLLLEIA 385
Cdd:PLN02211 257 FLLFGLLIKAA 267
Abhydrolase_1 pfam00561
alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.
137-374 2.15e-17

alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.


Pssm-ID: 334145 [Multi-domain]  Cd Length: 245  Bit Score: 80.63  E-value: 2.15e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602   137 NHFVLVHGGSFGAWCWYKTIALLEEDGFKVTAIDLAGCGINSININGIA-SLSQYVKPLTDILEKLPIgEKVILVGHDFG 215
Cdd:pfam00561   1 PPVLLLHGLPGSSDLWRKLAPALARDGFRVIALDLRGFGKSSRPPAQDDyRTDDLAEDLEYILDALGL-EKVNLVGHSMG 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602   216 GACISYAMELFPSKISKAVFLAAAMLTNGQSTLDMFslkAGQNDLMRKAQIFIY-TNGNENPPTAIDLDKSLLKDLLFNQ 294
Cdd:pfam00561  80 GLIALAYAAKYPDRVKALVLLGTLDPPHELDEADRF---ILALFPGFFDGYVADfAPNPLGRLVAKLLALLLLRLRLLKA 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602   295 SPSKDVALASVSmRSIPFAPVLEKLSL-----SDANYGSVRRYYIETL-----EDNAIPVTLQENMINSSPPEKVYRLKG 364
Cdd:pfam00561 157 LPLLNKRFPSED-YALAKSLVTGALLFieqwsTELRRKFLGRLDEPTLviwgdQDPLVPPQALEKLAQLFPNARLVVIPD 235
                         250
                  ....*....|
gi 27808602   365 ADHAPFFSKP 374
Cdd:pfam00561 236 AGHFAFLEGP 245
Abhydrolase_6 pfam12697
Alpha/beta hydrolase family; This family contains alpha/beta hydrolase enzymes of diverse ...
139-380 4.28e-17

Alpha/beta hydrolase family; This family contains alpha/beta hydrolase enzymes of diverse specificity.


Pssm-ID: 338449 [Multi-domain]  Cd Length: 216  Bit Score: 79.07  E-value: 4.28e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602   139 FVLVHGGSFGAWCWY-KTIALLEEDGFKVTAIDLAGCGINSININGIASLSQYVKPLTDILEKlpiGEKVILVGHDFGGA 217
Cdd:pfam12697   1 VVLVHGAGASASSWLvAPLAALLAAGYRVLAPDLPGHGSSDPPPLDLADLADLAALLAELGAA---GRPVVLVGHSLGGA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602   218 cisYAMELFPSKISKAVFLAAAMLTNGQSTlDMFSLKAGQNDLMRKAQIFIYTNGNEnpptaidldksllkdllFNQSPS 297
Cdd:pfam12697  78 ---VALAAAAAAPVVGVLLAPLALPLGLLA-ALLALLAALLAALAAPAWLRELLARG-----------------FLDDLP 136
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602   298 KDVALASVSMRSIPFAPVLEKLSLSDANyGSVRRYYIETLEDNAIPVTLQEnMINSSPPEKVYRLKGADHAPFFSkPQAL 377
Cdd:pfam12697 137 PDAAWAAALAALAALLAALALLPLAAWR-DLPAPVLVLAEEDRLVPPLAQR-LLAALAGARLVVLPGAGHLPLLD-PEEV 213

                  ...
gi 27808602   378 HKL 380
Cdd:pfam12697 214 AEA 216
MhpC COG0596
Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General ...
140-388 1.77e-12

Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only];


