NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|21593717|gb|AAM65684|]
View 

AKIN beta1 [Arabidopsis thaliana]

Protein Classification

E_set_AMPKbeta_like_N and AMPKBI domain-containing protein (domain architecture ID 11244027)

E_set_AMPKbeta_like_N and AMPKBI domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AMPK1_CBM pfam16561
Glycogen recognition site of AMP-activated protein kinase; AMPK1_CBM is a family found in ...
101-180 1.67e-41

Glycogen recognition site of AMP-activated protein kinase; AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.


:

Pssm-ID: 339778 [Multi-domain]  Cd Length: 80  Bit Score: 137.61  E-value: 1.67e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21593717   101 IPTIITWNQGGNDVTVEGSWDNWRSRKKLQKSGKDHSILFVLPSGIYHYKVIVDGESKYIPDLPFVADEVGNVCNILDVH 180
Cdd:pfam16561   1 VPTVIRWRGGGKKVYVTGSFDNWKKKIPLQRSGGDFSTILDLPPGTHQYKFIVDGEWRHDPDLPTATDDMGNLNNYIEVK 80
AMPKBI pfam04739
5'-AMP-activated protein kinase beta subunit, interaction domain; This region is found in the ...
214-280 5.00e-25

5'-AMP-activated protein kinase beta subunit, interaction domain; This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.


:

Pssm-ID: 309744  Cd Length: 69  Bit Score: 94.53  E-value: 5.00e-25
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 21593717   214 AKEPLAVPPQLHLTLL----GTTEETAIATKPQHVVLNHVFIEQGWtpQSIVALGLTHRFESKYITVVLYK 280
Cdd:pfam04739   1 AKEPPALPPHLLLTILnkppSSSDDPSVLPRPNHVVLNHLYTSSIK--DGVLALGTTTRYRSKYVTTVLYK 69
 
Name Accession Description Interval E-value
AMPK1_CBM pfam16561
Glycogen recognition site of AMP-activated protein kinase; AMPK1_CBM is a family found in ...
101-180 1.67e-41

Glycogen recognition site of AMP-activated protein kinase; AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.


Pssm-ID: 339778 [Multi-domain]  Cd Length: 80  Bit Score: 137.61  E-value: 1.67e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21593717   101 IPTIITWNQGGNDVTVEGSWDNWRSRKKLQKSGKDHSILFVLPSGIYHYKVIVDGESKYIPDLPFVADEVGNVCNILDVH 180
Cdd:pfam16561   1 VPTVIRWRGGGKKVYVTGSFDNWKKKIPLQRSGGDFSTILDLPPGTHQYKFIVDGEWRHDPDLPTATDDMGNLNNYIEVK 80
AMPKBI pfam04739
5'-AMP-activated protein kinase beta subunit, interaction domain; This region is found in the ...
214-280 5.00e-25

5'-AMP-activated protein kinase beta subunit, interaction domain; This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.


Pssm-ID: 309744  Cd Length: 69  Bit Score: 94.53  E-value: 5.00e-25
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 21593717   214 AKEPLAVPPQLHLTLL----GTTEETAIATKPQHVVLNHVFIEQGWtpQSIVALGLTHRFESKYITVVLYK 280
Cdd:pfam04739   1 AKEPPALPPHLLLTILnkppSSSDDPSVLPRPNHVVLNHLYTSSIK--DGVLALGTTTRYRSKYVTTVLYK 69
AMPKBI smart01010
5'-AMP-activated protein kinase beta subunit, interation domain; This region is found in the ...
197-282 8.56e-25

5'-AMP-activated protein kinase beta subunit, interation domain; This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.


Pssm-ID: 214973  Cd Length: 100  Bit Score: 95.08  E-value: 8.56e-25
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21593717    197 PSPDHSYGQTLPAA-----------EDYAKEPLAVPPQLHLTLL-----GTTEETAIATKPQHVVLNHVFIEQgwTPQSI 260
Cdd:smart01010   1 QSPPESYTNEIPACftdddfieespEEKWKEPPALPPHLEKVILntsstATREDPSLLPIPNHVVLNHLYTSS--IKDGV 78
                           90       100
                   ....*....|....*....|..
gi 21593717    261 VALGLTHRFESKYITVVLYKPL 282
Cdd:smart01010  79 LAVAATTRYRGKYVTQVLYKPL 100
E_set_AMPKbeta_like_N cd02859
N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain ...
102-179 8.38e-24

N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit; E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.


Pssm-ID: 199889 [Multi-domain]  Cd Length: 80  Bit Score: 91.89  E-value: 8.38e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21593717 102 PTIITWN-QGGNDVTVEGSWDNWRSRKKLQKSGK-DHSILFVLPSGIYHYKVIVDGESKYIPDLPFVADEVGNVCNILDV 179
Cdd:cd02859   1 PVTFRWPgPGGKEVYVTGSFDNWQQPIPLEKSGDgEFSATVELPPGRYEYKFIVDGEWVHDPDLPTVTDEFGNLNNVLEV 80
 
Name Accession Description Interval E-value
AMPK1_CBM pfam16561
Glycogen recognition site of AMP-activated protein kinase; AMPK1_CBM is a family found in ...
101-180 1.67e-41

Glycogen recognition site of AMP-activated protein kinase; AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.


Pssm-ID: 339778 [Multi-domain]  Cd Length: 80  Bit Score: 137.61  E-value: 1.67e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21593717   101 IPTIITWNQGGNDVTVEGSWDNWRSRKKLQKSGKDHSILFVLPSGIYHYKVIVDGESKYIPDLPFVADEVGNVCNILDVH 180
Cdd:pfam16561   1 VPTVIRWRGGGKKVYVTGSFDNWKKKIPLQRSGGDFSTILDLPPGTHQYKFIVDGEWRHDPDLPTATDDMGNLNNYIEVK 80
AMPKBI pfam04739
5'-AMP-activated protein kinase beta subunit, interaction domain; This region is found in the ...
214-280 5.00e-25

5'-AMP-activated protein kinase beta subunit, interaction domain; This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.


Pssm-ID: 309744  Cd Length: 69  Bit Score: 94.53  E-value: 5.00e-25
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 21593717   214 AKEPLAVPPQLHLTLL----GTTEETAIATKPQHVVLNHVFIEQGWtpQSIVALGLTHRFESKYITVVLYK 280
Cdd:pfam04739   1 AKEPPALPPHLLLTILnkppSSSDDPSVLPRPNHVVLNHLYTSSIK--DGVLALGTTTRYRSKYVTTVLYK 69
AMPKBI smart01010
5'-AMP-activated protein kinase beta subunit, interation domain; This region is found in the ...
197-282 8.56e-25

5'-AMP-activated protein kinase beta subunit, interation domain; This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.


Pssm-ID: 214973  Cd Length: 100  Bit Score: 95.08  E-value: 8.56e-25
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21593717    197 PSPDHSYGQTLPAA-----------EDYAKEPLAVPPQLHLTLL-----GTTEETAIATKPQHVVLNHVFIEQgwTPQSI 260
Cdd:smart01010   1 QSPPESYTNEIPACftdddfieespEEKWKEPPALPPHLEKVILntsstATREDPSLLPIPNHVVLNHLYTSS--IKDGV 78
                           90       100
                   ....*....|....*....|..
gi 21593717    261 VALGLTHRFESKYITVVLYKPL 282
Cdd:smart01010  79 LAVAATTRYRGKYVTQVLYKPL 100
E_set_AMPKbeta_like_N cd02859
N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain ...
102-179 8.38e-24

N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit; E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.


Pssm-ID: 199889 [Multi-domain]  Cd Length: 80  Bit Score: 91.89  E-value: 8.38e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21593717 102 PTIITWN-QGGNDVTVEGSWDNWRSRKKLQKSGK-DHSILFVLPSGIYHYKVIVDGESKYIPDLPFVADEVGNVCNILDV 179
Cdd:cd02859   1 PVTFRWPgPGGKEVYVTGSFDNWQQPIPLEKSGDgEFSATVELPPGRYEYKFIVDGEWVHDPDLPTVTDEFGNLNNVLEV 80
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH