NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|20530737|gb|AAM27211|]
View 

multidrug resistance protein 4 [Aspergillus fumigatus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
842-1432 6.18e-115

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


:

Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 373.30  E-value: 6.18e-115
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  842 WVLLGLAMSVIIGGSYSAEAIVFGHTVGSLSPcrSAEAISRDGNLYGLLFFILALVEFGANVVGGcafgWAADKVLYRIR 921
Cdd:COG1132   15 LLLLAILLLLLSALLSLLLPLLIGRIIDALLA--DLGELLELLLLLLLLALLGGVLRALQSYLGS----RLGQKIVADLR 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  922 VLSLRSLLGQTVKWHEseDRTPGTLLTYITGDASALGGITGTTIGLLLATAVNLIGGLVISFSIAWKITIVLFPTIPVL- 1000
Cdd:COG1132   89 RDLFEKLLRLPLSFFD--KAKSGDLISRLTNDVEAVSNLVSTVLVLVFTSILLLIGSLVLLFSLSWRLALILLLILPLLa 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1001 LVSGMMKLRVQKqLAERHQKAFAKATAVTIEAVDNIRAVSAFSLEKQSYQVYGRALRGPYRATIKATFHGNAWLALAFSI 1080
Cdd:COG1132  167 LVLSLLARKSRK-LSRRVREALGELNARLLESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRASRLEALLAPLMLLL 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1081 SNLVYALAYWWGSKQIAEGRYSQTQFFIVMPALLFSTQSCGQMFALAPDISKAGVASSNIVELLTTRSaedevtpgsshs 1160
Cdd:COG1132  246 SSLGTVLVLALGGFLVLSGSLTVGALAAFILYLLRLLTPILQLGEVVSLLQRASAAAERLFELLDEEP------------ 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1161 fqpssslleektavqDIEAQEYARSTRQRAAErggmgaqLRDVHFTYPhrPERPVLKGLNIDIKPGQFCALVGPSGSGKS 1240
Cdd:COG1132  314 ---------------EVEDPPDPLKDTIGSIE-------FENVSFSYP--GKKPVLKDISFSIEPGEKVAIVGPSGSGKS 369
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1241 TTFAMLERFYRPNAGAVVIDGVDVtRQVGTEF-RDDIALVPQQNILFEGTVAFNVALGaCPGHepTQEEIEEACRMANIH 1319
Cdd:COG1132  370 TLIKLLLRLYDPTSGEILIDGIDI-RDISLDSlRKRIGIVSQDPLLFSGTIRENIALG-RPDA--TDEEIEEALKLANAH 445
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1320 DVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVESEKRIQEALATLAGRTTVVAIAHRLN 1399
Cdd:COG1132  446 EFIANLPDGYDTIVGERGVNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIAHRLS 525
                        570       580       590
                 ....*....|....*....|....*....|...
gi 20530737 1400 TIHRADQIFLIEDGRCIEQGTHQQLIQRSETYR 1432
Cdd:COG1132  526 TIKNADRIIVLDNGRIVERGTHEELLAKGGLYA 558
PTZ00265 super family cl36537
multidrug resistance protein (mdr1); Provisional
142-1425 1.49e-114

multidrug resistance protein (mdr1); Provisional


The actual alignment was detected with superfamily member PTZ00265:

Pssm-ID: 240339 [Multi-domain]  Cd Length: 1466  Bit Score: 394.78  E-value: 1.49e-114
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   142 AICAGIPFPLLGIVFGDLINDLNtvtcsssdratadLSSAVRAKVLYVIYITIANFWFIYAHSTCWCLVSERLARRYRRR 221
Cdd:PTZ00265   69 ATISGGTLPFFVSVFGVIMKNMN-------------LGENVNDIIFSLVLIGIFQFILSFISSFCMDVVTTKILKTLKLE 135
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   222 YFESIIKQEAKFIESLPSGDVVSRLVSDIELVQSGTSEKVGLVISTLSYFVAAYVVAFIKVPKIAGMLVSVVPCFFLMAL 301
Cdd:PTZ00265  136 FLKSVFYQDGQFHDNNPGSKLTSDLDFYLEQVNAGIGTKFITIFTYASAFLGLYIWSLFKNARLTLCITCVFPLIYICGV 215
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   302 ggghyIKKFAGRLAEKV-----NAATSIASSSLSHL----------TLVHAFNANdrlEKRFAGYLLQsrkdAVRKATTH 366
Cdd:PTZ00265  216 -----ICNKKVKINKKTsllynNNTMSIIEEALVGIrtvvsycgekTILKKFNLS---EKLYSKYILK----ANFMESLH 283
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   367 AAQLGCLYFIAYsanALAFWEGSQMISKSVADG--NSGTSVGAVYTVIFVLIDASFILSQVAPFIHVFASAAGASERLLQ 444
Cdd:PTZ00265  284 IGMINGFILASY---AFGFWYGTRIIISDLSNQqpNNDFHGGSVISILLGVLISMFMLTIILPNITEYMKSLEATNSLYE 360
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   445 VINRPSAIDGTSDsGDKTAAFgeEDIRFRDVHFKYPSRPDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDP 524
Cdd:PTZ00265  361 IINRKPLVENNDD-GKKLKDI--KKIQFKNVRFHYDTRKDVEIYKDLNFTLTEGKTYAFVGESGCGKSTILKLIERLYDP 437
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   525 DSGDVLIGDK-NFRDINVRYLRGNIGYVQQEPSLLDRTILENIAYGLVS----SAMERHQRLAPFILDSSL--------- 590
Cdd:PTZ00265  438 TEGDIIINDShNLKDINLKWWRSKIGVVSQDPLLFSNSIKNNIKYSLYSlkdlEALSNYYNEDGNDSQENKnkrnscrak 517
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   591 --PDLAEKIREGLTEK--EALREYDSCV-TEIVDLVKEAAANanalGFIEALPYGFATNVGTAGNQLSGGQKQRIALARA 665
Cdd:PTZ00265  518 caGDLNDMSNTTDSNEliEMRKNYQTIKdSEVVDVSKKVLIH----DFVSALPDKYETLVGSNASKLSGGQKQRISIARA 593
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   666 LVREPCLLILDEATAALDSTSEQLIQAALNRV--SERVTTVSIAHRLATAKNAHKIVVV----QSGRVT----------- 728
Cdd:PTZ00265  594 IIRNPKILILDEATSSLDNKSEYLVQKTINNLkgNENRITIIIAHRLSTIRYANTIFVLsnreRGSTVDvdiigedptkd 673
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   729 --------------------------------EEGSHTDLV-SRGGVYAEMVRLQNLG--KLSLDDRVISGDMISALNAT 773
Cdd:PTZ00265  674 nkennnknnkddnnnnnnnnnnkinnagsyiiEQGTHDALMkNKNGIYYTMINNQKVSskKSSNNDNDKDSDMKSSAYKD 753
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   774 PETRQLLDEKQAF-VDGNRS---DITEDTVVADTPSDSRDGSEEEARKKRKRTRSAGFVTRYTFALIRPNLHWVLLgLAM 849
Cdd:PTZ00265  754 SERGYDPDEMNGNsKHENESasnKKSCKMSDENASENNAGGKLPFLRNLFKRKPKAPNNLRIVYREIFSYKKDVTI-IAL 832
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   850 SVII-GGSYSAEAIVFGHTVGSLSPCRSAEAISRDGNLYGLL-----FFILALVEFGANVVGgcafgwaaDKVLYRIRVL 923
Cdd:PTZ00265  833 SILVaGGLYPVFALLYAKYVSTLFDFANLEANSNKYSLYILViaiamFISETLKNYYNNVIG--------EKVEKTMKRR 904
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   924 SLRSLLGQTVKWHESEDRTPGTLLTYITGDASALGgiTGTTIGLLLAT--AVNLIGGLVISFS----IAWKITIVLFPTI 997
Cdd:PTZ00265  905 LFENILYQEISFFDQDKHAPGLLSAHINRDVHLLK--TGLVNNIVIFThfIVLFLVSMVMSFYfcpiVAAVLTGTYFIFM 982
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   998 PVLLVSGMMKLR--VQKQLAERHQKAFAKATAVTI---------EAVDNIRAVSAFSLEKQSYQVYGRALRGPYRATIKA 1066
Cdd:PTZ00265  983 RVFAIRARLTANkdVEKKEINQPGTVFAYNSDDEIfkdpsfliqEAFYNMNTVIIYGLEDYFCNLIEKAIDYSNKGQKRK 1062
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1067 TFHGNAWLALAFSISNLVYALAYWWGSKQIAEGRYSQTQFFIVMPALLFSTQSCGQMFALAPDISKAGVASSNIVELLTT 1146
Cdd:PTZ00265 1063 TLVNSMLWGFSQSAQLFINSFAYWFGSFLIRRGTILVDDFMKSLFTFLFTGSYAGKLMSLKGDSENAKLSFEKYYPLIIR 1142
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1147 RSAEDEVTPGSSHSFQPssslleektavQDIEAQeyarstrqraaerggmgAQLRDVHFTYPHRPERPVLKGLNIDIKPG 1226
Cdd:PTZ00265 1143 KSNIDVRDNGGIRIKNK-----------NDIKGK-----------------IEIMDVNFRYISRPNVPIYKDLTFSCDSK 1194
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1227 QFCALVGPSGSGKSTTFAMLERFYR------------------------------------------------------P 1252
Cdd:PTZ00265 1195 KTTAIVGETGSGKSTVMSLLMRFYDlkndhhivfknehtndmtneqdyqgdeeqnvgmknvnefsltkeggsgedstvfK 1274
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1253 NAGAVVIDGVDVTRQVGTEFRDDIALVPQQNILFEGTVAFNVALGAcpgHEPTQEEIEEACRMANIHDVIMTLPQGYQTM 1332
Cdd:PTZ00265 1275 NSGKILLDGVDICDYNLKDLRNLFSIVSQEPMLFNMSIYENIKFGK---EDATREDVKRACKFAAIDEFIESLPNKYDTN 1351
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1333 CSHDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVESEKRIQEALATLAGRT--TVVAIAHRLNTIHRADQIFLI 1410
Cdd:PTZ00265 1352 VGPYGKSLSGGQKQRIAIARALLREPKILLLDEATSSLDSNSEKLIEKTIVDIKDKAdkTIITIAHRIASIKRSDKIVVF 1431
                        1450      1460
                  ....*....|....*....|
gi 20530737  1411 ED----GRCIE-QGTHQQLI 1425
Cdd:PTZ00265 1432 NNpdrtGSFVQaHGTHEELL 1451
 
Name Accession Description Interval E-value
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
842-1432 6.18e-115

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 373.30  E-value: 6.18e-115
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  842 WVLLGLAMSVIIGGSYSAEAIVFGHTVGSLSPcrSAEAISRDGNLYGLLFFILALVEFGANVVGGcafgWAADKVLYRIR 921
Cdd:COG1132   15 LLLLAILLLLLSALLSLLLPLLIGRIIDALLA--DLGELLELLLLLLLLALLGGVLRALQSYLGS----RLGQKIVADLR 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  922 VLSLRSLLGQTVKWHEseDRTPGTLLTYITGDASALGGITGTTIGLLLATAVNLIGGLVISFSIAWKITIVLFPTIPVL- 1000
Cdd:COG1132   89 RDLFEKLLRLPLSFFD--KAKSGDLISRLTNDVEAVSNLVSTVLVLVFTSILLLIGSLVLLFSLSWRLALILLLILPLLa 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1001 LVSGMMKLRVQKqLAERHQKAFAKATAVTIEAVDNIRAVSAFSLEKQSYQVYGRALRGPYRATIKATFHGNAWLALAFSI 1080
Cdd:COG1132  167 LVLSLLARKSRK-LSRRVREALGELNARLLESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRASRLEALLAPLMLLL 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1081 SNLVYALAYWWGSKQIAEGRYSQTQFFIVMPALLFSTQSCGQMFALAPDISKAGVASSNIVELLTTRSaedevtpgsshs 1160
Cdd:COG1132  246 SSLGTVLVLALGGFLVLSGSLTVGALAAFILYLLRLLTPILQLGEVVSLLQRASAAAERLFELLDEEP------------ 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1161 fqpssslleektavqDIEAQEYARSTRQRAAErggmgaqLRDVHFTYPhrPERPVLKGLNIDIKPGQFCALVGPSGSGKS 1240
Cdd:COG1132  314 ---------------EVEDPPDPLKDTIGSIE-------FENVSFSYP--GKKPVLKDISFSIEPGEKVAIVGPSGSGKS 369
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1241 TTFAMLERFYRPNAGAVVIDGVDVtRQVGTEF-RDDIALVPQQNILFEGTVAFNVALGaCPGHepTQEEIEEACRMANIH 1319
Cdd:COG1132  370 TLIKLLLRLYDPTSGEILIDGIDI-RDISLDSlRKRIGIVSQDPLLFSGTIRENIALG-RPDA--TDEEIEEALKLANAH 445
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1320 DVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVESEKRIQEALATLAGRTTVVAIAHRLN 1399
Cdd:COG1132  446 EFIANLPDGYDTIVGERGVNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIAHRLS 525
                        570       580       590
                 ....*....|....*....|....*....|...
gi 20530737 1400 TIHRADQIFLIEDGRCIEQGTHQQLIQRSETYR 1432
Cdd:COG1132  526 TIKNADRIIVLDNGRIVERGTHEELLAKGGLYA 558
PTZ00265 PTZ00265
multidrug resistance protein (mdr1); Provisional
142-1425 1.49e-114

multidrug resistance protein (mdr1); Provisional


Pssm-ID: 240339 [Multi-domain]  Cd Length: 1466  Bit Score: 394.78  E-value: 1.49e-114
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   142 AICAGIPFPLLGIVFGDLINDLNtvtcsssdratadLSSAVRAKVLYVIYITIANFWFIYAHSTCWCLVSERLARRYRRR 221
Cdd:PTZ00265   69 ATISGGTLPFFVSVFGVIMKNMN-------------LGENVNDIIFSLVLIGIFQFILSFISSFCMDVVTTKILKTLKLE 135
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   222 YFESIIKQEAKFIESLPSGDVVSRLVSDIELVQSGTSEKVGLVISTLSYFVAAYVVAFIKVPKIAGMLVSVVPCFFLMAL 301
Cdd:PTZ00265  136 FLKSVFYQDGQFHDNNPGSKLTSDLDFYLEQVNAGIGTKFITIFTYASAFLGLYIWSLFKNARLTLCITCVFPLIYICGV 215
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   302 ggghyIKKFAGRLAEKV-----NAATSIASSSLSHL----------TLVHAFNANdrlEKRFAGYLLQsrkdAVRKATTH 366
Cdd:PTZ00265  216 -----ICNKKVKINKKTsllynNNTMSIIEEALVGIrtvvsycgekTILKKFNLS---EKLYSKYILK----ANFMESLH 283
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   367 AAQLGCLYFIAYsanALAFWEGSQMISKSVADG--NSGTSVGAVYTVIFVLIDASFILSQVAPFIHVFASAAGASERLLQ 444
Cdd:PTZ00265  284 IGMINGFILASY---AFGFWYGTRIIISDLSNQqpNNDFHGGSVISILLGVLISMFMLTIILPNITEYMKSLEATNSLYE 360
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   445 VINRPSAIDGTSDsGDKTAAFgeEDIRFRDVHFKYPSRPDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDP 524
Cdd:PTZ00265  361 IINRKPLVENNDD-GKKLKDI--KKIQFKNVRFHYDTRKDVEIYKDLNFTLTEGKTYAFVGESGCGKSTILKLIERLYDP 437
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   525 DSGDVLIGDK-NFRDINVRYLRGNIGYVQQEPSLLDRTILENIAYGLVS----SAMERHQRLAPFILDSSL--------- 590
Cdd:PTZ00265  438 TEGDIIINDShNLKDINLKWWRSKIGVVSQDPLLFSNSIKNNIKYSLYSlkdlEALSNYYNEDGNDSQENKnkrnscrak 517
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   591 --PDLAEKIREGLTEK--EALREYDSCV-TEIVDLVKEAAANanalGFIEALPYGFATNVGTAGNQLSGGQKQRIALARA 665
Cdd:PTZ00265  518 caGDLNDMSNTTDSNEliEMRKNYQTIKdSEVVDVSKKVLIH----DFVSALPDKYETLVGSNASKLSGGQKQRISIARA 593
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   666 LVREPCLLILDEATAALDSTSEQLIQAALNRV--SERVTTVSIAHRLATAKNAHKIVVV----QSGRVT----------- 728
Cdd:PTZ00265  594 IIRNPKILILDEATSSLDNKSEYLVQKTINNLkgNENRITIIIAHRLSTIRYANTIFVLsnreRGSTVDvdiigedptkd 673
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   729 --------------------------------EEGSHTDLV-SRGGVYAEMVRLQNLG--KLSLDDRVISGDMISALNAT 773
Cdd:PTZ00265  674 nkennnknnkddnnnnnnnnnnkinnagsyiiEQGTHDALMkNKNGIYYTMINNQKVSskKSSNNDNDKDSDMKSSAYKD 753
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   774 PETRQLLDEKQAF-VDGNRS---DITEDTVVADTPSDSRDGSEEEARKKRKRTRSAGFVTRYTFALIRPNLHWVLLgLAM 849
Cdd:PTZ00265  754 SERGYDPDEMNGNsKHENESasnKKSCKMSDENASENNAGGKLPFLRNLFKRKPKAPNNLRIVYREIFSYKKDVTI-IAL 832
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   850 SVII-GGSYSAEAIVFGHTVGSLSPCRSAEAISRDGNLYGLL-----FFILALVEFGANVVGgcafgwaaDKVLYRIRVL 923
Cdd:PTZ00265  833 SILVaGGLYPVFALLYAKYVSTLFDFANLEANSNKYSLYILViaiamFISETLKNYYNNVIG--------EKVEKTMKRR 904
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   924 SLRSLLGQTVKWHESEDRTPGTLLTYITGDASALGgiTGTTIGLLLAT--AVNLIGGLVISFS----IAWKITIVLFPTI 997
Cdd:PTZ00265  905 LFENILYQEISFFDQDKHAPGLLSAHINRDVHLLK--TGLVNNIVIFThfIVLFLVSMVMSFYfcpiVAAVLTGTYFIFM 982
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   998 PVLLVSGMMKLR--VQKQLAERHQKAFAKATAVTI---------EAVDNIRAVSAFSLEKQSYQVYGRALRGPYRATIKA 1066
Cdd:PTZ00265  983 RVFAIRARLTANkdVEKKEINQPGTVFAYNSDDEIfkdpsfliqEAFYNMNTVIIYGLEDYFCNLIEKAIDYSNKGQKRK 1062
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1067 TFHGNAWLALAFSISNLVYALAYWWGSKQIAEGRYSQTQFFIVMPALLFSTQSCGQMFALAPDISKAGVASSNIVELLTT 1146
Cdd:PTZ00265 1063 TLVNSMLWGFSQSAQLFINSFAYWFGSFLIRRGTILVDDFMKSLFTFLFTGSYAGKLMSLKGDSENAKLSFEKYYPLIIR 1142
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1147 RSAEDEVTPGSSHSFQPssslleektavQDIEAQeyarstrqraaerggmgAQLRDVHFTYPHRPERPVLKGLNIDIKPG 1226
Cdd:PTZ00265 1143 KSNIDVRDNGGIRIKNK-----------NDIKGK-----------------IEIMDVNFRYISRPNVPIYKDLTFSCDSK 1194
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1227 QFCALVGPSGSGKSTTFAMLERFYR------------------------------------------------------P 1252
Cdd:PTZ00265 1195 KTTAIVGETGSGKSTVMSLLMRFYDlkndhhivfknehtndmtneqdyqgdeeqnvgmknvnefsltkeggsgedstvfK 1274
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1253 NAGAVVIDGVDVTRQVGTEFRDDIALVPQQNILFEGTVAFNVALGAcpgHEPTQEEIEEACRMANIHDVIMTLPQGYQTM 1332
Cdd:PTZ00265 1275 NSGKILLDGVDICDYNLKDLRNLFSIVSQEPMLFNMSIYENIKFGK---EDATREDVKRACKFAAIDEFIESLPNKYDTN 1351
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1333 CSHDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVESEKRIQEALATLAGRT--TVVAIAHRLNTIHRADQIFLI 1410
Cdd:PTZ00265 1352 VGPYGKSLSGGQKQRIAIARALLREPKILLLDEATSSLDSNSEKLIEKTIVDIKDKAdkTIITIAHRIASIKRSDKIVVF 1431
                        1450      1460
                  ....*....|....*....|
gi 20530737  1411 ED----GRCIE-QGTHQQLI 1425
Cdd:PTZ00265 1432 NNpdrtGSFVQaHGTHEELL 1451
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
120-753 7.15e-112

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 364.83  E-value: 7.15e-112
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  120 RLLFSLDYTIAdVLLIIGGLLFAICAGIPFPLLGIVFGDLINDLNTVTcsssdratadlssavrAKVLYVIYITIANFWF 199
Cdd:COG1132    6 RLLKYLKYKLL-LLAILLLLLSALLSLLLPLLIGRIIDALLADLGELL----------------ELLLLLLLLALLGGVL 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  200 IYAHSTCWCLVSERLARRYRRRYFESIIKQEAKFIESLPSGDVVSRLVSDIELVQSGTSEKVGLVISTLSYFVAAYVVAF 279
Cdd:COG1132   69 RALQSYLGSRLGQKIVADLRRDLFEKLLRLPLSFFDKAKSGDLISRLTNDVEAVSNLVSTVLVLVFTSILLLIGSLVLLF 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  280 IKVPKIAGMLVSVVPCFFLMALGGGHYIKKFAGRLAEKVNAATSIASSSLSHLTLVHAFNANDRLEKRFAGYLLQSRKDA 359
Cdd:COG1132  149 SLSWRLALILLLILPLLALVLSLLARKSRKLSRRVREALGELNARLLESLSGIRVIKAFGAEDRELKRFEEANEELRRAN 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  360 VRKATTHAAQLGCLYFIAYSANALAFWEGSQMISksvadgNSGTSVGAVYTVIFVLIDASFILSQVAPFIHVFASAAGAS 439
Cdd:COG1132  229 LRASRLEALLAPLMLLLSSLGTVLVLALGGFLVL------SGSLTVGALAAFILYLLRLLTPILQLGEVVSLLQRASAAA 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  440 ERLLQVINRPSAIDGtsdsGDKTAAFGEEDIRFRDVHFKYPsrPDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLE 519
Cdd:COG1132  303 ERLFELLDEEPEVED----PPDPLKDTIGSIEFENVSFSYP--GKKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLLL 376
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  520 RFYDPDSGDVLIGDKNFRDINVRYLRGNIGYVQQEPSLLDRTILENIAYGlvssamerhqrlapfildsslpdlaekiRE 599
Cdd:COG1132  377 RLYDPTSGEILIDGIDIRDISLDSLRKRIGIVSQDPLLFSGTIRENIALG----------------------------RP 428
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  600 GLTEKEalreydscvteivdlVKEAAANANALGFIEALPYGFATNVGTAGNQLSGGQKQRIALARALVREPCLLILDEAT 679
Cdd:COG1132  429 DATDEE---------------IEEALKLANAHEFIANLPDGYDTIVGERGVNLSGGQRQRLAIARALLRNPPILILDEAT 493
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 20530737  680 AALDSTSEQLIQAALNRVSERVTTVSIAHRLATAKNAHKIVVVQSGRVTEEGSHTDLVSRGGVYAEMVRLQNLG 753
Cdd:COG1132  494 SALDTETEALIQDALKKLLKGRTTLIIAHRLSTIKNADRIIVLDNGRIVERGTHEELLAKGGLYARLYQAQGGA 567
ABC_MTABC3_MDL1_MDL2 cd03249
ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; MTABC3 ...
470-750 2.21e-109

ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.


Pssm-ID: 213216 [Multi-domain]  Cd Length: 238  Bit Score: 345.29  E-value: 2.21e-109
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  470 IRFRDVHFKYPSRPDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDPDSGDVLIGDKNFRDINVRYLRGNIG 549
Cdd:cd03249    1 IEFKNVSFRYPSRPDVPILKGLSLTIPPGKTVALVGSSGCGKSTVVSLLERFYDPTSGEILLDGVDIRDLNLRWLRSQIG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  550 YVQQEPSLLDRTILENIAYGlvssamerhqrlapfildsslpdlaekiREGLTEKEalreydscvteivdlVKEAAANAN 629
Cdd:cd03249   81 LVSQEPVLFDGTIAENIRYG----------------------------KPDATDEE---------------VEEAAKKAN 117
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  630 ALGFIEALPYGFATNVGTAGNQLSGGQKQRIALARALVREPCLLILDEATAALDSTSEQLIQAALNRVSERVTTVSIAHR 709
Cdd:cd03249  118 IHDFIMSLPDGYDTLVGERGSQLSGGQKQRIAIARALLRNPKILLLDEATSALDAESEKLVQEALDRAMKGRTTIVIAHR 197
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 20530737  710 LATAKNAHKIVVVQSGRVTEEGSHTDLVSRGGVYAEMVRLQ 750
Cdd:cd03249  198 LSTIRNADLIAVLQNGQVVEQGTHDELMAQKGVYAKLVKAQ 238
ABC_MTABC3_MDL1_MDL2 cd03249
ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; MTABC3 ...
1200-1438 5.78e-106

ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.


Pssm-ID: 213216 [Multi-domain]  Cd Length: 238  Bit Score: 335.66  E-value: 5.78e-106
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1200 LRDVHFTYPHRPERPVLKGLNIDIKPGQFCALVGPSGSGKSTTFAMLERFYRPNAGAVVIDGVDVTRQVGTEFRDDIALV 1279
Cdd:cd03249    3 FKNVSFRYPSRPDVPILKGLSLTIPPGKTVALVGSSGCGKSTVVSLLERFYDPTSGEILLDGVDIRDLNLRWLRSQIGLV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1280 PQQNILFEGTVAFNVALGAcpgHEPTQEEIEEACRMANIHDVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKPR 1359
Cdd:cd03249   83 SQEPVLFDGTIAENIRYGK---PDATDEEVEEAAKKANIHDFIMSLPDGYDTLVGERGSQLSGGQKQRIAIARALLRNPK 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1360 LLLLDESTSALDVESEKRIQEALATLA-GRTTVVaIAHRLNTIHRADQIFLIEDGRCIEQGTHQQLIQRSETYRTSVIHQ 1438
Cdd:cd03249  160 ILLLDEATSALDAESEKLVQEALDRAMkGRTTIV-IAHRLSTIRNADLIAVLQNGQVVEQGTHDELMAQKGVYAKLVKAQ 238
MsbA_rel TIGR02204
ABC transporter, permease/ATP-binding protein; This protein is related to a Proteobacterial ...
209-750 1.84e-96

ABC transporter, permease/ATP-binding protein; This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.


Pssm-ID: 131259 [Multi-domain]  Cd Length: 576  Bit Score: 322.42  E-value: 1.84e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    209 LVSERLARRYRRRYFESIIKQEAKFIESLPSGDVVSRLVSDIELVQSGTSEKVGLVISTLSYFVAAYVVAFIKVPKIAGM 288
Cdd:TIGR02204   84 WLGERVVADIRRAVFAHLISLSPSFFDKNRSGEVVSRLTTDTTLLQSVIGSSLSMALRNALMCIGGLIMMFITSPKLTSL 163
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    289 LVSVVPCFFLMALGGGHYIKKFAGRLAEKVNAATSIASSSLSHLTLVHAFNANDRLEKRFAGYLLQSRKDAVRKATTHAA 368
Cdd:TIGR02204  164 VLLAVPLVLLPILLFGRRVRKLSRESQDRIADAGSYAGETLGAIRTVQAFGHEDAERSRFGGAVEKAYEAARQRIRTRAL 243
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    369 QLGCLYFIAYSANALAFWEGSQMIsksVADGNSGTSVGAVytVIFVLIDASFIlSQVAPFIHVFASAAGASERLLQVINR 448
Cdd:TIGR02204  244 LTAIVIVLVFGAIVGVLWVGAHDV---IAGKMSAGTLGQF--VFYAVMVAGSI-GTLSEVWGELQRAAGAAERLIELLQA 317
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    449 PSAIDGTSdSGDKTAAFGEEDIRFRDVHFKYPSRPDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDPDSGD 528
Cdd:TIGR02204  318 EPDIKAPA-HPKTLPVPLRGEIEFEQVNFAYPARPDQPALDGLNLTVRPGETVALVGPSGAGKSTLFQLLLRFYDPQSGR 396
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    529 VLIGDKNFRDINVRYLRGNIGYVQQEPSLLDRTILENIAYGlvssamerhqrlapfildsslpdlaekiREGLTEKEalr 608
Cdd:TIGR02204  397 ILLDGVDLRQLDPAELRARMALVPQDPVLFAASVMENIRYG----------------------------RPDATDEE--- 445
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    609 eydscvteivdlVKEAAANANALGFIEALPYGFATNVGTAGNQLSGGQKQRIALARALVREPCLLILDEATAALDSTSEQ 688
Cdd:TIGR02204  446 ------------VEAAARAAHAHEFISALPEGYDTYLGERGVTLSGGQRQRIAIARAILKDAPILLLDEATSALDAESEQ 513
                          490       500       510       520       530       540
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 20530737    689 LIQAALNRVSERVTTVSIAHRLATAKNAHKIVVVQSGRVTEEGSHTDLVSRGGVYAEMVRLQ 750
Cdd:TIGR02204  514 LVQQALETLMKGRTTLIIAHRLATVLKADRIVVMDQGRIVAQGTHAELIAKGGLYARLARLQ 575
MsbA_rel TIGR02204
ABC transporter, permease/ATP-binding protein; This protein is related to a Proteobacterial ...
827-1432 1.16e-92

ABC transporter, permease/ATP-binding protein; This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.


Pssm-ID: 131259 [Multi-domain]  Cd Length: 576  Bit Score: 311.63  E-value: 1.16e-92
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    827 FVTRY-------TFALIRPNLHWVLLGLAMSVIIGGSYSAEaivfghtvgslspcrSAEAIsrdgNLYGLLFFILALVEF 899
Cdd:TIGR02204   12 FVRPYrgrvlaaLVALLITAAATLSLPYAVRLMIDHGFSKD---------------SSGLL----NRYFAFLLVVALVLA 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    900 GANVVGGCAFGWAADKVLYRIRvlslRSLLGQTVKWHES--EDRTPGTLLTYITGDASALGGITGTTIGLLLATAVNLIG 977
Cdd:TIGR02204   73 LGTAARFYLVTWLGERVVADIR----RAVFAHLISLSPSffDKNRSGEVVSRLTTDTTLLQSVIGSSLSMALRNALMCIG 148
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    978 GLVISFSIAWKITIVLFPTIPVLLVSGMMKLRVQKQLAERHQKAFAKATAVTIEAVDNIRAVSAFSLEKQSYQVYGRALR 1057
Cdd:TIGR02204  149 GLIMMFITSPKLTSLVLLAVPLVLLPILLFGRRVRKLSRESQDRIADAGSYAGETLGAIRTVQAFGHEDAERSRFGGAVE 228
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1058 GPYRATIKATfHGNAWLaLAFSISnLVYA---LAYWWGSKQIAEGRYSQTQFFIVMPALLFSTQSCGQMFALAPDISKAG 1134
Cdd:TIGR02204  229 KAYEAARQRI-RTRALL-TAIVIV-LVFGaivGVLWVGAHDVIAGKMSAGTLGQFVFYAVMVAGSIGTLSEVWGELQRAA 305
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1135 VASSNIVELLTTRSaedevtpgsshsfqpssslleektavqDIEAQEYARSTRQRAaeRGGMgaQLRDVHFTYPHRPERP 1214
Cdd:TIGR02204  306 GAAERLIELLQAEP---------------------------DIKAPAHPKTLPVPL--RGEI--EFEQVNFAYPARPDQP 354
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1215 VLKGLNIDIKPGQFCALVGPSGSGKSTTFAMLERFYRPNAGAVVIDGVDVTRQVGTEFRDDIALVPQQNILFEGTVAFNV 1294
Cdd:TIGR02204  355 ALDGLNLTVRPGETVALVGPSGAGKSTLFQLLLRFYDPQSGRILLDGVDLRQLDPAELRARMALVPQDPVLFAASVMENI 434
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1295 ALGACpghEPTQEEIEEACRMANIHDVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVES 1374
Cdd:TIGR02204  435 RYGRP---DATDEEVEAAARAAHAHEFISALPEGYDTYLGERGVTLSGGQRQRIAIARAILKDAPILLLDEATSALDAES 511
                          570       580       590       600       610
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 20530737   1375 EKRIQEALATL-AGRTTVVaIAHRLNTIHRADQIFLIEDGRCIEQGTHQQLIQRSETYR 1432
Cdd:TIGR02204  512 EQLVQQALETLmKGRTTLI-IAHRLATVLKADRIVVMDQGRIVAQGTHAELIAKGGLYA 569
PRK11176 PRK11176
lipid transporter ATP-binding/permease protein; Provisional
1173-1431 3.53e-67

lipid transporter ATP-binding/permease protein; Provisional


Pssm-ID: 183016 [Multi-domain]  Cd Length: 582  Bit Score: 238.38  E-value: 3.53e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1173 AVQDIEaQEyaRSTRQRAAERGGMGAQLRDVHFTYPHRpERPVLKGLNIDIKPGQFCALVGPSGSGKSTTFAMLERFYRP 1252
Cdd:PRK11176  320 AILDLE-QE--KDEGKRVIERAKGDIEFRNVTFTYPGK-EVPALRNINFKIPAGKTVALVGRSGSGKSTIANLLTRFYDI 395
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1253 NAGAVVIDGVDVTRQVGTEFRDDIALVPQQNILFEGTVAFNVALGAcpGHEPTQEEIEEACRMANIHDVIMTLPQGYQTM 1332
Cdd:PRK11176  396 DEGEILLDGHDLRDYTLASLRNQVALVSQNVHLFNDTIANNIAYAR--TEQYSREQIEEAARMAYAMDFINKMDNGLDTV 473
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1333 CSHDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVESEKRIQEALATLAGRTTVVAIAHRLNTIHRADQIFLIED 1412
Cdd:PRK11176  474 IGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEKADEILVVED 553
                         250
                  ....*....|....*....
gi 20530737  1413 GRCIEQGTHQQLIQRSETY 1431
Cdd:PRK11176  554 GEIVERGTHAELLAQNGVY 572
ABC_membrane pfam00664
ABC transporter transmembrane region; This family represents a unit of six transmembrane ...
847-1117 6.90e-37

ABC transporter transmembrane region; This family represents a unit of six transmembrane helices. Many members of the ABC transporter family (pfam00005) have two such regions.


Pssm-ID: 307007 [Multi-domain]  Cd Length: 270  Bit Score: 140.47  E-value: 6.90e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    847 LAMSVIIGGSYSAEAIVFGHTVGSLSPCRSAEaiSRDGNLYGLLFFILALVEFGANVVGGCAFGWAADKVLYRIRVLSLR 926
Cdd:pfam00664    1 ILLAILSGAISPAFPLVLGRILDVLLPDGDPD--TSALNLYSLALLLLGLAQFILSLLQSYLLNVTGERLSRRLRRKLFK 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    927 SLLGQTVKWHEseDRTPGTLLTYITGDASALGGITGTTIGLLLATAVNLIGGLVISFSIAWKITIVLFPTIPVLLVSGMM 1006
Cdd:pfam00664   79 KILRQPMSFFD--TNSTGELLSRLTNDTSKIRDGLGEKLGLLFQSLATIVGGIIVMFYYGWKLTLVLLAVLPLYILVSAV 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1007 KLRVQKQLAERHQKAFAKATAVTIEAVDNIRAVSAFSLEKQSYQVYGRALRGPYRATIKATFHGNAWLALAFSISNLVYA 1086
Cdd:pfam00664  157 FAKILRKLSRKEQKAVAKASSVAEESLSGIRTVKAFGREEYELERFDKALEEARKAGIKKAVANGLSFGITQLIGYLSYA 236
                          250       260       270
                   ....*....|....*....|....*....|...
gi 20530737   1087 LAYWWGSKQIAEGRYS--QTQFFIVMPALLFST 1117
Cdd:pfam00664  237 LALWFGAYLVISGELSvgDLVAFLSLFAILFGP 269
ABC_tran pfam00005
ABC transporter; ABC transporters for a large family of proteins responsible for translocation ...
488-680 1.14e-35

ABC transporter; ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide as in CFTR, or belong in different polypeptide chains.


Pssm-ID: 333758 [Multi-domain]  Cd Length: 150  Bit Score: 132.77  E-value: 1.14e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    488 LQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDPDSGDVLIGDKNFRDINVRYLRGNIGYVQQEPSLLDR-TILENI 566
Cdd:pfam00005    1 LKNVSLTLNPGEIVALVGPNGAGKSTLLKLISGLLSPTEGTILLDGQDLTDDERKSLRKEIGYVFQDPQLFPRlTVRENL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    567 AYGLVSSAMERHQRLApfildsslpdlaekiregltekealreydscvteivdlvkEAAANANALGFIEALpygfATNVG 646
Cdd:pfam00005   81 RLGLRLKGLSKAEKDA----------------------------------------RAEEALEKLGLGDLL----DRPVG 116
                          170       180       190
                   ....*....|....*....|....*....|....
gi 20530737    647 TAGNQLSGGQKQRIALARALVREPCLLILDEATA 680
Cdd:pfam00005  117 ENPGTLSGGQRQRVAIARALLTKPKLLLLDEPTA 150
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
1225-1414 5.60e-11

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 62.01  E-value: 5.60e-11
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    1225 PGQFCALVGPSGSGKSTTFAMLERFYRPNAGAVVIDGVDVTRQVGTEFRDDIALVPqqnilfegtvafnvalgacpghep 1304
Cdd:smart00382    1 PGEVILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQLLLIIVGG------------------------ 56
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    1305 tqeeieeacrmanihdvimtlpqgyqtmcshDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVESEKRIQEALAT 1384
Cdd:smart00382   57 -------------------------------KKASGSGELRLRLALALARKLKPDVLILDEITSLLDAEQEALLLLLEEL 105
                           170       180       190       200
                    ....*....|....*....|....*....|....*....|...
gi 20530737    1385 LA-------GRTTVVAIAHR------LNTIHRADQIFLIEDGR 1414
Cdd:smart00382  106 RLllllkseKNLTVILTTNDekdlgpALLRRRFDRRIVLLLIL 148
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
645-694 3.80e-05

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 45.06  E-value: 3.80e-05
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|
gi 20530737     645 VGTAGNQLSGGQKQRIALARALVREPCLLILDEATAALDSTSEQLIQAAL 694
Cdd:smart00382   54 VGGKKASGSGELRLRLALALARKLKPDVLILDEITSLLDAEQEALLLLLE 103
 
Name Accession Description Interval E-value
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
842-1432 6.18e-115

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 373.30  E-value: 6.18e-115
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  842 WVLLGLAMSVIIGGSYSAEAIVFGHTVGSLSPcrSAEAISRDGNLYGLLFFILALVEFGANVVGGcafgWAADKVLYRIR 921
Cdd:COG1132   15 LLLLAILLLLLSALLSLLLPLLIGRIIDALLA--DLGELLELLLLLLLLALLGGVLRALQSYLGS----RLGQKIVADLR 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  922 VLSLRSLLGQTVKWHEseDRTPGTLLTYITGDASALGGITGTTIGLLLATAVNLIGGLVISFSIAWKITIVLFPTIPVL- 1000
Cdd:COG1132   89 RDLFEKLLRLPLSFFD--KAKSGDLISRLTNDVEAVSNLVSTVLVLVFTSILLLIGSLVLLFSLSWRLALILLLILPLLa 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1001 LVSGMMKLRVQKqLAERHQKAFAKATAVTIEAVDNIRAVSAFSLEKQSYQVYGRALRGPYRATIKATFHGNAWLALAFSI 1080
Cdd:COG1132  167 LVLSLLARKSRK-LSRRVREALGELNARLLESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRASRLEALLAPLMLLL 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1081 SNLVYALAYWWGSKQIAEGRYSQTQFFIVMPALLFSTQSCGQMFALAPDISKAGVASSNIVELLTTRSaedevtpgsshs 1160
Cdd:COG1132  246 SSLGTVLVLALGGFLVLSGSLTVGALAAFILYLLRLLTPILQLGEVVSLLQRASAAAERLFELLDEEP------------ 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1161 fqpssslleektavqDIEAQEYARSTRQRAAErggmgaqLRDVHFTYPhrPERPVLKGLNIDIKPGQFCALVGPSGSGKS 1240
Cdd:COG1132  314 ---------------EVEDPPDPLKDTIGSIE-------FENVSFSYP--GKKPVLKDISFSIEPGEKVAIVGPSGSGKS 369
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1241 TTFAMLERFYRPNAGAVVIDGVDVtRQVGTEF-RDDIALVPQQNILFEGTVAFNVALGaCPGHepTQEEIEEACRMANIH 1319
Cdd:COG1132  370 TLIKLLLRLYDPTSGEILIDGIDI-RDISLDSlRKRIGIVSQDPLLFSGTIRENIALG-RPDA--TDEEIEEALKLANAH 445
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1320 DVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVESEKRIQEALATLAGRTTVVAIAHRLN 1399
Cdd:COG1132  446 EFIANLPDGYDTIVGERGVNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIAHRLS 525
                        570       580       590
                 ....*....|....*....|....*....|...
gi 20530737 1400 TIHRADQIFLIEDGRCIEQGTHQQLIQRSETYR 1432
Cdd:COG1132  526 TIKNADRIIVLDNGRIVERGTHEELLAKGGLYA 558
PTZ00265 PTZ00265
multidrug resistance protein (mdr1); Provisional
142-1425 1.49e-114

multidrug resistance protein (mdr1); Provisional


Pssm-ID: 240339 [Multi-domain]  Cd Length: 1466  Bit Score: 394.78  E-value: 1.49e-114
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   142 AICAGIPFPLLGIVFGDLINDLNtvtcsssdratadLSSAVRAKVLYVIYITIANFWFIYAHSTCWCLVSERLARRYRRR 221
Cdd:PTZ00265   69 ATISGGTLPFFVSVFGVIMKNMN-------------LGENVNDIIFSLVLIGIFQFILSFISSFCMDVVTTKILKTLKLE 135
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   222 YFESIIKQEAKFIESLPSGDVVSRLVSDIELVQSGTSEKVGLVISTLSYFVAAYVVAFIKVPKIAGMLVSVVPCFFLMAL 301
Cdd:PTZ00265  136 FLKSVFYQDGQFHDNNPGSKLTSDLDFYLEQVNAGIGTKFITIFTYASAFLGLYIWSLFKNARLTLCITCVFPLIYICGV 215
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   302 ggghyIKKFAGRLAEKV-----NAATSIASSSLSHL----------TLVHAFNANdrlEKRFAGYLLQsrkdAVRKATTH 366
Cdd:PTZ00265  216 -----ICNKKVKINKKTsllynNNTMSIIEEALVGIrtvvsycgekTILKKFNLS---EKLYSKYILK----ANFMESLH 283
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   367 AAQLGCLYFIAYsanALAFWEGSQMISKSVADG--NSGTSVGAVYTVIFVLIDASFILSQVAPFIHVFASAAGASERLLQ 444
Cdd:PTZ00265  284 IGMINGFILASY---AFGFWYGTRIIISDLSNQqpNNDFHGGSVISILLGVLISMFMLTIILPNITEYMKSLEATNSLYE 360
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   445 VINRPSAIDGTSDsGDKTAAFgeEDIRFRDVHFKYPSRPDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDP 524
Cdd:PTZ00265  361 IINRKPLVENNDD-GKKLKDI--KKIQFKNVRFHYDTRKDVEIYKDLNFTLTEGKTYAFVGESGCGKSTILKLIERLYDP 437
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   525 DSGDVLIGDK-NFRDINVRYLRGNIGYVQQEPSLLDRTILENIAYGLVS----SAMERHQRLAPFILDSSL--------- 590
Cdd:PTZ00265  438 TEGDIIINDShNLKDINLKWWRSKIGVVSQDPLLFSNSIKNNIKYSLYSlkdlEALSNYYNEDGNDSQENKnkrnscrak 517
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   591 --PDLAEKIREGLTEK--EALREYDSCV-TEIVDLVKEAAANanalGFIEALPYGFATNVGTAGNQLSGGQKQRIALARA 665
Cdd:PTZ00265  518 caGDLNDMSNTTDSNEliEMRKNYQTIKdSEVVDVSKKVLIH----DFVSALPDKYETLVGSNASKLSGGQKQRISIARA 593
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   666 LVREPCLLILDEATAALDSTSEQLIQAALNRV--SERVTTVSIAHRLATAKNAHKIVVV----QSGRVT----------- 728
Cdd:PTZ00265  594 IIRNPKILILDEATSSLDNKSEYLVQKTINNLkgNENRITIIIAHRLSTIRYANTIFVLsnreRGSTVDvdiigedptkd 673
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   729 --------------------------------EEGSHTDLV-SRGGVYAEMVRLQNLG--KLSLDDRVISGDMISALNAT 773
Cdd:PTZ00265  674 nkennnknnkddnnnnnnnnnnkinnagsyiiEQGTHDALMkNKNGIYYTMINNQKVSskKSSNNDNDKDSDMKSSAYKD 753
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   774 PETRQLLDEKQAF-VDGNRS---DITEDTVVADTPSDSRDGSEEEARKKRKRTRSAGFVTRYTFALIRPNLHWVLLgLAM 849
Cdd:PTZ00265  754 SERGYDPDEMNGNsKHENESasnKKSCKMSDENASENNAGGKLPFLRNLFKRKPKAPNNLRIVYREIFSYKKDVTI-IAL 832
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   850 SVII-GGSYSAEAIVFGHTVGSLSPCRSAEAISRDGNLYGLL-----FFILALVEFGANVVGgcafgwaaDKVLYRIRVL 923
Cdd:PTZ00265  833 SILVaGGLYPVFALLYAKYVSTLFDFANLEANSNKYSLYILViaiamFISETLKNYYNNVIG--------EKVEKTMKRR 904
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   924 SLRSLLGQTVKWHESEDRTPGTLLTYITGDASALGgiTGTTIGLLLAT--AVNLIGGLVISFS----IAWKITIVLFPTI 997
Cdd:PTZ00265  905 LFENILYQEISFFDQDKHAPGLLSAHINRDVHLLK--TGLVNNIVIFThfIVLFLVSMVMSFYfcpiVAAVLTGTYFIFM 982
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   998 PVLLVSGMMKLR--VQKQLAERHQKAFAKATAVTI---------EAVDNIRAVSAFSLEKQSYQVYGRALRGPYRATIKA 1066
Cdd:PTZ00265  983 RVFAIRARLTANkdVEKKEINQPGTVFAYNSDDEIfkdpsfliqEAFYNMNTVIIYGLEDYFCNLIEKAIDYSNKGQKRK 1062
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1067 TFHGNAWLALAFSISNLVYALAYWWGSKQIAEGRYSQTQFFIVMPALLFSTQSCGQMFALAPDISKAGVASSNIVELLTT 1146
Cdd:PTZ00265 1063 TLVNSMLWGFSQSAQLFINSFAYWFGSFLIRRGTILVDDFMKSLFTFLFTGSYAGKLMSLKGDSENAKLSFEKYYPLIIR 1142
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1147 RSAEDEVTPGSSHSFQPssslleektavQDIEAQeyarstrqraaerggmgAQLRDVHFTYPHRPERPVLKGLNIDIKPG 1226
Cdd:PTZ00265 1143 KSNIDVRDNGGIRIKNK-----------NDIKGK-----------------IEIMDVNFRYISRPNVPIYKDLTFSCDSK 1194
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1227 QFCALVGPSGSGKSTTFAMLERFYR------------------------------------------------------P 1252
Cdd:PTZ00265 1195 KTTAIVGETGSGKSTVMSLLMRFYDlkndhhivfknehtndmtneqdyqgdeeqnvgmknvnefsltkeggsgedstvfK 1274
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1253 NAGAVVIDGVDVTRQVGTEFRDDIALVPQQNILFEGTVAFNVALGAcpgHEPTQEEIEEACRMANIHDVIMTLPQGYQTM 1332
Cdd:PTZ00265 1275 NSGKILLDGVDICDYNLKDLRNLFSIVSQEPMLFNMSIYENIKFGK---EDATREDVKRACKFAAIDEFIESLPNKYDTN 1351
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  1333 CSHDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVESEKRIQEALATLAGRT--TVVAIAHRLNTIHRADQIFLI 1410
Cdd:PTZ00265 1352 VGPYGKSLSGGQKQRIAIARALLREPKILLLDEATSSLDSNSEKLIEKTIVDIKDKAdkTIITIAHRIASIKRSDKIVVF 1431
                        1450      1460
                  ....*....|....*....|
gi 20530737  1411 ED----GRCIE-QGTHQQLI 1425
Cdd:PTZ00265 1432 NNpdrtGSFVQaHGTHEELL 1451
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
120-753 7.15e-112

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 364.83  E-value: 7.15e-112
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  120 RLLFSLDYTIAdVLLIIGGLLFAICAGIPFPLLGIVFGDLINDLNTVTcsssdratadlssavrAKVLYVIYITIANFWF 199
Cdd:COG1132    6 RLLKYLKYKLL-LLAILLLLLSALLSLLLPLLIGRIIDALLADLGELL----------------ELLLLLLLLALLGGVL 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  200 IYAHSTCWCLVSERLARRYRRRYFESIIKQEAKFIESLPSGDVVSRLVSDIELVQSGTSEKVGLVISTLSYFVAAYVVAF 279
Cdd:COG1132   69 RALQSYLGSRLGQKIVADLRRDLFEKLLRLPLSFFDKAKSGDLISRLTNDVEAVSNLVSTVLVLVFTSILLLIGSLVLLF 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  280 IKVPKIAGMLVSVVPCFFLMALGGGHYIKKFAGRLAEKVNAATSIASSSLSHLTLVHAFNANDRLEKRFAGYLLQSRKDA 359
Cdd:COG1132  149 SLSWRLALILLLILPLLALVLSLLARKSRKLSRRVREALGELNARLLESLSGIRVIKAFGAEDRELKRFEEANEELRRAN 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  360 VRKATTHAAQLGCLYFIAYSANALAFWEGSQMISksvadgNSGTSVGAVYTVIFVLIDASFILSQVAPFIHVFASAAGAS 439
Cdd:COG1132  229 LRASRLEALLAPLMLLLSSLGTVLVLALGGFLVL------SGSLTVGALAAFILYLLRLLTPILQLGEVVSLLQRASAAA 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  440 ERLLQVINRPSAIDGtsdsGDKTAAFGEEDIRFRDVHFKYPsrPDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLE 519
Cdd:COG1132  303 ERLFELLDEEPEVED----PPDPLKDTIGSIEFENVSFSYP--GKKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLLL 376
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  520 RFYDPDSGDVLIGDKNFRDINVRYLRGNIGYVQQEPSLLDRTILENIAYGlvssamerhqrlapfildsslpdlaekiRE 599
Cdd:COG1132  377 RLYDPTSGEILIDGIDIRDISLDSLRKRIGIVSQDPLLFSGTIRENIALG----------------------------RP 428
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  600 GLTEKEalreydscvteivdlVKEAAANANALGFIEALPYGFATNVGTAGNQLSGGQKQRIALARALVREPCLLILDEAT 679
Cdd:COG1132  429 DATDEE---------------IEEALKLANAHEFIANLPDGYDTIVGERGVNLSGGQRQRLAIARALLRNPPILILDEAT 493
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 20530737  680 AALDSTSEQLIQAALNRVSERVTTVSIAHRLATAKNAHKIVVVQSGRVTEEGSHTDLVSRGGVYAEMVRLQNLG 753
Cdd:COG1132  494 SALDTETEALIQDALKKLLKGRTTLIIAHRLSTIKNADRIIVLDNGRIVERGTHEELLAKGGLYARLYQAQGGA 567
ABC_MTABC3_MDL1_MDL2 cd03249
ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; MTABC3 ...
470-750 2.21e-109

ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.


Pssm-ID: 213216 [Multi-domain]  Cd Length: 238  Bit Score: 345.29  E-value: 2.21e-109
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  470 IRFRDVHFKYPSRPDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDPDSGDVLIGDKNFRDINVRYLRGNIG 549
Cdd:cd03249    1 IEFKNVSFRYPSRPDVPILKGLSLTIPPGKTVALVGSSGCGKSTVVSLLERFYDPTSGEILLDGVDIRDLNLRWLRSQIG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  550 YVQQEPSLLDRTILENIAYGlvssamerhqrlapfildsslpdlaekiREGLTEKEalreydscvteivdlVKEAAANAN 629
Cdd:cd03249   81 LVSQEPVLFDGTIAENIRYG----------------------------KPDATDEE---------------VEEAAKKAN 117
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  630 ALGFIEALPYGFATNVGTAGNQLSGGQKQRIALARALVREPCLLILDEATAALDSTSEQLIQAALNRVSERVTTVSIAHR 709
Cdd:cd03249  118 IHDFIMSLPDGYDTLVGERGSQLSGGQKQRIAIARALLRNPKILLLDEATSALDAESEKLVQEALDRAMKGRTTIVIAHR 197
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 20530737  710 LATAKNAHKIVVVQSGRVTEEGSHTDLVSRGGVYAEMVRLQ 750
Cdd:cd03249  198 LSTIRNADLIAVLQNGQVVEQGTHDELMAQKGVYAKLVKAQ 238
ABC_MTABC3_MDL1_MDL2 cd03249
ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; MTABC3 ...
1200-1438 5.78e-106

ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.


Pssm-ID: 213216 [Multi-domain]  Cd Length: 238  Bit Score: 335.66  E-value: 5.78e-106
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1200 LRDVHFTYPHRPERPVLKGLNIDIKPGQFCALVGPSGSGKSTTFAMLERFYRPNAGAVVIDGVDVTRQVGTEFRDDIALV 1279
Cdd:cd03249    3 FKNVSFRYPSRPDVPILKGLSLTIPPGKTVALVGSSGCGKSTVVSLLERFYDPTSGEILLDGVDIRDLNLRWLRSQIGLV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1280 PQQNILFEGTVAFNVALGAcpgHEPTQEEIEEACRMANIHDVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKPR 1359
Cdd:cd03249   83 SQEPVLFDGTIAENIRYGK---PDATDEEVEEAAKKANIHDFIMSLPDGYDTLVGERGSQLSGGQKQRIAIARALLRNPK 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1360 LLLLDESTSALDVESEKRIQEALATLA-GRTTVVaIAHRLNTIHRADQIFLIEDGRCIEQGTHQQLIQRSETYRTSVIHQ 1438
Cdd:cd03249  160 ILLLDEATSALDAESEKLVQEALDRAMkGRTTIV-IAHRLSTIRNADLIAVLQNGQVVEQGTHDELMAQKGVYAKLVKAQ 238
ABC_6TM_Pgp_ABCB1_D2_like cd18578
Six-transmembrane helical domain 2 (TMD2) of P-glycoprotein 1 (Pgp) and related proteins; ...
833-1149 1.84e-99

Six-transmembrane helical domain 2 (TMD2) of P-glycoprotein 1 (Pgp) and related proteins; P-glycoprotein 1 (permeability glycoprotein, Pgp) also known as multidrug resistance protein 1 (MDR1) or ATP-binding cassette sub-family B member 1 (ABCB1) is a member of the superfamily of ATP-binding cassette (ABC) transporters. Pgp acts as an ATP-dependent efflux pump, binds drugs with diverse chemical structures and pump them out of the drug resistant cancer cells. It is responsible for decreased drug accumulation in multidrug-resistant cells and mediates the development of resistance to anticancer drugs. Pgp consists of two alpha-helical transmembrane domains (TMDs) and two cytoplasmic nucleotide-binding domains (NBDs). This protein also functions as a transporter in the blood-brain barrier. In addition to Pgp, breast cancer resistance protein (BCRP/MXR/ABC-P/ABCG2) and multidrug resistance-associated proteins (MRP1/ABCC1 and MRP2/ABCC2) function as drug efflux pumps of anticancer drugs, and overexpression of these transporters induces multidrug resistance to a broad spectrum of anticancer drugs including doxorubicin, taxol, and vinca alkaloids by actively pumping the drugs out of cells.


Pssm-ID: 350022 [Multi-domain]  Cd Length: 317  Bit Score: 320.94  E-value: 1.84e-99
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  833 FALIRPNLHWVLLGLAMSVIIGGSYSAEAIVFGHTVGSLSPCRSAEaISRDGNLYGLLFFILALVEFGANVVGGCAFGWA 912
Cdd:cd18578    1 LKLNKPEWPLLLLGLIGAIIAGAVFPVFAILFSKLISVFSLPDDDE-LRSEANFWALMFLVLAIVAGIAYFLQGYLFGIA 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  913 ADKVLYRIRVLSLRSLLGQTVKWHESEDRTPGTLLTYITGDASALGGITGTTIGLLLATAVNLIGGLVISFSIAWKITIV 992
Cdd:cd18578   80 GERLTRRLRKLAFRAILRQDIAWFDDPENSTGALTSRLSTDASDVRGLVGDRLGLILQAIVTLVAGLIIAFVYGWKLALV 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  993 LFPTIPVLLVSGMMKLRVQKQLAERHQKAFAKATAVTIEAVDNIRAVSAFSLEKQSYQVYGRALRGPYRATIKATFHGNA 1072
Cdd:cd18578  160 GLATVPLLLLAGYLRMRLLSGFEEKNKKAYEESSKIASEAVSNIRTVASLTLEDYFLEKYEEALEEPLKKGLRRALISGL 239
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 20530737 1073 WLALAFSISNLVYALAYWWGSKQIAEGRYSQTQFFIVMPALLFSTQSCGQMFALAPDISKAGVASSNIVELLTTRSA 1149
Cdd:cd18578  240 GFGLSQSLTFFAYALAFWYGGRLVANGEYTFEQFFIVFMALIFGAQSAGQAFSFAPDIAKAKAAAARIFRLLDRKPE 316
MsbA_rel TIGR02204
ABC transporter, permease/ATP-binding protein; This protein is related to a Proteobacterial ...
209-750 1.84e-96

ABC transporter, permease/ATP-binding protein; This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.


Pssm-ID: 131259 [Multi-domain]  Cd Length: 576  Bit Score: 322.42  E-value: 1.84e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    209 LVSERLARRYRRRYFESIIKQEAKFIESLPSGDVVSRLVSDIELVQSGTSEKVGLVISTLSYFVAAYVVAFIKVPKIAGM 288
Cdd:TIGR02204   84 WLGERVVADIRRAVFAHLISLSPSFFDKNRSGEVVSRLTTDTTLLQSVIGSSLSMALRNALMCIGGLIMMFITSPKLTSL 163
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    289 LVSVVPCFFLMALGGGHYIKKFAGRLAEKVNAATSIASSSLSHLTLVHAFNANDRLEKRFAGYLLQSRKDAVRKATTHAA 368
Cdd:TIGR02204  164 VLLAVPLVLLPILLFGRRVRKLSRESQDRIADAGSYAGETLGAIRTVQAFGHEDAERSRFGGAVEKAYEAARQRIRTRAL 243
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    369 QLGCLYFIAYSANALAFWEGSQMIsksVADGNSGTSVGAVytVIFVLIDASFIlSQVAPFIHVFASAAGASERLLQVINR 448
Cdd:TIGR02204  244 LTAIVIVLVFGAIVGVLWVGAHDV---IAGKMSAGTLGQF--VFYAVMVAGSI-GTLSEVWGELQRAAGAAERLIELLQA 317
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    449 PSAIDGTSdSGDKTAAFGEEDIRFRDVHFKYPSRPDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDPDSGD 528
Cdd:TIGR02204  318 EPDIKAPA-HPKTLPVPLRGEIEFEQVNFAYPARPDQPALDGLNLTVRPGETVALVGPSGAGKSTLFQLLLRFYDPQSGR 396
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    529 VLIGDKNFRDINVRYLRGNIGYVQQEPSLLDRTILENIAYGlvssamerhqrlapfildsslpdlaekiREGLTEKEalr 608
Cdd:TIGR02204  397 ILLDGVDLRQLDPAELRARMALVPQDPVLFAASVMENIRYG----------------------------RPDATDEE--- 445
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    609 eydscvteivdlVKEAAANANALGFIEALPYGFATNVGTAGNQLSGGQKQRIALARALVREPCLLILDEATAALDSTSEQ 688
Cdd:TIGR02204  446 ------------VEAAARAAHAHEFISALPEGYDTYLGERGVTLSGGQRQRIAIARAILKDAPILLLDEATSALDAESEQ 513
                          490       500       510       520       530       540
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 20530737    689 LIQAALNRVSERVTTVSIAHRLATAKNAHKIVVVQSGRVTEEGSHTDLVSRGGVYAEMVRLQ 750
Cdd:TIGR02204  514 LVQQALETLMKGRTTLIIAHRLATVLKADRIVVMDQGRIVAQGTHAELIAKGGLYARLARLQ 575
3a01208 TIGR00958
Conjugate Transporter-2 (CT2) Family protein; [Transport and binding proteins, Other]
102-747 6.09e-96

Conjugate Transporter-2 (CT2) Family protein; [Transport and binding proteins, Other]


Pssm-ID: 273363 [Multi-domain]  Cd Length: 711  Bit Score: 325.14  E-value: 6.09e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    102 VTRHIPTKDDLGKSFAYLRLLfslDYTIADVLLIIGGLLFAICAG-----IPFpLLGIVFGDLINDlntvtcsssdRATA 176
Cdd:TIGR00958  133 ASEKEAEQGQSETADLLFRLL---GLSGRDWPWLISAFVFLTLSSlgemfIPF-YTGRVIDTLGGD----------KGPP 198
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    177 DLSSAVRAKVLYviyiTIANFWFIYAHSTCWCLVSERLARRYRRRYFESIIKQEAKFIESLPSGDVVSRLVSDIELVQSG 256
Cdd:TIGR00958  199 ALASAIFFMCLL----SIASSVSAGLRGGSFNYTMARINLRIREDLFRSLLRQDLGFFDENKTGELTSRLSSDTQTMSRS 274
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    257 TSEKVGLVISTLSYFVAAYVVAFIKVPKIAGMLVSVVPCFFLMALGGGHYIKKFAGRLAEKVNAATSIASSSLSHLTLVH 336
Cdd:TIGR00958  275 LSLNVNVLLRNLVMLLGLLGFMLWLSPRLTMVTLINLPLVFLAEKVFGKRYQLLSEELQEAVAKANQVAEEALSGMRTVR 354
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    337 AFNANDRLEKRFAGYLLQSRKDAVRKATTHAAQLGCLYFIAYSANALAFWEGSQ-MISKSVADGNsgtsvgavyTVIFVL 415
Cdd:TIGR00958  355 SFAAEEGEASRFKEALEETLQLNKRKALAYAGYLWTTSVLGMLIQVLVLYYGGQlVLTGKVSSGN---------LVSFLL 425
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    416 I-----DASFILSQVAPFIhvfASAAGASERLLQVINRPSAIdgtSDSGDKTAAFGEEDIRFRDVHFKYPSRPDVPVLQG 490
Cdd:TIGR00958  426 YqeqlgEAVRVLSYVYSGM---MQAVGASEKVFEYLDRKPNI---PLTGTLAPLNLEGLIEFQDVSFSYPNRPDVPVLKG 499
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    491 VTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDPDSGDVLIGDKNFRDINVRYLRGNIGYVQQEPSLLDRTILENIAYGL 570
Cdd:TIGR00958  500 LTFTLHPGEVVALVGPSGSGKSTVAALLQNLYQPTGGQVLLDGVPLVQYDHHYLHRQVALVGQEPVLFSGSVRENIAYGL 579
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    571 VSSAMERhqrlapfildsslpdlaekiregltekealreydscvteivdlVKEAAANANALGFIEALPYGFATNVGTAGN 650
Cdd:TIGR00958  580 TDTPDEE-------------------------------------------IMAAAKAANAHDFIMEFPNGYDTEVGEKGS 616
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    651 QLSGGQKQRIALARALVREPCLLILDEATAALDSTSEQLIQAALNRVSErvTTVSIAHRLATAKNAHKIVVVQSGRVTEE 730
Cdd:TIGR00958  617 QLSGGQKQRIAIARALVRKPRVLILDEATSALDAECEQLLQESRSRASR--TVLLIAHRLSTVERADQILVLKKGSVVEM 694
                          650
                   ....*....|....*..
gi 20530737    731 GSHTDLVSRGGVYAEMV 747
Cdd:TIGR00958  695 GTHKQLMEDQGCYKHLV 711
SunT COG2274
ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase ...
910-1432 6.85e-93

ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms];


Pssm-ID: 225183 [Multi-domain]  Cd Length: 709  Bit Score: 316.48  E-value: 6.85e-93
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  910 GWAADKVLYRIRV-LSL---RSLLGQTVKWHESedRTPGTLLTYITGDASALGGITGTTIGLLLATAVNLIGGLVIsFSI 985
Cdd:COG2274  215 TYLIAHLGKRLDLeLSGrffRHLLRLPLSYFEK--RSVGEIISRVRELEQIREFLTGSILTLIIDLLFALIFLAVM-FLY 291
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  986 AWKITIVLFPTIPVLLVSGmmkLRVQKQLAERHQKAF---AKATAVTIEAVDNIRAVSAFSLEKQSYQVYGRALRGPYRA 1062
Cdd:COG2274  292 SWKLTLIVLAAIPLNVLIT---LIFQPLLRRKTRKLIeesAEQQSFLVETIKGIETVKALAAEPRFRSQWDNRLAKQVNI 368
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1063 TIKATFHGNAWLALAFSISNLVYALAYWWGSKQIAEGRYSQTQFF-IVMPALLFsTQSCGQMFALAPDISKAGVASSNIV 1141
Cdd:COG2274  369 GFKTEKLALILNTIKSLLQQLSSVLILWFGAILVLEGELTLGQLVaFNMLAGYF-ISPITRLSQLWTDFQQAKVALERLG 447
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1142 ELLTTRSAEDEvtpgsshsfqpssslleEKTAVQDIEAQEYARstrqraaerggmgaqLRDVHFTYPHRpERPVLKGLNI 1221
Cdd:COG2274  448 DILDTPPEQEG-----------------DKTLIHLPKLQGEIE---------------FENVSFRYGPD-DPPVLEDLSL 494
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1222 DIKPGQFCALVGPSGSGKSTTFAMLERFYRPNAGAVVIDGVDVTRQVGTEFRDDIALVPQQNILFEGTVAFNVALGAcPg 1301
Cdd:COG2274  495 EIPPGEKVAIVGRSGSGKSTLLKLLLGLYKPQQGRILLDGVDLNDIDLASLRRQVGYVLQDPFLFSGSIRENIALGN-P- 572
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1302 hEPTQEEIEEACRMANIHDVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVESEKRIQEA 1381
Cdd:COG2274  573 -EATDEEIIEAAQLAGAHEFIENLPMGYDTPVGEGGANLSGGQRQRLALARALLSKPKILLLDEATSALDPETEAIILQN 651
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|.
gi 20530737 1382 LATLAGRTTVVAIAHRLNTIHRADQIFLIEDGRCIEQGTHQQLIQRSETYR 1432
Cdd:COG2274  652 LLQILQGRTVIIIAHRLSTIRSADRIIVLDQGKIVEQGSHEELLAQGGLYA 702
MsbA_rel TIGR02204
ABC transporter, permease/ATP-binding protein; This protein is related to a Proteobacterial ...
827-1432 1.16e-92

ABC transporter, permease/ATP-binding protein; This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.


Pssm-ID: 131259 [Multi-domain]  Cd Length: 576  Bit Score: 311.63  E-value: 1.16e-92
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    827 FVTRY-------TFALIRPNLHWVLLGLAMSVIIGGSYSAEaivfghtvgslspcrSAEAIsrdgNLYGLLFFILALVEF 899
Cdd:TIGR02204   12 FVRPYrgrvlaaLVALLITAAATLSLPYAVRLMIDHGFSKD---------------SSGLL----NRYFAFLLVVALVLA 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    900 GANVVGGCAFGWAADKVLYRIRvlslRSLLGQTVKWHES--EDRTPGTLLTYITGDASALGGITGTTIGLLLATAVNLIG 977
Cdd:TIGR02204   73 LGTAARFYLVTWLGERVVADIR----RAVFAHLISLSPSffDKNRSGEVVSRLTTDTTLLQSVIGSSLSMALRNALMCIG 148
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    978 GLVISFSIAWKITIVLFPTIPVLLVSGMMKLRVQKQLAERHQKAFAKATAVTIEAVDNIRAVSAFSLEKQSYQVYGRALR 1057
Cdd:TIGR02204  149 GLIMMFITSPKLTSLVLLAVPLVLLPILLFGRRVRKLSRESQDRIADAGSYAGETLGAIRTVQAFGHEDAERSRFGGAVE 228
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1058 GPYRATIKATfHGNAWLaLAFSISnLVYA---LAYWWGSKQIAEGRYSQTQFFIVMPALLFSTQSCGQMFALAPDISKAG 1134
Cdd:TIGR02204  229 KAYEAARQRI-RTRALL-TAIVIV-LVFGaivGVLWVGAHDVIAGKMSAGTLGQFVFYAVMVAGSIGTLSEVWGELQRAA 305
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1135 VASSNIVELLTTRSaedevtpgsshsfqpssslleektavqDIEAQEYARSTRQRAaeRGGMgaQLRDVHFTYPHRPERP 1214
Cdd:TIGR02204  306 GAAERLIELLQAEP---------------------------DIKAPAHPKTLPVPL--RGEI--EFEQVNFAYPARPDQP 354
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1215 VLKGLNIDIKPGQFCALVGPSGSGKSTTFAMLERFYRPNAGAVVIDGVDVTRQVGTEFRDDIALVPQQNILFEGTVAFNV 1294
Cdd:TIGR02204  355 ALDGLNLTVRPGETVALVGPSGAGKSTLFQLLLRFYDPQSGRILLDGVDLRQLDPAELRARMALVPQDPVLFAASVMENI 434
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1295 ALGACpghEPTQEEIEEACRMANIHDVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKPRLLLLDESTSALDVES 1374
Cdd:TIGR02204  435 RYGRP---DATDEEVEAAARAAHAHEFISALPEGYDTYLGERGVTLSGGQRQRIAIARAILKDAPILLLDEATSALDAES 511
                          570       580       590       600       610
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 20530737   1375 EKRIQEALATL-AGRTTVVaIAHRLNTIHRADQIFLIEDGRCIEQGTHQQLIQRSETYR 1432
Cdd:TIGR02204  512 EQLVQQALETLmKGRTTLI-IAHRLATVLKADRIVVMDQGRIVAQGTHAELIAKGGLYA 569
3a01208 TIGR00958
Conjugate Transporter-2 (CT2) Family protein; [Transport and binding proteins, Other]
892-1435 4.29e-89

Conjugate Transporter-2 (CT2) Family protein; [Transport and binding proteins, Other]


Pssm-ID: 273363 [Multi-domain]  Cd Length: 711  Bit Score: 305.88  E-value: 4.29e-89
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    892 FILALVEFGANVVGGC---AFGWAADKVLYRIRVLSLRSLLGQTVKWHEsEDRTpGTLLTYITGDASALGGITGTTIGLL 968
Cdd:TIGR00958  205 FFMCLLSIASSVSAGLrggSFNYTMARINLRIREDLFRSLLRQDLGFFD-ENKT-GELTSRLSSDTQTMSRSLSLNVNVL 282
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    969 LATAVNLIGGLVISFSIAWKITIVLFPTIPVLLVSGMMKLRVQKQLAERHQKAFAKATAVTIEAVDNIRAVSAFSLEKQS 1048
Cdd:TIGR00958  283 LRNLVMLLGLLGFMLWLSPRLTMVTLINLPLVFLAEKVFGKRYQLLSEELQEAVAKANQVAEEALSGMRTVRSFAAEEGE 362
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1049 YQVYGRALRGPYRATIKATFHGNAWLALAFSISNLVYALAYWWGSKQIAEGRYSQTQFFIVMPALLFSTQSCGQMFALAP 1128
Cdd:TIGR00958  363 ASRFKEALEETLQLNKRKALAYAGYLWTTSVLGMLIQVLVLYYGGQLVLTGKVSSGNLVSFLLYQEQLGEAVRVLSYVYS 442
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1129 DISKAGVASSNIVELLttrsaedEVTPGSSHSFQPSSSLLEEKTavqdieaqeyarstrqraaerggmgaQLRDVHFTYP 1208
Cdd:TIGR00958  443 GMMQAVGASEKVFEYL-------DRKPNIPLTGTLAPLNLEGLI--------------------------EFQDVSFSYP 489
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1209 HRPERPVLKGLNIDIKPGQFCALVGPSGSGKSTTFAMLERFYRPNAGAVVIDGVDVTRQVGTEFRDDIALVPQQNILFEG 1288
Cdd:TIGR00958  490 NRPDVPVLKGLTFTLHPGEVVALVGPSGSGKSTVAALLQNLYQPTGGQVLLDGVPLVQYDHHYLHRQVALVGQEPVLFSG 569
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1289 TVAFNVALG--ACPgheptQEEIEEACRMANIHDVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKPRLLLLDES 1366
Cdd:TIGR00958  570 SVRENIAYGltDTP-----DEEIMAAAKAANAHDFIMEFPNGYDTEVGEKGSQLSGGQKQRIAIARALVRKPRVLILDEA 644
                          490       500       510       520       530       540
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 20530737   1367 TSALDVESEKRIQEaLATLAGRtTVVAIAHRLNTIHRADQIFLIEDGRCIEQGTHQQLIQRSETYRTSV 1435
Cdd:TIGR00958  645 TSALDAECEQLLQE-SRSRASR-TVLLIAHRLSTVERADQILVLKKGSVVEMGTHKQLMEDQGCYKHLV 711
ABCC_ATM1_transporter cd03253
ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C; ATM1 is an ABC ...
1199-1432 1.16e-84

ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C; ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213220 [Multi-domain]  Cd Length: 236  Bit Score: 276.42  E-value: 1.16e-84
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1199 QLRDVHFTYPhrPERPVLKGLNIDIKPGQFCALVGPSGSGKSTTFAMLERFYRPNAGAVVIDGVDVTRQVGTEFRDDIAL 1278
Cdd:cd03253    2 EFENVTFAYD--PGRPVLKDVSFTIPAGKKVAIVGPSGSGKSTILRLLFRFYDVSSGSILIDGQDIREVTLDSLRRAIGV 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1279 VPQQNILFEGTVAFNVALGaCPGhePTQEEIEEACRMANIHDVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKP 1358
Cdd:cd03253   80 VPQDTVLFNDTIGYNIRYG-RPD--ATDEEVIEAAKAAQIHDKIMRFPDGYDTIVGERGLKLSGGEKQRVAIARAILKNP 156
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 20530737 1359 RLLLLDESTSALDVESEKRIQEALATLAGRTTVVAIAHRLNTIHRADQIFLIEDGRCIEQGTHQQLIQRSETYR 1432
Cdd:cd03253  157 PILLLDEATSALDTHTEREIQAALRDVSKGRTTIVIAHRLSTIVNADKIIVLKDGRIVERGTHEELLAKGGLYA 230
ABCC_MsbA cd03251
ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C; ...
1200-1432 3.52e-84

ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C; MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213218 [Multi-domain]  Cd Length: 234  Bit Score: 274.88  E-value: 3.52e-84
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1200 LRDVHFTYPHRpERPVLKGLNIDIKPGQFCALVGPSGSGKSTTFAMLERFYRPNAGAVVIDGVDVtRQVG-TEFRDDIAL 1278
Cdd:cd03251    3 FKNVTFRYPGD-GPPVLRDISLDIPAGETVALVGPSGSGKSTLVNLIPRFYDVDSGRILIDGHDV-RDYTlASLRRQIGL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737 1279 VPQQNILFEGTVAFNVALGAcpgHEPTQEEIEEACRMANIHDVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARALVRKP 1358
Cdd:cd03251   81 VSQDVFLFNDTVAENIAYGR---PGATREEVEEAARAANAHEFIMELPEGYDTVIGERGVKLSGGQRQRIAIARALLKDP 157
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 20530737 1359 RLLLLDESTSALDVESEKRIQEALATL-AGRTTVVaIAHRLNTIHRADQIFLIEDGRCIEQGTHQQLIQRSETYR 1432
Cdd:cd03251  158 PILILDEATSALDTESERLVQAALERLmKNRTTFV-IAHRLSTIENADRIVVLEDGKIVERGTHEELLAQGGVYA 231
ABCC_ATM1_transporter cd03253
ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C; ATM1 is an ABC ...
470-750 2.64e-83

ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C; ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213220 [Multi-domain]  Cd Length: 236  Bit Score: 272.57  E-value: 2.64e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  470 IRFRDVHFKYPsrPDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDPDSGDVLIGDKNFRDINVRYLRGNIG 549
Cdd:cd03253    1 IEFENVTFAYD--PGRPVLKDVSFTIPAGKKVAIVGPSGSGKSTILRLLFRFYDVSSGSILIDGQDIREVTLDSLRRAIG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  550 YVQQEPSLLDRTILENIAYGlvssamerhqrlapfildsslpdlaekiREGLTEKEalreydscvteivdlVKEAAANAN 629
Cdd:cd03253   79 VVPQDTVLFNDTIGYNIRYG----------------------------RPDATDEE---------------VIEAAKAAQ 115
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  630 ALGFIEALPYGFATNVGTAGNQLSGGQKQRIALARALVREPCLLILDEATAALDSTSEQLIQAALNRVSERVTTVSIAHR 709
Cdd:cd03253  116 IHDKIMRFPDGYDTIVGERGLKLSGGEKQRVAIARAILKNPPILLLDEATSALDTHTEREIQAALRDVSKGRTTIVIAHR 195
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 20530737  710 LATAKNAHKIVVVQSGRVTEEGSHTDLVSRGGVYAEMVRLQ 750
Cdd:cd03253  196 LSTIVNADKIIVLKDGRIVERGTHEELLAKGGLYAEMWKAQ 236
ABCC_MsbA cd03251
ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C; ...
470-746 5.18e-83

ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C; MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213218 [Multi-domain]  Cd Length: 234  Bit Score: 271.41  E-value: 5.18e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  470 IRFRDVHFKYPSRPDvPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERFYDPDSGDVLIGDKNFRDINVRYLRGNIG 549
Cdd:cd03251    1 VEFKNVTFRYPGDGP-PVLRDISLDIPAGETVALVGPSGSGKSTLVNLIPRFYDVDSGRILIDGHDVRDYTLASLRRQIG 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  550 YVQQEPSLLDRTILENIAYGlvssamerhqrlapfildsslpdlaekiREGLTEKEalreydscvteivdlVKEAAANAN 629
Cdd:cd03251   80 LVSQDVFLFNDTVAENIAYG----------------------------RPGATREE---------------VEEAARAAN 116
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737  630 ALGFIEALPYGFATNVGTAGNQLSGGQKQRIALARALVREPCLLILDEATAALDSTSEQLIQAALNRVSERVTTVSIAHR 709
Cdd:cd03251  117 AHEFIMELPEGYDTVIGERGVKLSGGQRQRIAIARALLKDPPILILDEATSALDTESERLVQAALERLMKNRTTFVIAHR 196
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 20530737  710 LATAKNAHKIVVVQSGRVTEEGSHTDLVSRGGVYAEM 746
Cdd:cd03251  197 LSTIENADRIVVLEDGKIVERGTHEELLAQGGVYAKL 233
MsbA_lipidA TIGR02203
lipid A export permease/ATP-binding protein MsbA; This family consists of a single polypeptide ...
137-751 1.27e-82

lipid A export permease/ATP-binding protein MsbA; This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other]


Pssm-ID: 131258 [Multi-domain]  Cd Length: 571  Bit Score: 282.76  E-value: 1.27e-82
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    137 GGLLFAICAGIPF----PLLGIVFGDLINDLntvtcsSSDRataDLSSAVRAKVLYVIYIT---IANFWFIYAHStcwcL 209
Cdd:TIGR02203   14 AGLVLAGVAMILVaateSTLAALLKPLLDDG------FGGR---DRSVLWWVPLVVIGLAVlrgICSFVSTYLLS----W 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    210 VSERLARRYRRRYFESIIKQEAKFIESLPSGDVVSRLVSDIELVQSGTSEKVGLVISTLSYFVAAYVVAFIKVPKIAGML 289
Cdd:TIGR02203   81 VSNKVVRDIRVRMFEKLLGLPVSFFDRQPTGTLLSRITFDSEQVASAATDAFIVLVRETLTVIGLFIVLLYYSWQLTLIV 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    290 VSVVPCFFLMALGGGHYIKKFAGRLAEKVNAATSIASSSLSHLTLVHAFNANDRLEKRFAGYLLQSRKDAVRKATTHAAQ 369
Cdd:TIGR02203  161 VVMLPVLSILMRRVSKRLRRISKEIQNSMGQVTTVAEETLQGYRVVKLFGGQAYETRRFDAVSNRNRRLAMKMTSAGSIS 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    370 LGCLYFIAYSANA----LAFWEGsqmisksvadGNSGTSVG---AVYTVIFVLIDASFILSQVA-PFIHVFASAagasER 441
Cdd:TIGR02203  241 SPITQLIASLALAvvlfIALFQA----------QAGSLTAGdftAFITAMIALIRPLKSLTNVNaPMQRGLAAA----ES 306
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    442 LLQVINRPSAIDgtsdSGDKTAAFGEEDIRFRDVHFKYPSRpDVPVLQGVTFNIPPKKHTAIVGPSGGGKSTVVALLERF 521
Cdd:TIGR02203  307 LFTLLDSPPEKD----TGTRAIERARGDVEFRNVTFRYPGR-DRPALDSISLVIEPGETVALVGRSGSGKSTLVNLIPRF 381
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    522 YDPDSGDVLIGDKNFRDINVRYLRGNIGYVQQEPSLLDRTILENIAYGlvssamerhqrlapfildsslpdlaekiregl 601
Cdd:TIGR02203  382 YEPDSGQILLDGHDLADYTLASLRRQVALVSQDVVLFNDTIANNIAYG-------------------------------- 429
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    602 tekeALREYDScvteivDLVKEAAANANALGFIEALPYGFATNVGTAGNQLSGGQKQRIALARALVREPCLLILDEATAA 681
Cdd:TIGR02203  430 ----RTEQADR------AEIERALAAAYAQDFVDKLPLGLDTPIGENGVLLSGGQRQRLAIARALLKDAPILILDEATSA 499
                          570       580       590       600       610       620       630
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    682 LDSTSEQLIQAALNRVSERVTTVSIAHRLATAKNAHKIVVVQSGRVTEEGSHTDLVSRGGVYAEMVRLQN 751
Cdd:TIGR02203  500 LDNESERLVQAALERLMQGRTTLVIAHRLSTIEKADRIVVMDDGRIVERGTHNELLARNGLYAQLHNMQF 569
MsbA_lipidA TIGR02203
lipid A export permease/ATP-binding protein MsbA; This family consists of a single polypeptide ...
889-1431 1.89e-82

lipid A export permease/ATP-binding protein MsbA; This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other]


Pssm-ID: 131258 [Multi-domain]  Cd Length: 571  Bit Score: 282.38  E-value: 1.89e-82
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    889 LLFFILALVEFGANVVGGCAFGWAADKVLYRIRVLSLRSLLGQTVKWHeseDRTP-GTLLTYITGDAS-ALGGITGTTIG 966
Cdd:TIGR02203   58 LVVIGLAVLRGICSFVSTYLLSWVSNKVVRDIRVRMFEKLLGLPVSFF---DRQPtGTLLSRITFDSEqVASAATDAFIV 134
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737    967 LLLATAVnLIGGLVISFSIAWKITIVLFPTIPVLlvSGMMKlRVQKQL---AERHQKAFAKATAVTIEAVDNIRAVSAFS 1043
Cdd:TIGR02203  135 LVRETLT-VIGLFIVLLYYSWQLTLIVVVMLPVL--SILMR-RVSKRLrriSKEIQNSMGQVTTVAEETLQGYRVVKLFG 210
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1044 LEKQSYQVYGRALRGPYRATIKATFHGN---------AWLALAFsisnlVYALAYWwgskQIAEGRYSQTQFFIVMPALL 1114
Cdd:TIGR02203  211 GQAYETRRFDAVSNRNRRLAMKMTSAGSisspitqliASLALAV-----VLFIALF----QAQAGSLTAGDFTAFITAMI 281
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1115 FSTQSCGQMFALAPDISKAGVASSNIVELLTTrsaEDEVTPGSshsfqpssslleektavqdieaqeyarstrqRAAERG 1194
Cdd:TIGR02203  282 ALIRPLKSLTNVNAPMQRGLAAAESLFTLLDS---PPEKDTGT-------------------------------RAIERA 327
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1195 GMGAQLRDVHFTYPHRpERPVLKGLNIDIKPGQFCALVGPSGSGKSTTFAMLERFYRPNAGAVVIDGVDVTRQVGTEFRD 1274
Cdd:TIGR02203  328 RGDVEFRNVTFRYPGR-DRPALDSISLVIEPGETVALVGRSGSGKSTLVNLIPRFYEPDSGQILLDGHDLADYTLASLRR 406
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20530737   1275 DIALVPQQNILFEGTVAFNVALGAcpGHEPTQEEIEEACRMANIHDVIMTLPQGYQTMCSHDGKQFSGGQRQRLSIARAL 1354
Cdd:TIGR02203  407 QVALVSQDVVLFNDTIANNIAYGR--TEQADRAEIERALAAA