Pssm-ID: 223669 [Multi-domain]  Cd Length: 282  Bit Score: 66.96  E-value: 1.77e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602 140 VLVHG--GSFGAWCWYKTIALLEEDGFKVTAIDLAGCGINSINIngiASLSQYVKPLTDILEKLPIgEKVILVGHDFGGA 217
Cdd:COG0596  25 VLLHGfpGSSSVWRPVFKVLPALAARYRVIAPDLRGHGRSDPAG---YSLSAYADDLAALLDALGL-EKVVLVGHSMGGA 100
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602 218 CISYAMELFPSKISKAVFLAAAMLTNGQSTLDMFSLKAGQNDLMRKAQIFIYTNGNENPPTAIDLDKSLLKDLLFNQSPS 297
Cdd:COG0596 101 VALALALRHPDRVRGLVLIGPAPPPGLLEAALRQPAGAAPLAALADLLLGLDAAAFAALLAALGLLAALAAAARAGLAEA 180
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602 298 KDVALASVSMRSIPFAPVLEKLSLSDANYGSVRRYYIETLE----------DNAIPVTLQENMINSSPPE-KVYRLKGAD 366
Cdd:COG0596 181 LRAPLLGAAAAAFARAARADLAAALLALLDRDLRAALARITvptliihgedDPVVPAELARRLAAALPNDaRLVVIPGAG 260
                       250       260
                ....*....|....*....|..
gi 27808602 367 HAPFFSKPQALHKLLLEIARIS 388
Cdd:COG0596 261 HFPHLEAPEAFAAALLAFLERL 282
PldB COG2267
Lysophospholipase, alpha-beta hydrolase superfamily [Lipid transport and metabolism];
140-240 6.89e-07

Lysophospholipase, alpha-beta hydrolase superfamily [Lipid transport and metabolism];


Pssm-ID: 225176 [Multi-domain]  Cd Length: 298  Bit Score: 50.06  E-value: 6.89e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602 140 VLVHGGSFGAWCWYKTIALLEEDGFKVTAIDLAGCGINSINING-IASLSQYVKPLTDILE--KLPI-GEKVILVGHDFG 215
Cdd:COG2267  38 VLVHGLGEHSGRYEELADDLAARGFDVYALDLRGHGRSPRGQRGhVDSFADYVDDLDAFVEtiAEPDpGLPVFLLGHSMG 117
                        90       100
                ....*....|....*....|....*
gi 27808602 216 GACISYAMELFPSKISKAVFLAAAM 240
Cdd:COG2267 118 GLIALLYLARYPPRIDGLVLSSPAL 142
PRK14875 PRK14875
acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional
140-217 2.81e-04

acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional


Pssm-ID: 184875 [Multi-domain]  Cd Length: 371  Bit Score: 42.24  E-value: 2.81e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602  140 VLVHGgsFGA--WCWYKTIALLEEdGFKVTAIDLAGCGINSINInGIASLSQYVKPLTDILEKLPIgEKVILVGHDFGGA 217
Cdd:PRK14875 135 VLIHG--FGGdlNNWLFNHAALAA-GRPVIALDLPGHGASSKAV-GAGSLDELAAAVLAFLDALGI-ERAHLVGHSMGGA 209
EstA COG1075
Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold [Lipid transport and ...
139-239 4.95e-04

Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold [Lipid transport and metabolism];


Pssm-ID: 224001  Cd Length: 336  Bit Score: 41.72  E-value: 4.95e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602 139 FVLVHGGSFGA------WCWYKTIALLEEDGFKVTAIdlAGCGINSININGiASLSQYVKpltDILEKLPIgEKVILVGH 212
Cdd:COG1075  62 IVLVHGLGGGYgnflplDYRLAILGWLTNGVYAFELS--GGDGTYSLAVRG-EQLFAYVD---EVLAKTGA-KKVNLIGH 134
                        90       100
                ....*....|....*....|....*....
gi 27808602 213 DFGGACISYAMELFP--SKISKAVFLAAA 239
Cdd:COG1075 135 SMGGLDSRYYLGVLGgaNRVASVVTLGTP 163
Hydrolase_4 pfam12146
Serine aminopeptidase, S33; This domain is found in bacteria and eukaryotes and is ...
140-239 3.70e-03

Serine aminopeptidase, S33; This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. The majority of the members in this family carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in UniProtKB:Q7ZWC2.


Pssm-ID: 338260 [Multi-domain]  Cd Length: 237  Bit Score: 38.34  E-value: 3.70e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27808602   140 VLVHG-----GSFGAWCWYktialLEEDGFKVTAIDLAGCGiNSINING-IASLSQYVKPLTDILEKL----PiGEKVIL 209
Cdd:pfam12146   8 VLVHGmgehsGRYAHLADA-----LAAQGFAVYAYDHRGHG-RSDGKRGhVPSFDDYVDDLDTFVDHIrarhP-GLPLFL 80
                          90       100       110
                  ....*....|....*....|....*....|
gi 27808602   210 VGHDFGGACISYAMELFPSKISKAVFLAAA 239
Cdd:pfam12146  81 LGHSMGGAIAALYALRYPDKVAGLILSAPA 110
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH