NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|21218387|gb|AAM44061|]
View 

annexin XIIIb [Oryctolagus cuniculus]

Protein Classification

annexin (domain architecture ID 10446041)

annexin belongs to a family of calcium- and phospholipid-binding proteins that have been implicated in many cellular processes, including channel formation, membrane fusion, vesicle transport, and regulation of phospholipase A2 activity

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
59-124 9.74e-26

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


:

Pssm-ID: 333913  Cd Length: 66  Bit Score: 97.93  E-value: 9.74e-26
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21218387    59 RDVKKLNKACKGMGTDEAAIIEILSTRTSEQRQQIKQKYKTAYGKDLEEVLKGELSGNFEKAALAL 124
Cdd:pfam00191   1 YDAELLRKAMKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
131-196 2.89e-23

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


:

Pssm-ID: 333913  Cd Length: 66  Bit Score: 91.38  E-value: 2.89e-23
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21218387   131 YAARLLQKAMKGLGTDEALLIEILCTTTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLERILVSL 196
Cdd:pfam00191   1 YDAELLRKAMKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
290-355 6.65e-23

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


:

Pssm-ID: 333913  Cd Length: 66  Bit Score: 90.22  E-value: 6.65e-23
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21218387   290 YFAERLYKSMKGAGTDEETLIGIIVTRAEVDLPGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVAL 355
Cdd:pfam00191   1 YDAELLRKAMKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
214-280 1.56e-19

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


:

Pssm-ID: 333913  Cd Length: 66  Bit Score: 80.98  E-value: 1.56e-19
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 21218387   214 QDAKELYDAgEGRWGTDELAFNEVLARRNYKQLRATFQAYQMLIGKDIEAAIEEETSGDLKKAYLTL 280
Cdd:pfam00191   1 YDAELLRKA-MKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
 
Name Accession Description Interval E-value
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
59-124 9.74e-26

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 333913  Cd Length: 66  Bit Score: 97.93  E-value: 9.74e-26
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21218387    59 RDVKKLNKACKGMGTDEAAIIEILSTRTSEQRQQIKQKYKTAYGKDLEEVLKGELSGNFEKAALAL 124
Cdd:pfam00191   1 YDAELLRKAMKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
131-196 2.89e-23

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 333913  Cd Length: 66  Bit Score: 91.38  E-value: 2.89e-23
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21218387   131 YAARLLQKAMKGLGTDEALLIEILCTTTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLERILVSL 196
Cdd:pfam00191   1 YDAELLRKAMKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
290-355 6.65e-23

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 333913  Cd Length: 66  Bit Score: 90.22  E-value: 6.65e-23
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21218387   290 YFAERLYKSMKGAGTDEETLIGIIVTRAEVDLPGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVAL 355
Cdd:pfam00191   1 YDAELLRKAMKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
ANX smart00335
Annexin repeats;
72-124 4.71e-22

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 87.46  E-value: 4.71e-22
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 21218387     72 GTDEAAIIEILSTRTSEQRQQIKQKYKTAYGKDLEEVLKGELSGNFEKAALAL 124
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
214-280 1.56e-19

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 333913  Cd Length: 66  Bit Score: 80.98  E-value: 1.56e-19
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 21218387   214 QDAKELYDAgEGRWGTDELAFNEVLARRNYKQLRATFQAYQMLIGKDIEAAIEEETSGDLKKAYLTL 280
Cdd:pfam00191   1 YDAELLRKA-MKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
ANX smart00335
Annexin repeats;
303-355 7.06e-18

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 76.29  E-value: 7.06e-18
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 21218387    303 GTDEETLIGIIVTRAEVDLPGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVAL 355
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
ANX smart00335
Annexin repeats;
144-196 8.73e-18

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 75.91  E-value: 8.73e-18
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 21218387    144 GTDEALLIEILCTTTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLERILVSL 196
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
ANX smart00335
Annexin repeats;
228-280 2.76e-15

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 68.97  E-value: 2.76e-15
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 21218387    228 GTDELAFNEVLARRNYKQLRATFQAYQMLIGKDIEAAIEEETSGDLKKAYLTL 280
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
 
Name Accession Description Interval E-value
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
59-124 9.74e-26

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 333913  Cd Length: 66  Bit Score: 97.93  E-value: 9.74e-26
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21218387    59 RDVKKLNKACKGMGTDEAAIIEILSTRTSEQRQQIKQKYKTAYGKDLEEVLKGELSGNFEKAALAL 124
Cdd:pfam00191   1 YDAELLRKAMKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
131-196 2.89e-23

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 333913  Cd Length: 66  Bit Score: 91.38  E-value: 2.89e-23
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21218387   131 YAARLLQKAMKGLGTDEALLIEILCTTTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLERILVSL 196
Cdd:pfam00191   1 YDAELLRKAMKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
290-355 6.65e-23

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 333913  Cd Length: 66  Bit Score: 90.22  E-value: 6.65e-23
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21218387   290 YFAERLYKSMKGAGTDEETLIGIIVTRAEVDLPGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVAL 355
Cdd:pfam00191   1 YDAELLRKAMKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
ANX smart00335
Annexin repeats;
72-124 4.71e-22

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 87.46  E-value: 4.71e-22
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 21218387     72 GTDEAAIIEILSTRTSEQRQQIKQKYKTAYGKDLEEVLKGELSGNFEKAALAL 124
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
214-280 1.56e-19

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 333913  Cd Length: 66  Bit Score: 80.98  E-value: 1.56e-19
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 21218387   214 QDAKELYDAgEGRWGTDELAFNEVLARRNYKQLRATFQAYQMLIGKDIEAAIEEETSGDLKKAYLTL 280
Cdd:pfam00191   1 YDAELLRKA-MKGLGTDEDTLIEILATRSNAQLQAIREAYKKMYGKDLEKDIKSETSGDFEKLLLAL 66
ANX smart00335
Annexin repeats;
303-355 7.06e-18

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 76.29  E-value: 7.06e-18
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 21218387    303 GTDEETLIGIIVTRAEVDLPGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVAL 355
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
ANX smart00335
Annexin repeats;
144-196 8.73e-18

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 75.91  E-value: 8.73e-18
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 21218387    144 GTDEALLIEILCTTTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLERILVSL 196
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
ANX smart00335
Annexin repeats;
228-280 2.76e-15

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 68.97  E-value: 2.76e-15
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 21218387    228 GTDELAFNEVLARRNYKQLRATFQAYQMLIGKDIEAAIEEETSGDLKKAYLTL 280
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH