NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|19387277|gb|AAL87188|]
View 

hypothetical protein [Oryza sativa Japonica Group]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
BTB_POZ super family cl38908
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
202-311 2.49e-21

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain superfamily; Proteins in this superfamily are characterized by the presence of a common protein-protein interaction motif of about 100 amino acids, known as the BTB/POZ domain. Members include transcription factors, oncogenic proteins, ion channel proteins, and potassium channel tetramerization domain (KCTD) proteins. They have been identified in poxviruses and many eukaryotes, and have diverse functions, such as transcriptional regulation, chromatin remodeling, protein degradation and cytoskeletal regulation. Many BTB/POZ proteins contain one or two additional domains, such as kelch repeats, zinc-finger domains, FYVE (Fab1, YOTB, Vac1, and EEA1) fingers, or ankyrin repeats, among others. These special additional domains or interaction partners provide unique characteristics and functions to BTB/POZ proteins. In ion channel proteins and KCTD proteins, the BTB/POZ domain is also called the tetramerization (T1) domain.


The actual alignment was detected with superfamily member cd18280:

Pssm-ID: 365784 [Multi-domain]  Cd Length: 121  Bit Score: 87.77  E-value: 2.49e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 202 LLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSpAIRLREMSPEAFGAVLHYVYHDSLP----PEA 277
Cdd:cd18280   8 LLESEEGADVTFNVDGEKFRAHKLVLAARSPVFRSMLFGPMREENEG-EIVIEDVEPPVFKALLHFIYKDELPddvePAG 86
                        90       100       110
                ....*....|....*....|....*....|....*
gi 19387277 278 NKGRNAA-AMAREVFEAADMYAMERLKLMCASNLC 311
Cdd:cd18280  87 SDSSSLDtTMAQHLLAAADRYALERLRLLCESRLC 121
MATH cd00121
MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded ...
31-164 6.44e-20

MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins. Meprins comprise a class of extracellular metalloproteases which are anchored to the membrane and are capable of cleaving growth factors, extracellular matrix proteins, and biologically active peptides. TRAF molecules serve as adapter proteins that link cell surface receptors of the Tumor Necrosis Factor and 1nterleukin-1/Toll-like families to downstream kinase cascades, which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems. Other members include the ubiquitin ligases, TRIM37 and SPOP, and the ubiquitin-specific proteases, HAUSP and Ubp21p. A large number of uncharacterized members mostly from lineage-specific expansions in C. elegans and rice contain MATH and BTB domains, similar to SPOP. The MATH domain has been shown to bind peptide/protein substrates in TRAFs and HAUSP. It is possible that the MATH domain in other members of this superfamily also interacts with various protein substrates. The TRAF domain may also be involved in the trimerization of TRAFs. Based on homology, it is postulated that the MATH domain in meprins may be involved in its tetramer assembly and that the MATH domain, in general, may take part in diverse modular arrangements defined by adjacent multimerization domains.


:

Pssm-ID: 238068  Cd Length: 126  Bit Score: 83.97  E-value: 6.44e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277  31 GVHQFTIRQYSgvkgKGVGNSVLSRNFTVAGREWFVRFYPDGyNSDTSDHVAFFLQSLYRPS--CGSVYHVEFSFALLGG 108
Cdd:cd00121   1 GKHTWKIVNFS----ELEGESIYSPPFEVGGYKWRIRIYPNG-DGESGDYLSLYLELDKGESdlEKWSVRAEFTLKLVNQ 75
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 19387277 109 GGGGgavlHDVRIDRPCRFDNRNNSWGIRKYIAREQLEGAalGAIHDDALTVRCTM 164
Cdd:cd00121  76 NGGK----SLSKSFTHVFFSEKGSGWGFPKFISWDDLEDS--YYLVDDSLTIEVEV 125
 
Name Accession Description Interval E-value
BTB_POZ_BPM_plant cd18280
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
202-311 2.49e-21

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in plant BTB/POZ-MATH (BPM) protein family; The BPM protein family includes Arabidopsis thaliana BTB/POZ and MATH domain-containing proteins, AtBPM1-6, and similar proteins from other plants. BPM protein, also called protein BTB-POZ and MATH domain, may act as a substrate-specific adaptor of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349589 [Multi-domain]  Cd Length: 121  Bit Score: 87.77  E-value: 2.49e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 202 LLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSpAIRLREMSPEAFGAVLHYVYHDSLP----PEA 277
Cdd:cd18280   8 LLESEEGADVTFNVDGEKFRAHKLVLAARSPVFRSMLFGPMREENEG-EIVIEDVEPPVFKALLHFIYKDELPddvePAG 86
                        90       100       110
                ....*....|....*....|....*....|....*
gi 19387277 278 NKGRNAA-AMAREVFEAADMYAMERLKLMCASNLC 311
Cdd:cd18280  87 SDSSSLDtTMAQHLLAAADRYALERLRLLCESRLC 121
MATH cd00121
MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded ...
31-164 6.44e-20

MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins. Meprins comprise a class of extracellular metalloproteases which are anchored to the membrane and are capable of cleaving growth factors, extracellular matrix proteins, and biologically active peptides. TRAF molecules serve as adapter proteins that link cell surface receptors of the Tumor Necrosis Factor and 1nterleukin-1/Toll-like families to downstream kinase cascades, which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems. Other members include the ubiquitin ligases, TRIM37 and SPOP, and the ubiquitin-specific proteases, HAUSP and Ubp21p. A large number of uncharacterized members mostly from lineage-specific expansions in C. elegans and rice contain MATH and BTB domains, similar to SPOP. The MATH domain has been shown to bind peptide/protein substrates in TRAFs and HAUSP. It is possible that the MATH domain in other members of this superfamily also interacts with various protein substrates. The TRAF domain may also be involved in the trimerization of TRAFs. Based on homology, it is postulated that the MATH domain in meprins may be involved in its tetramer assembly and that the MATH domain, in general, may take part in diverse modular arrangements defined by adjacent multimerization domains.


Pssm-ID: 238068  Cd Length: 126  Bit Score: 83.97  E-value: 6.44e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277  31 GVHQFTIRQYSgvkgKGVGNSVLSRNFTVAGREWFVRFYPDGyNSDTSDHVAFFLQSLYRPS--CGSVYHVEFSFALLGG 108
Cdd:cd00121   1 GKHTWKIVNFS----ELEGESIYSPPFEVGGYKWRIRIYPNG-DGESGDYLSLYLELDKGESdlEKWSVRAEFTLKLVNQ 75
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 19387277 109 GGGGgavlHDVRIDRPCRFDNRNNSWGIRKYIAREQLEGAalGAIHDDALTVRCTM 164
Cdd:cd00121  76 NGGK----SLSKSFTHVFFSEKGSGWGFPKFISWDDLEDS--YYLVDDSLTIEVEV 125
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
210-314 1.53e-16

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585 [Multi-domain]  Cd Length: 97  Bit Score: 73.88  E-value: 1.53e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277    210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQvGNEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEANkgrnaaaMARE 289
Cdd:smart00225   1 DVTLVVGGKKFHAHKAVLAAHSPYFKALFSSD-FKESDKSEIYLDDVSPEDFRALLNFLYTGKLDLPEE-------NVEE 72
                           90       100
                   ....*....|....*....|....*
gi 19387277    290 VFEAADMYAMERLKLMCASNLCRFI 314
Cdd:smart00225  73 LLELADYLQIPGLVELCEEFLLKLL 97
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
202-311 2.89e-16

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerized PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


Pssm-ID: 334194 [Multi-domain]  Cd Length: 108  Bit Score: 73.46  E-value: 2.89e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277   202 LLSGDAPFDLEIHVGDA-TFGAHRLALAGQSLYFRKLLYGQvGNEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEankg 280
Cdd:pfam00651   4 LREQGKLCDVTLVVGDGkEFRAHKAVLAACSPYFKALFSGQ-EEESSVSEIELDDVSPEDFEALLEFMYTGELEIS---- 78
                          90       100       110
                  ....*....|....*....|....*....|.
gi 19387277   281 rnaAAMAREVFEAADMYAMERLKLMCASNLC 311
Cdd:pfam00651  79 ---EENVDDLLAAADKLQIPSLVDKCEEFLI 106
 
Name Accession Description Interval E-value
BTB_POZ_BPM_plant cd18280
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
202-311 2.49e-21

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in plant BTB/POZ-MATH (BPM) protein family; The BPM protein family includes Arabidopsis thaliana BTB/POZ and MATH domain-containing proteins, AtBPM1-6, and similar proteins from other plants. BPM protein, also called protein BTB-POZ and MATH domain, may act as a substrate-specific adaptor of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349589 [Multi-domain]  Cd Length: 121  Bit Score: 87.77  E-value: 2.49e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 202 LLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSpAIRLREMSPEAFGAVLHYVYHDSLP----PEA 277
Cdd:cd18280   8 LLESEEGADVTFNVDGEKFRAHKLVLAARSPVFRSMLFGPMREENEG-EIVIEDVEPPVFKALLHFIYKDELPddvePAG 86
                        90       100       110
                ....*....|....*....|....*....|....*
gi 19387277 278 NKGRNAA-AMAREVFEAADMYAMERLKLMCASNLC 311
Cdd:cd18280  87 SDSSSLDtTMAQHLLAAADRYALERLRLLCESRLC 121
MATH cd00121
MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded ...
31-164 6.44e-20

MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins. Meprins comprise a class of extracellular metalloproteases which are anchored to the membrane and are capable of cleaving growth factors, extracellular matrix proteins, and biologically active peptides. TRAF molecules serve as adapter proteins that link cell surface receptors of the Tumor Necrosis Factor and 1nterleukin-1/Toll-like families to downstream kinase cascades, which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems. Other members include the ubiquitin ligases, TRIM37 and SPOP, and the ubiquitin-specific proteases, HAUSP and Ubp21p. A large number of uncharacterized members mostly from lineage-specific expansions in C. elegans and rice contain MATH and BTB domains, similar to SPOP. The MATH domain has been shown to bind peptide/protein substrates in TRAFs and HAUSP. It is possible that the MATH domain in other members of this superfamily also interacts with various protein substrates. The TRAF domain may also be involved in the trimerization of TRAFs. Based on homology, it is postulated that the MATH domain in meprins may be involved in its tetramer assembly and that the MATH domain, in general, may take part in diverse modular arrangements defined by adjacent multimerization domains.


Pssm-ID: 238068  Cd Length: 126  Bit Score: 83.97  E-value: 6.44e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277  31 GVHQFTIRQYSgvkgKGVGNSVLSRNFTVAGREWFVRFYPDGyNSDTSDHVAFFLQSLYRPS--CGSVYHVEFSFALLGG 108
Cdd:cd00121   1 GKHTWKIVNFS----ELEGESIYSPPFEVGGYKWRIRIYPNG-DGESGDYLSLYLELDKGESdlEKWSVRAEFTLKLVNQ 75
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 19387277 109 GGGGgavlHDVRIDRPCRFDNRNNSWGIRKYIAREQLEGAalGAIHDDALTVRCTM 164
Cdd:cd00121  76 NGGK----SLSKSFTHVFFSEKGSGWGFPKFISWDDLEDS--YYLVDDSLTIEVEV 125
BTB_POZ_ZBTB_KLHL-like cd18186
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-297 1.13e-17

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing (ZBTB) proteins, Kelch-like (KLHL) proteins, and similar proteins; This family includes a variety of BTB/POZ domain-containing proteins, such as zinc finger and BTB domain-containing (ZBTB) proteins and Kelch-like (KLHL) proteins. They have diverse functions, such as transcriptional regulation, chromatin remodeling, protein degradation and cytoskeletal regulation. Many BTB/POZ proteins contain one or two additional domains, such as kelch repeats, zinc-finger domains, FYVE (Fab1, YOTB, Vac1, and EEA1) fingers, or ankyrin repeats. These special additional domains or interaction partners provide unique characteristics and functions to BTB/POZ proteins. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349497 [Multi-domain]  Cd Length: 82  Bit Score: 76.44  E-value: 1.13e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQvGNEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEANkgrnaaaMARE 289
Cdd:cd18186   3 DVTLVVGGREFPAHRAVLAARSPYFRAMFSSG-MKESSSSEIELDDVSPEAFEALLDYIYTGELELSEE-------NVEE 74

                ....*...
gi 19387277 290 VFEAADMY 297
Cdd:cd18186  75 LLAAADKL 82
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
210-314 1.53e-16

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585 [Multi-domain]  Cd Length: 97  Bit Score: 73.88  E-value: 1.53e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277    210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQvGNEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEANkgrnaaaMARE 289
Cdd:smart00225   1 DVTLVVGGKKFHAHKAVLAAHSPYFKALFSSD-FKESDKSEIYLDDVSPEDFRALLNFLYTGKLDLPEE-------NVEE 72
                           90       100
                   ....*....|....*....|....*
gi 19387277    290 VFEAADMYAMERLKLMCASNLCRFI 314
Cdd:smart00225  73 LLELADYLQIPGLVELCEEFLLKLL 97
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
202-311 2.89e-16

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerized PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


Pssm-ID: 334194 [Multi-domain]  Cd Length: 108  Bit Score: 73.46  E-value: 2.89e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277   202 LLSGDAPFDLEIHVGDA-TFGAHRLALAGQSLYFRKLLYGQvGNEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEankg 280
Cdd:pfam00651   4 LREQGKLCDVTLVVGDGkEFRAHKAVLAACSPYFKALFSGQ-EEESSVSEIELDDVSPEDFEALLEFMYTGELEIS---- 78
                          90       100       110
                  ....*....|....*....|....*....|.
gi 19387277   281 rnaAAMAREVFEAADMYAMERLKLMCASNLC 311
Cdd:pfam00651  79 ---EENVDDLLAAADKLQIPSLVDKCEEFLI 106
BTB_POZ_SPOPL cd18343
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
191-311 3.05e-13

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in speckle-type POZ protein-like (SPOPL); SPOPL, also called HIB homolog 2 or Roadkill homolog 2, is a component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes that mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The complexes may contain homodimeric SPOPL or the heterodimers formed by speckle-type POZ protein (SPOP) and SPOPL, which are less efficient than ubiquitin ligase complexes containing only SPOP. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349652 [Multi-domain]  Cd Length: 123  Bit Score: 65.41  E-value: 3.05e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 191 PSCHARNAMEFLLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYH 270
Cdd:cd18343   4 PECRLAEDLGNLWENSRFTDCSLFVGGQEFKAHKSILAARSPVFNAMFEHEM-EESKKNRVEINDVDPEVFKEMMRFIYT 82
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 19387277 271 DSLPpeankgrNAAAMAREVFEAADMYAMERLKLMCASNLC 311
Cdd:cd18343  83 GKAP-------NLDKMADNLLAAADKYALERLKVMCEEALC 116
BTB2_POZ_ABTB1_BPOZ1 cd18296
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
204-307 3.35e-13

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ankyrin repeat and BTB/POZ domain-containing protein 1 (ABTB1); ABTB1, also called elongation factor 1A-binding protein or bood POZ containing gene type 1 (BPOZ-1), is an anti-proliferative factor that may act as a mediator of the phosphatase and tensin homolog (PTEN) growth-suppressive signaling pathway. It may play a role in developmental processes. ABTB1 contains an ankyrin repeat and two BTB domains. This model corresponds to the second BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349605 [Multi-domain]  Cd Length: 121  Bit Score: 65.39  E-value: 3.35e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 204 SGDAPFDLEIH---------VGDATFGAHRLALAGQSLYFRKLLYGQ----VGNEASSPAIRLREMSPEAFGAVLHYVYH 270
Cdd:cd18296   4 LDELPFPPEQElsfpdvcfqVEGHRFPCHKAFFCGRSDYFKALLRDHfaesEENNGSIPVVTLHDVSPEVFAIVLYYIYT 83
                        90       100       110
                ....*....|....*....|....*....|....*....
gi 19387277 271 DS--LPPEAnkgrnaaamAREVFEAADMYAMERLKLMCA 307
Cdd:cd18296  84 DDtdLPPEN---------AYDVLYVADMYLLPGLKRLCG 113
BTB2_POZ_BTBD8 cd18286
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
203-314 9.57e-13

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 8 (BTBD8); BTBD8 is a BTB-domain-containing Kelch-like protein that may play a role in developmental processes. It may also act as a protein-protein adaptor in a transcription complex and thus be involved in brain development. BTBD8 contains two BTB domains. This model corresponds to the second domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349595 [Multi-domain]  Cd Length: 121  Bit Score: 64.20  E-value: 9.57e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 203 LSGDAPfDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQvGNEASSPAIRLREMSPEAFGAVLHYVYHD--SLPPEANKG 280
Cdd:cd18286  13 LNGEDS-DITIKVDGKTFKAHRCILCARSSYFAAMLSGS-WAESNSSEITLTGVSHAAVSFVLLFIYGGvlDLPDDVNLG 90
                        90       100       110
                ....*....|....*....|....*....|....
gi 19387277 281 rnaaamarEVFEAADMYAMERLKLMCASNLCRFI 314
Cdd:cd18286  91 --------ELLSLADMYGLDGLKDVVAYTLRRDY 116
BTB_POZ_BTBD9 cd18287
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 1.78e-11

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 9 (BTBD9); BTBD9 is a risk factor for Restless Legs Syndrome (RLS) encoding a Cullin-3 substrate adaptor. The BTBD9 gene may be associated with antipsychotic-induced RLS in schizophrenia. Mutations in BTBD9 lead to reduced dopamine, increased locomotion and sleep fragmentation. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349596 [Multi-domain]  Cd Length: 119  Bit Score: 60.33  E-value: 1.78e-11
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18287  24 DVTFVVEEKRFPAHRVILAARSEYFRALLYGGM-RESQQSEIELKDTNAEAFKALLKYIY 82
BTB_POZ_SPOP-like cd18279
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
191-312 4.51e-11

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in speckle-type POZ protein (SPOP) and similar proteins; This family includes speckle-type POZ protein (SPOP), speckle-type POZ protein-like (SPOPL), TD and POZ domain-containing proteins (TDPOZ), Drosophila melanogaster protein roadkill and similar proteins. Both, SPOP and SPOPL, serve as adaptors of cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes that mediate the ubiquitination and proteasomal degradation of target proteins. TDPOZ is a family of bipartite animal and plant proteins that contain a tumor necrosis factor receptor-associated factor (TRAF) domain (TD) and a POZ/BTB domains. TDPOZ proteins may be nuclear scaffold proteins probably involved in transcription regulation in early development and other cellular processes. Drosophila melanogaster protein roadkill, also called Hh-induced MATH and BTB domain-containing protein (HIB), is a hedgehog-induced BTB protein that modulates hedgehog signaling by degrading Ci/Gli transcription factor. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349588 [Multi-domain]  Cd Length: 120  Bit Score: 59.47  E-value: 4.51e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 191 PSCHARNAMEFLLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYH 270
Cdd:cd18279   1 PECRLAEDLGNLWENSRFTDCCLCVGGQEFQAHKAILAARSPVFSAMFEHEM-EESKKNRVEINDVDPEVFKEMMRFIYT 79
                        90       100       110       120
                ....*....|....*....|....*....|....*....|..
gi 19387277 271 DSLPpeankgrNAAAMAREVFEAADMYAMERLKLMCASNLCR 312
Cdd:cd18279  80 GKAP-------NLDKMADDLLAAADKYALERLKVMCEDALCS 114
BTB_POZ_roadkill-like cd18345
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
191-311 9.27e-11

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein roadkill and similar proteins; Drosophila melanogaster protein roadkill, also called Hh-induced MATH and BTB domain-containing protein (HIB), is a hedgehog-induced BTB protein that modulates hedgehog signaling by degrading Ci/Gli transcription factor. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349654 [Multi-domain]  Cd Length: 121  Bit Score: 58.32  E-value: 9.27e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 191 PSCHARNAMEFLLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYh 270
Cdd:cd18345   1 PECRLSDDLGLLFERSAFSDVTLCVGGREFQAHKAILAARSPVFNAMFEHEM-EERKQNRVEITDVDHEVMREMLRFIY- 78
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 19387277 271 dslppeANKGRNAAAMAREVFEAADMYAMERLKLMCASNLC 311
Cdd:cd18345  79 ------TGKAPNLDKMADDLLAAADKYALERLKVMCEEALC 113
BTB_POZ_KLHL27_IPP cd18256
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
203-312 3.23e-10

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in intracisternal A particle-promoted polypeptide (IPP); IPP, also called Kelch-like protein 27 (KLHL27) or actin-binding protein IPP, is an actin-binding protein that may play a role in organizing the actin cytoskeleton. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349565 [Multi-domain]  Cd Length: 125  Bit Score: 57.03  E-value: 3.23e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 203 LSGDAPF-DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGnEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEANKgr 281
Cdd:cd18256  14 LRGQHEFcDVQLQVGMELFSVHRLVLAASSPYFAALFAGGMS-ESSKDVVQIHGVEPDIFHILLDFIYTGVVEVTVSN-- 90
                        90       100       110
                ....*....|....*....|....*....|.
gi 19387277 282 naaamAREVFEAADMYAMERLKLMCASNLCR 312
Cdd:cd18256  91 -----VQELLVAADMLQLTEVVEICCEFLKG 116
BTB_POZ_BTBD19 cd18294
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
198-314 3.00e-09

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 19 (BTBD19); BTBD19 is a BTB domain-containing protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349603 [Multi-domain]  Cd Length: 111  Bit Score: 53.79  E-value: 3.00e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 198 AMEFLLSGDAPFDLEIHVGDA--TFGAHRLALAGQSLYFRKLLYGQVGNEASSPAIRLREMSPEAFGAVLHYVYHDSLPP 275
Cdd:cd18294   4 DMKSLINNPEFSDVKFLVGPErqEIFAHKCILAARCEVFRAMFLTGPQKESTQSPLVLSDIEPEVFRAVLEFIYTNCVTL 83
                        90       100       110
                ....*....|....*....|....*....|....*....
gi 19387277 276 EANkgrnaaaMAREVFEAADMYAMERLKLMCAsnlcRFI 314
Cdd:cd18294  84 SNH-------TVIEVLAAAVEYGLDELRKLCE----RFI 111
BTB_POZ_TDPOZ cd18344
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-319 3.19e-09

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in TD and POZ domain-containing proteins (TDPOZ); TDPOZ is a family of bipartite animal and plant proteins that contains a tumor necrosis factor receptor-associated factor (TRAF) domain (TD) and a POZ/BTB domain. TDPOZ proteins may be nuclear scaffold proteins probably involved in transcription regulation in early development and other cellular processes. This subfamily contains only mammalian members. Plant TDPOZ proteins contain a MATH domain at the N-terminal region and are named "BTB/POZ and MATH domain-containing proteins (BPM)", not included in this subfamily. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349653 [Multi-domain]  Cd Length: 128  Bit Score: 54.19  E-value: 3.19e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSPaIRLREMSPEAFGAVLHYVYHDSLPPeankgRNAAAMARE 289
Cdd:cd18344  25 DCCLLVAGHEFRAHKAILAARSPVFRAMFEHEMEERLKNP-IEIHDLDPQVFKEMMGFIYTGKAPH-----LHSHSMACD 98
                        90       100       110
                ....*....|....*....|....*....|
gi 19387277 290 VFEAADMYAMERLKLMCASNLCRFIGDDTA 319
Cdd:cd18344  99 VLAAADKYGLEGLKVLCEDALCRNLSVENA 128
BTB_POZ_SPOP cd18342
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
191-311 5.28e-09

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in speckle-type POZ protein (SPOP); SPOP, also called HIB homolog 1 or Roadkill homolog 1, is a novel nuclear speckle-type protein which serves as an adaptor of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and proteasomal degradation of target proteins, such as BRMS1, DAXX, PDX1/IPF1, GLI2 and GLI3. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349651 [Multi-domain]  Cd Length: 125  Bit Score: 53.57  E-value: 5.28e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 191 PSCHARNAMEFLLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYh 270
Cdd:cd18342   5 PECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEM-EESKKNRVEINDVEPEVFKEMMCFIY- 82
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 19387277 271 dslppeANKGRNAAAMAREVFEAADMYAMERLKLMCASNLC 311
Cdd:cd18342  83 ------TGKAPNLDKMADDLLAAADKYALERLKVMCEDALC 117
BTB_POZ cd01165
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
213-297 9.40e-09

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain superfamily; Proteins in this superfamily are characterized by the presence of a common protein-protein interaction motif of about 100 amino acids, known as the BTB/POZ domain. Members include transcription factors, oncogenic proteins, ion channel proteins, and potassium channel tetramerization domain (KCTD) proteins. They have been identified in poxviruses and many eukaryotes, and have diverse functions, such as transcriptional regulation, chromatin remodeling, protein degradation and cytoskeletal regulation. Many BTB/POZ proteins contain one or two additional domains, such as kelch repeats, zinc-finger domains, FYVE (Fab1, YOTB, Vac1, and EEA1) fingers, or ankyrin repeats, among others. These special additional domains or interaction partners provide unique characteristics and functions to BTB/POZ proteins. In ion channel proteins and KCTD proteins, the BTB/POZ domain is also called the tetramerization (T1) domain.


Pssm-ID: 349496 [Multi-domain]  Cd Length: 79  Bit Score: 51.51  E-value: 9.40e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 213 IHVGDATFGAHRLALAGQSLYFRKLLYGqvGNEASSPA-IRLREMSPEAFGAVLHYVYHDslppeanKGRNAAAMAREVF 291
Cdd:cd01165   3 LVVEGEKFHVNKELLAQSSEYFRALFRG--GFRESGQAeINLRDISPEDFRALLEFLYGG-------KRDLDASNLLELL 73

                ....*.
gi 19387277 292 EAADMY 297
Cdd:cd01165  74 EAANFL 79
BTB_POZ_trishanku-like cd18314
BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in ...
210-306 2.86e-08

BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in Dictyostelium discoideum trishanku and similar proteins; Trishanku is a novel regulator required for normal morphogenesis and cell-type stability in Dictyostelium discoideum. It contains a BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349623 [Multi-domain]  Cd Length: 96  Bit Score: 50.81  E-value: 2.86e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLppeankgRNAAAMARE 289
Cdd:cd18314   8 DVVLCVGDRKFFAHRIVLCARSPVFRSMLTGSM-IESNLKEVTLEDVEPEIFETVLKYMYTGQV-------TLSEENVLD 79
                        90
                ....*....|....*..
gi 19387277 290 VFEAADMYAMERLKLMC 306
Cdd:cd18314  80 LLMLASKYQVPDLEKLC 96
BTB_POZ_BTBD17 cd18292
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-342 3.40e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 17 (BTBD17); BTBD17, also called galectin-3-binding protein-like, is a BTB domain-containing protein. Its function remains unclear. It may be associated with hepatocellular carcinoma. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349601 [Multi-domain]  Cd Length: 114  Bit Score: 51.13  E-value: 3.40e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSPAIRLREmSPE---AFGAVLHYVYHDSLppeankgrnaaam 286
Cdd:cd18292  19 DIVLRVGGKVFHAHRLILAKSSDVFRVMLSNDWWSESKQSEIELVE-DPEcaaVFEKFLRYLYTGQI------------- 84
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 19387277 287 arevfeaadmyamerlklmcasnlcrFIGDDTASGIMELAKAHSCDPLKKACENYM 342
Cdd:cd18292  85 --------------------------SVNLETALPLLMLADKYNVTDLKQLCVDFM 114
BTB_POZ_ZBTB38_CIBZ cd18223
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-288 5.48e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 38 (ZBTB38); ZBTB38, also termed CIBZ, is a transcriptional regulator with bimodal DNA-binding specificity. It binds with a higher affinity to methylated CpG dinucleotides in the consensus sequence 5'-CGCG-3', as well as E-box elements (5'-CACGTG-3'). It can also bind specifically to a single methyl-CpG pair. ZBTB38 represses transcription in a methyl-CpG-dependent manner. It is a negative regulator of endoplasmic reticulum stress-associated apoptosis. It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349532 [Multi-domain]  Cd Length: 114  Bit Score: 50.56  E-value: 5.48e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQvGNEASSPAIRLREMSPEAFGAVLHYVYHDSLP-PEANKGRNAAAMAR 288
Cdd:cd18223  20 DVTIVVEDTKFKAHKNVLAASSLYFKNAFSSQ-EIWISSHVLELPDLKAEVFAEILNFIYSSKVVvKRQETVTDLVAAGK 98
BTB_POZ_KLHL40_KBTBD5 cd18340
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
202-310 6.09e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 40 (KLHL40); KLHL40, also called Kelch repeat and BTB domain-containing protein 5 (KBTBD5) or sarcosynapsin, is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a key regulator of skeletal muscle development. Mutations in KLHL40 may cause severe autosomal-recessive nemaline myopathy. KLHL40 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349649 [Multi-domain]  Cd Length: 134  Bit Score: 50.60  E-value: 6.09e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 202 LLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLP-PEANkg 280
Cdd:cd18340  21 LLDHNKFVDCVLKIKEKEFPCHRLVLAACSPYFRAMFLSDL-EESKKREIVLEDVDPDVMGKILHYIYTSEIEiTEQN-- 97
                        90       100       110
                ....*....|....*....|....*....|
gi 19387277 281 rnaaamAREVFEAADMYAMERLKLMCASNL 310
Cdd:cd18340  98 ------VQDIFAAANMFQIPSIFTVCVSFL 121
BTB_POZ_KBTBD4 cd18272
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
195-312 1.07e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 4 (KBTBD4); KBTBD4, also called BTB and kelch domain-containing protein 4 (BKLHD4), is a BTB-BACK-Kelch domain protein belonging to a large family of cullin-RING ubiquitin ligase adaptors that facilitate the ubiquitination of target substrates. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349581 [Multi-domain]  Cd Length: 140  Bit Score: 50.28  E-value: 1.07e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 195 ARNAMEFLLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLP 274
Cdd:cd18272  19 AQSIMDLCLEDGLFADVTISVEGKEFQLHRLVLSAQSCFFRSMFTSNL-KEARNRVIELKDVSESVFQLLVDYIYHGTVK 97
                        90       100       110
                ....*....|....*....|....*....|....*...
gi 19387277 275 PEANKgrnaaamAREVFEAADMYAMERLKLMCASNLCR 312
Cdd:cd18272  98 LRVEE-------LQETYEVADMYQLTALFEECSRFLAR 128
BTB2_POZ_RhoBTB cd18300
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
210-306 6.15e-07

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Rho-related BTB domain-containing proteins (RhoBTB); RhoBTB proteins constitute a subfamily of atypical members within the Rho family of small guanosine triphosphatases (GTPases), which is characterized by containing a GTPase domain (in most cases, non-functional) followed by a proline-rich region, a tandem of 2 BTB domains, and a conserved C-terminal region. In humans, the RhoBTB subfamily consists of 3 isoforms: RhoBTB1, RhoBTB2, and RhoBTB3. Orthologs are present in several other eukaryotes, such as Drosophila and Dictyostelium, but have been lost in plants and fungi. This model corresponds to the second BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349609 [Multi-domain]  Cd Length: 108  Bit Score: 47.23  E-value: 6.15e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLPPeankgrNAAAMARE 289
Cdd:cd18300  11 DVTFIVEDGTIPAHKALLVARCDVMAAMFGGNF-RESSAKEVELPGVSKETFLALLEYLYTDQAPI------LEDGDCVG 83
                        90
                ....*....|....*..
gi 19387277 290 VFEAADMYAMERLKLMC 306
Cdd:cd18300  84 LIVLANRLCLPRLVALC 100
BTB_POZ_KLHL40-like cd18269
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
202-310 2.25e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins, KLHL40 and KLHL41; This family includes Kelch-like proteins, KLHL40 and KLHL41. KLHL40 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a key regulator of skeletal muscle development. KLHL41 is a novel kelch related protein that is involved in pseudopod elongation in transformed cells. They both contain a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349578 [Multi-domain]  Cd Length: 133  Bit Score: 46.24  E-value: 2.25e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 202 LLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLP-PEANkg 280
Cdd:cd18269  21 LLDENKFVDCVLKIGDKEFPCHRLVLAACSPYFRAMFLSDL-EESKKKEVVLEDVDPDVMGMILKYLYTSEIDlNDQN-- 97
                        90       100       110
                ....*....|....*....|....*....|
gi 19387277 281 rnaaamAREVFEAADMYAMERLKLMCASNL 310
Cdd:cd18269  98 ------VQDIFALASRFQIPSIFTVCVSYL 121
BTB_POZ_ZBTB19_PATZ1 cd18207
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 2.60e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in POZ-, AT hook-, and zinc finger-containing protein 1 (PATZ1); PATZ1 is also called zinc finger and BTB domain-containing protein 19 (ZBTB19), BTB/POZ domain zinc finger transcription factor, protein kinase A RI subunit alpha-associated protein, zinc finger protein 278, or zinc finger sarcoma gene protein. It is an important transcriptional regulatory factor that regulates divergent pathways depending on the cellular context. For instance, it acts as a transcriptional suppressor that functions in T lymphocytes. It is also a DNA damage-responsive transcription factor that inhibits p53 function. It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349516 [Multi-domain]  Cd Length: 128  Bit Score: 46.11  E-value: 2.60e-06
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18207  29 DVLLRVGEESFPAHRAVLAACSEYFESVFSAQEGDGGTPRELEMHTISSKVFGDILDFAY 88
BTB_POZ_ZBTB21_ZNF295 cd18209
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-273 5.00e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 21 (ZBTB21); ZBTB21, also called zinc finger protein 295 (ZNF295), is a transcription repressor that acts in a selective manner on different promoters. It may be involved in the bi-directional control of gene expression in concert with another transcription factor ZFP161. It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349518 [Multi-domain]  Cd Length: 112  Bit Score: 44.86  E-value: 5.00e-06
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKlLYGQVGNEASSpAIRLREMSPEAFGAVLHYVYHDSL 273
Cdd:cd18209  20 DVLLIVGDQKFRAHKNVLAASSEYFQS-LFTEKENESQS-VFQLDFCEPDAFENVLNYIYSSSL 81
BTB1_POZ_ABTB1_BPOZ1 cd18295
first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
202-273 5.58e-06

first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ankyrin repeat and BTB/POZ domain-containing protein 1 (ABTB1); ABTB1, also called elongation factor 1A-binding protein or bood POZ containing gene type 1 (BPOZ-1), is an anti-proliferative factor that may act as a mediator of the phosphatase and tensin homolog (PTEN) growth-suppressive signaling pathway. It may play a role in developmental processes. ABTB1 contains an ankyrin repeat and two BTB domains. This model corresponds to the first BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349604 [Multi-domain]  Cd Length: 119  Bit Score: 44.93  E-value: 5.58e-06
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 19387277 202 LLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEaSSPAIRLREMSPEAFGAVLHYVYHDSL 273
Cdd:cd18295  13 LLEQGSYSDVTFNVHGESFPAHRCILSARSPYFAEMFETKWKDK-REINLKHPLVNPDAFRALLQYLYTGRL 83
BTB_POZ_KLHL21 cd18250
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
209-310 6.97e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 21 (KLHL21); KLHL21 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for efficient chromosome alignment and cytokinesis. The BCR(KLHL21) E3 ubiquitin ligase complex regulates localization of the chromosomal passenger complex (CPC) from chromosomes to the spindle midzone in anaphase and mediates the ubiquitination of aurora B. KLHL21 also targets IkappaB kinase-beta to regulate nuclear factor kappa-light chain enhancer of activated B cells (NF-kappaB) signaling negatively. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349559 [Multi-domain]  Cd Length: 124  Bit Score: 44.76  E-value: 6.97e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 209 FDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLppeANKGRNAAAMar 288
Cdd:cd18250  22 FDVTLCAGGREFPCHRTVLAAASSYFRAMFAGEL-RESRADRVVLHGVSAEILGLLLDFSYTGRV---TVTQDNVEAL-- 95
                        90       100
                ....*....|....*....|..
gi 19387277 289 evFEAADMYAMERLKLMCASNL 310
Cdd:cd18250  96 --LRAADLFQFPSVKEACCAYL 115
BTB_POZ_ZBTB40 cd18225
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-275 1.07e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 40 (ZBTB40); ZBTB40 may be involved in transcriptional regulation. Single-nucleotide polymorphisms of ZBTB40 are associated with bone mineral density in European and East-Asian populations. ZBTB40 contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349534 [Multi-domain]  Cd Length: 116  Bit Score: 44.05  E-value: 1.07e-05
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGqvgneASSPAIRLREMSPEAFGAVLHYVYHDSLPP 275
Cdd:cd18225  25 DCTIFIGTFHFRAHKLVLAASSLLFKSLLDS-----TDTISIDASVVSPEEFALLLEMVYTGKLPP 85
BTB1_POZ_IBtk cd18301
first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
205-272 1.21e-05

first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in inhibitor of Bruton tyrosine kinase (IBtk); IBtk is an inhibitor or negative regulator of Bruton tyrosine kinase (Btk), which is required for B-cell differentiation and development. IBtk binds to the PH domain of Btk and down-regulates the Btk kinase activity. It contains two BTB domains. This model corresponds to the first BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349610 [Multi-domain]  Cd Length: 99  Bit Score: 43.43  E-value: 1.21e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 19387277 205 GDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASS---PAIRLREMSPEAFGAVLHYVYHDS 272
Cdd:cd18301  15 GDNIHDVVFQVGGKTFPAHKFILASRSDYFRKLFLSSLLTSEDAvgcDVVHIEKVPPEIFEQLLQFIYTDT 85
BTB_POZ_ZBTB7C_ZBTB36 cd18328
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-316 1.96e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 7C (ZBTB7C); ZBTB7C is also called affected by papillomavirus DNA integration in ME180 cells protein 1 (APM-1), zinc finger and BTB domain-containing protein 36 (ZBTB36), zinc finger protein 857C (ZNF857C), or kidney cancer-related POZ domain and Kruppel-like protein (Kr-POK). It is a transcriptional repressor with a pro-oncogenic role that relies upon binding to p53 and inhibition of its transactivation function. It may act as an important regulator of fatty acid synthesis and may induce rapid cancer cell proliferation by increasing palmitate synthesis. The ZBTB7C gene has been identified as a susceptibility gene to ischemic injury. ZBTB7C contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349637 [Multi-domain]  Cd Length: 120  Bit Score: 43.33  E-value: 1.96e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLygQVGNEASSPAI-RLREMSPEAFGAVLHYVYHDSLPPEANKgrnaaamAR 288
Cdd:cd18328  27 DVVLIVQDQEYRTHRSVLAACSKYFKKLF--TAGTLADQPYVyEIDFVTPEALSAILEFAYTSTLTITTSN-------VK 97
                        90       100
                ....*....|....*....|....*...
gi 19387277 289 EVFEAADMyamerLKLMCASNLCRFIGD 316
Cdd:cd18328  98 HILNAAQM-----LEIQCIINVCLEIMD 120
BTB_POZ_KLHL8 cd18238
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 2.02e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 8 (KLHL8); KLHL8 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex required for the ubiquitination and degradation of rapsyn, a postsynaptic protein required for clustering of nicotinic acetylcholine receptors (nAChRs) at the neuromuscular junction. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349547 [Multi-domain]  Cd Length: 120  Bit Score: 43.05  E-value: 2.02e-05
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGnEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18238  17 DVTLKVGEKSIHCHRLVLACVSPYFRAMFTSEMA-ESKQDSITIKDIDEEAVELLVDFAY 75
BTB_POZ_ABTB2-like cd18297
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-313 2.05e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) and similar proteins; This family includes ABTB2, BTBD11, plant ARM repeat protein interacting with ABF2 (ARIA), and similar proteins. ABTB2, also called bood POZ containing gene type 2 (BPOZ-2), is a scaffold protein that controls the degradation of many biological proteins ranging from embryonic development to tumor progression. It may be involved in the initiation of hepatocyte growth. ABTB2 functions as an adaptor protein for the E3 ubiquitin ligase scaffold protein Cullin-3. It directly binds to eukaryotic elongation factor 1A1 (eEF1A1) to promote eEF1A1 ubiquitylation and degradation, and prevent translation. The BTBD11 gene has been recently identified as an all-trans retinoic acid (atRA)-responsive gene that lies downstream of atRA and its receptors in the regulation of neurite outgrowth and cell adhesion in neural as well as non-neural tissues. ARIA is an armadillo (ARM) repeat and BTB domain-containing protein that acts as a positive regulator of ABA response via the modulation of the transcriptional activity of ABF2. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349606 [Multi-domain]  Cd Length: 117  Bit Score: 43.03  E-value: 2.05e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQvGNEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEANKGRNaaamARE 289
Cdd:cd18297  14 DVTFLVEGRPFYAHKIVLVTASDRFKSMLSSG-STEAQTPVIEIPDIRYDIFQLMMQYLYTGGVESLDVAQDD----ALE 88
                        90       100
                ....*....|....*....|....
gi 19387277 290 VFEAADMYAMERLKLMCaSNLCRF 313
Cdd:cd18297  89 LLRAASFFQLDGLKRHC-EILLSQ 111
BTB_POZ_KLHL10 cd18240
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-316 3.05e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 10 (KLHL10); KLHL10 is a substrate-specific adaptor of a CUL3-based E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins specifically in the testis during spermatogenesis. Haploinsufficiency of Klhl10 causes infertility in male mice. KLHL10 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349549 [Multi-domain]  Cd Length: 120  Bit Score: 42.70  E-value: 3.05e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSpAIRLREMSPEAFGAVLHYVYHDSLP-PEANkgrnaaamAR 288
Cdd:cd18240  19 DVVIRVNGVEFPAHRNILCACSPYFRALFTNGWNETEKK-VYKIPGVSPEMMELIIEYAYTRTVPiTAEN--------VE 89
                        90       100
                ....*....|....*....|....*...
gi 19387277 289 EVFEAADMYAMERLKLMCasnlCRFIGD 316
Cdd:cd18240  90 ELLPAADQFNIMGIVKAC----CDFLED 113
BTB_POZ_KLHL15 cd18244
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
209-319 3.69e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 15 (KLHL15); KLHL15 is a substrate-specific adaptor for the Cullin3 E3 ubiquitin-protein ligase complex that targets the serine/threonine-protein phosphatase 2A (PP2A) subunit PPP2R5B for ubiquitination and subsequent proteasomal degradation, thus promoting exchange with other regulatory subunits. It also plays a key role in DNA damage response, favoring DNA double-strand repair through error-prone non-homologous end joining (NHEJ) over error-free, RBBP8-mediated homologous recombination (HR), by targeting the DNA-end resection factor RBBP8/CtIP for ubiquitination and subsequent proteasomal degradation. KLHL15 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349553 [Multi-domain]  Cd Length: 137  Bit Score: 43.02  E-value: 3.69e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 209 FDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLppeankgRNAAAMAR 288
Cdd:cd18244  31 LDVTLVIEDHQFQAHKALLATQSDYFRIMFTADM-RERDQDKIHLKGLTATGFSHVLQFMYYGTI-------ELSMLTVH 102
                        90       100       110
                ....*....|....*....|....*....|...
gi 19387277 289 EVFEAAdMYA--MERLKLMCASNLCRFIGDDTA 319
Cdd:cd18244 103 EILQAA-MYVqlTEVVKFCCSFLLAKICLDNCA 134
MATH_SPOP cd03774
Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to ...
33-169 5.35e-05

Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP. SPOP was isolated as a novel antigen recognized by serum from a scleroderma patient, whose overexpression in COS cells results in a discrete speckled pattern in the nuclei. It contains an N-terminal MATH domain and a C-terminal BTB (also called POZ) domain. Together with Cul3, SPOP constitutes an ubiquitin E3 ligase which is able to ubiquitinate the PcG protein BMI1, the variant histone macroH2A1 and the death domain-associated protein Daxx. Therefore, SPOP may be involved in the regulation of these proteins and may play a role in transcriptional regulation, apoptosis and X-chromosome inactivation. Cul3 binds to the BTB domain of SPOP whereas Daxx and the macroH2A1 nonhistone region have been shown to bind to the MATH domain. Both MATH and BTB domains are necessary for the nuclear speckled accumulation of SPOP. There are many proteins, mostly uncharacterized, containing both MATH and BTB domains from C. elegans and plants which are excluded from this family.


Pssm-ID: 239743  Cd Length: 139  Bit Score: 42.53  E-value: 5.35e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277  33 HQFTIRQYSGVKGkGVGNSVLSRNFTVAGRE---WFVRFYPDGYNSDTSDHVAFFLQSLyrpSCG-SVYHVEFSFALLGG 108
Cdd:cd03774   7 YMWTISNFSFCRE-EMGEVIKSSTFSSGANDklkWCLRVNPKGLDEESKDYLSLYLLLV---SCPkSEVRAKFKFSILNA 82
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 19387277 109 GGGGGAVLhdvRIDRPCRFdNRNNSWGIRKYIAREQLEGAALGAIHDDALTVRCTMHVIQR 169
Cdd:cd03774  83 KGEETKAM---ESQRAYRF-VQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQD 139
BTB_POZ_KLHL11 cd18241
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
220-310 9.32e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 11 (KLHL11); KLHL11 is a component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, leading most often to their proteasomal degradation. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349550 [Multi-domain]  Cd Length: 135  Bit Score: 41.77  E-value: 9.32e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 220 FGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMS------PEAFGAVLHYVYHDSLppeankgRNAAAMAREVFEA 293
Cdd:cd18241  38 FRAHRSVLAAATEYFTPLLSGQF-SESRSGRVEMRKWSsepgpdPDTVEAVIQYMYTGRI-------RVSTGNVHEVLEL 109
                        90
                ....*....|....*..
gi 19387277 294 ADMYAMERLKLMCASNL 310
Cdd:cd18241 110 ADRFLLIRLKEFCGEFL 126
BTB_POZ_KLHL1-like cd18234
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 9.62e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins KLHL1, KLHL4 and KLHL5; This family contains the Kelch-like proteins: KLHL1, KLHL4 and KLHL5, all of which share high identity and similarity with the Drosophila kelch protein, a component of ring canals. KLHL1 is a neuronal actin-binding protein that modulates voltage-gated CaV2.1 (P/Q-type) and CaV3.2 (alpha1H T-type) calcium channels. Family members contain a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349543 [Multi-domain]  Cd Length: 105  Bit Score: 40.81  E-value: 9.62e-05
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGnEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18234   3 DVILIAGDRRIPAHRLVLSAVSDYFAAMFTNDVR-EATEEEIKLKDVDPDALWTLVQYCY 61
BTB_POZ_BTBD14A_NAC2 cd18289
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-279 1.10e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in nucleus accumbens-associated protein 2 (NAC-2); NAC-2, also called BTB/POZ domain-containing protein 14A (BTBD14A) or repressor with BTB domain and BEN domain (RBB), is a novel transcription repressor through its association with the NuRD complex. It recruits the NuRD complex to the promoter of MDM2, leading to the repression of MDM2 transcription and subsequent stability of p53/TP53. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349598 [Multi-domain]  Cd Length: 131  Bit Score: 41.55  E-value: 1.10e-04
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSPAirlrEMSPEAFGAVLHYVYHDSLPPEANK 279
Cdd:cd18289  31 DVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPA----TVPPACFQQILSFCYTGKLTMAASE 96
BTB_POZ_ZBTB7B_ZBTB15 cd18327
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-314 1.16e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 7B (ZBTB7B); ZBTB7B is also called Krueppel-related zinc finger protein cKrox, T-helper-inducing POZ/Krueppel-like factor, zinc finger and BTB domain-containing protein 15 (ZBTB15), zinc finger protein 67 (ZNF67), Zfp67, zinc finger protein 857B (ZNF857B), or zinc finger protein Th-POK. It is a transcriptional regulator of extracellular matrix gene expression. It plays widespread and critical roles in T-cell development, particularly as the master regulator of CD4 commitment. It also plays a role as a potent driver of brown fat development and thermogenesis, as well as cold-induced beige fat formation. ZBTB7B contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349636 [Multi-domain]  Cd Length: 127  Bit Score: 41.37  E-value: 1.16e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSPA------IRLREMSPEAFGAVLHYVYHDSLPpeankgrNA 283
Cdd:cd18327  27 DLTIKTRGLEYRTHRAVLAACSLYFRKLFTGGGGGSGDLGAgggqdvCELDFVGPEALGALLEFAYTATLT-------IS 99
                        90       100       110
                ....*....|....*....|....*....|.
gi 19387277 284 AAMAREVFEAADMyamerLKLMCASNLCRFI 314
Cdd:cd18327 100 SSNMREVLRAARL-----LEIPCVADACADI 125
BTB_POZ_NPR_plant cd18310
BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in ...
202-269 1.20e-04

BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in plant regulatory proteins, NPR1-4, and similar proteins; NPR1 and NPR2 are essential for pathogenicity and the utilization of many nitrogen sources. NPR1 is also called nitrogen pathogenicity regulation protein NPR1, non-inducible immunity protein 1 (Nim1), nonexpresser of PR genes 1, or salicylic acid insensitive 1 (Sai1). It acts as a transcription coactivator that plays dual roles in regulating plant immunity. NPR3 and NPR4 are involved in negative regulation of defense responses against pathogens in plant. NPR proteins contain a BTB domain, DUF3420, ankyrin (ANK) repeats, and a conserved C-terminal domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349619 [Multi-domain]  Cd Length: 145  Bit Score: 41.52  E-value: 1.20e-04
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 19387277 202 LLSGDAPF-DLEIHVGDA-TFGAHRLALAGQSLYFRKLLYG-QVGNEASSPAIRLREMSP------EAFGAVLHYVY 269
Cdd:cd18310  11 LDSPDLFYsDAEIIVEGGrPVPVHRCILAARSPFFRDIFASaKAEGANTKPKLELRELIPggivgyDAFMLVLSYLY 87
BTB2_POZ_IBtk cd18302
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
220-310 1.25e-04

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in inhibitor of Bruton tyrosine kinase (IBtk); IBtk is an inhibitor or negative regulator of Bruton tyrosine kinase (Btk), which is required for B-cell differentiation and development. IBtk binds to the PH domain of Btk and down-regulates the Btk kinase activity. It contains two BTB domains. This model corresponds to the second BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349611 [Multi-domain]  Cd Length: 113  Bit Score: 40.81  E-value: 1.25e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 220 FGAHRLALAGQSLYFRKLLYGQVGNEASSPAIRLrEMSPEAFGAVLHYVYHDSLPPeANKGRNAAAMArEVFEAADMYAM 299
Cdd:cd18302  18 FPCHKCVLVARLEYFHSMLSSSWIEASSCSALTM-PIPSDILEIILDYLYTDEASA-VKESQNVEFLC-NVLVIADQLLI 94
                        90
                ....*....|.
gi 19387277 300 ERLKLMCASNL 310
Cdd:cd18302  95 TRLKEICEVAL 105
BTB_POZ_KLHL35 cd18265
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
192-310 1.47e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 35 (KLHL35); KLHL35 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. Significant differences in DNA methylation of the KLHL35 gene in abdominal aortic aneurysm (AAA) patients compared to non-AAA controls suggest a potential role in AAA pathology. Hypermethylation of the KLHL35 gene has also been associated with the development of hepatocellular carcinoma. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349574 [Multi-domain]  Cd Length: 128  Bit Score: 40.91  E-value: 1.47e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 192 SCHARNAMEFL----LSGDAPfDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHY 267
Cdd:cd18265   4 PCHAERILQVLnayrRSGTFT-DVVLLVDGKDFPCHRATLSANSAYFRAMFGGHL-KESRQAVVEIQKVSAAAMEVLLDY 81
                        90       100       110       120
                ....*....|....*....|....*....|....*....|...
gi 19387277 268 VYHDSLPPEANkgrNAAAmareVFEAADMYAMERLKLMCASNL 310
Cdd:cd18265  82 MYGGGLRIQED---NVES----VLEASDLLQVSKLREACVRFL 117
BTB_POZ_Rank-5 cd18303
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-310 1.52e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in rabankyrin-5 (Rank-5); Rank-5, also called ankyrin repeat and FYVE domain-containing protein 1 (ANKFY1) or ankyrin repeats hooked to a zinc finger motif (ANKHZN), is a Rab5 effector that regulates and coordinates different endocytic mechanisms. It contains an N-terminal BTB domain, followed by a BACK domain, several ankyrin (ANK) repeats and a C-terminal FYVE domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349612 [Multi-domain]  Cd Length: 120  Bit Score: 40.77  E-value: 1.52e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRkllygqVGNEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEANKGrnaaaMARE 289
Cdd:cd18303  20 DITIKLADKSIPAHKFVLAARSEKWS------NENLASTNELDLSDISYEVVLALLRWLYTDELDLTLDDE-----FLLE 88
                        90       100
                ....*....|....*....|.
gi 19387277 290 VFEAADMYAMERLKLMCASNL 310
Cdd:cd18303  89 LMKAAKRFQLTDLVERCERAL 109
BTB_POZ_ZBTB32_FAZF_TZFP cd18218
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-310 1.54e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 32 (ZBTB32); ZBTB32 is also called FANCC-interacting protein, fanconi anemia zinc finger protein (FAZF), testis zinc finger protein (TZFP), or zinc finger protein 538 (ZNF538). It is a DNA-binding transcription factor that binds to the 5'-TGTACAGTGT-3' core sequence. It acts as a transcription suppressor that controls T cell-mediated autoimmunity. ZBTB32 is essential for down-regulation of GATA3 via ZPO2; this promotes aggressive breast cancer development. It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349527 [Multi-domain]  Cd Length: 110  Bit Score: 40.31  E-value: 1.54e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSpairLREMSPEAFGAVLHYVYHDS--LPPEAnkgrnaaamA 287
Cdd:cd18218  20 DTLITVGSQEFPAHSLVLAGASQQLGRQLTNPNPGQWCL----GEGISPSTFKQLLDFVYGESveVQPGE---------L 86
                        90       100
                ....*....|....*....|...
gi 19387277 288 REVFEAADMYAMERLKLMCASNL 310
Cdd:cd18218  87 RPLLEAARALEVESLEEACWRAL 109
BTB_POZ_KLHL4 cd18336
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
199-269 1.75e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 4 (KLHL4); KLHL4 shares high identity and similarity with the Drosophila kelch protein, a component of ring canals. It may be associated with X-linked cleft palate (CPX) and is also a candidate gene in the impairment of mullerian duct development. In addition, it has been identified as a target of insulin-like growth factor binding protein 5 (IGFBP5). KLHL4 contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349645 [Multi-domain]  Cd Length: 126  Bit Score: 40.80  E-value: 1.75e-04
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 19387277 199 MEFLLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18336  10 MENYLQHKQLCDVLLIAGNLKIPAHRLVLSAVSDYFAAMFTNDV-REAKQEEIKMEGVDPDALKALVHYAY 79
BTB_POZ_BAB-like cd18315
BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in ...
208-269 2.12e-04

BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster proteins bric-a-brac 1 (BAB1), bric-a-brac 2 (BAB2), modifier of mdg4 (doom), and similar proteins; BAB1 and BAB2 probably act as transcriptional regulators that are required for specification of the tarsal segment and are involved in antenna development. Doom is a product of the Drosophila mod(mdg4) gene. It induces apoptosis and binds to baculovirus inhibitor-of-apoptosis proteins. This subfamily also includes Drosophila melanogaster sex determination protein fruitless (FRU), protein jim lovell (LOV), zinc finger protein chinmo, transcription factor GAGA, transcription factor Ken, and longitudinals lacking proteins (LOLA). FRU probably acts as a transcriptional regulator that plays a role in male courtship behavior and sexual orientation, and enhances male-specific expression of takeout in brain-associated fat body. LOV, also called tyrosine kinase-related (TKR), has a regulatory role during midline cell development. Chinmo is a functional effector of the JAK/STAT pathway that regulates eye development, tumor formation, and stem cell self-renewal in Drosophila. GAGA is a transcriptional activator that functions by regulating chromatin structure. Ken, also termed protein Ken and Barbie, is a transcription factor required for Terminalia development. LOLA proteins are putative transcription factors required for axon growth and guidance in the central and peripheral nervous systems. Proteins in this subfamily contain a BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349624 [Multi-domain]  Cd Length: 85  Bit Score: 39.46  E-value: 2.12e-04
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 19387277 208 PFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEasSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18315   1 LVDVTLACEGGSLKAHKLVLAAASPYFAALLKETPPDE--HPVIILPDVPYSELKALLDFIY 60
BTB_POZ_ZBTB7 cd18198
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-311 2.47e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 7 (ZBTB7); There are three ZBTB7 isoforms: ZBTB7A, ZBTB7B, and ZBTB7C. ZBTB7A is a transcription repressor of key glycolytic genes, including GLUT3, PFKP, and PKM, and its downregulation in human cancer contributes to tumor metabolism. ZBTB7B is a transcriptional regulator of extracellular matrix gene expression. ZBTB7C is a transcriptional repressor with a pro-oncogenic role that relies upon binding to p53 and inhibition of its transactivation function. ZBTB7 isoforms contain a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349507 [Multi-domain]  Cd Length: 120  Bit Score: 40.23  E-value: 2.47e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLygQVGNEASSPAI-RLREMSPEAFGAVLHYVYHDSLPpeankgrNAAAMAR 288
Cdd:cd18198  27 DVVILVQGREYRTHRSVLAACSQYFKKLF--TSGAVVDQQNVyEIDFVSPEALTALLEFAYTATLT-------VSTANVG 97
                        90       100
                ....*....|....*....|...
gi 19387277 289 EVFEAADMyamerLKLMCASNLC 311
Cdd:cd18198  98 DILSAARL-----LEIPCVSHVC 115
BTB2_POZ_LZTR1 cd18309
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
201-310 3.24e-04

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in leucine-zipper-like transcriptional regulator 1 (LZTR-1); LZTR-1 is a golgi BTB-kelch protein that is degraded upon induction of apoptosis. It may also function as a transcriptional regulator that plays a crucial role in embryogenesis. Germline loss-of-function mutations in LZTR-1 predispose to an inherited disorder of multiple schwannomas. LZTR-1 contains two BTB domains. This model corresponds to the second domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349618 [Multi-domain]  Cd Length: 126  Bit Score: 40.06  E-value: 3.24e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 201 FLLSGDAPF-DLEIHVGDATFGAHRLALAGQSLYFRKLlYGQVGNEASSPAIRLREMSP--EAFGAVLHYVYHD--SLPP 275
Cdd:cd18309  12 FLESVGGDFcDITLLLDGHPIPAHKAILAARCSYFEAM-FRSFMPEDNTVNISIGEMVPsrQAFDSLLRYIYYGdvTMPP 90
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 19387277 276 EAnkgrnaaamAREVFEAADMY--AMERLKLMCASNL 310
Cdd:cd18309  91 ED---------SLYLFSAPYFYgfTNNRLQAYCKQNL 118
BTB_POZ_ARIA_plant cd18352
BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in ...
210-311 3.34e-04

BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in plant ARM repeat protein interacting with ABF2 (ARIA) and similar proteins; ARIA is an armadillo (ARM) repeat and BTB domain-containing protein that acts as a positive regulator of ABA response via the modulation of the transcriptional activity of ABF2, a transcription factor which controls ABA-dependent gene expression via the G-box-type ABA-responsive elements. ARIA is a novel abscisic acid signaling component. It negatively regulates seed germination and young seedling growth. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349661 [Multi-domain]  Cd Length: 116  Bit Score: 39.77  E-value: 3.34e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLppeankgRNAAAMARE 289
Cdd:cd18352  15 DVTFLVEGRRFYAHRIALLASSDAFRAMFDGGY-REKEARDIEIPNIRWEVFELMMRFIYTGSV-------DITNDIAKD 86
                        90       100
                ....*....|....*....|....*.
gi 19387277 290 VFEAADMYAMERLKLMC----ASNLC 311
Cdd:cd18352  87 LLRAADQYLLEGLKRLCeytiAQDLT 112
BTB_POZ_KLHL37_ENC1 cd18267
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-310 4.10e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ectoderm-neural cortex protein 1 (ENC-1); ENC-1 is also called Kelch-like protein 37 (KLHL37), nuclear matrix protein NRP/B, or p53-induced gene 10 protein. It is an actin-binding nuclear matrix protein that associates with p110(RB), and is involved in the regulation of neuronal process formation and in differentiation of neural crest cells. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349576 [Multi-domain]  Cd Length: 147  Bit Score: 39.97  E-value: 4.10e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSPAIRLREMSPEAFGAVLHYVYHDS-LPPEANkgrnaaamAR 288
Cdd:cd18267  42 DVLLHAGNRSFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFHDSIHPEVLELLLDYAYSSRvIINEEN--------AE 113
                        90       100
                ....*....|....*....|..
gi 19387277 289 EVFEAADMYAMERLKLMCASNL 310
Cdd:cd18267 114 SLLEAGDMLEFQDIRDACAEFL 135
BTB_POZ_RCBTB2_CHC1L cd18354
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-317 4.50e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in RCC1 and BTB domain-containing protein 2 (RCBTB2); RCBTB2 is also called chromosome condensation 1-like (CHC1-L), RCC1-like G exchanging factor, or regulator of chromosome condensation and BTB domain-containing protein 2. It is a chromosome condensation regulator-like guanine nucleotide exchange factor (GEF) protein for the Ras-related GTPase Ran. It contains an RCC1 repeat, a BTB domain, and a BACK domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349663 [Multi-domain]  Cd Length: 117  Bit Score: 39.15  E-value: 4.50e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLygqvgNEASSPAIRLREMSPEAFGAVLHYVYHDS--LPPEANKGrnaaama 287
Cdd:cd18354  22 DLKFLVDGKYIYVHKVLLKIRCEHFRSLL-----NENEEEIIEMSQFSYPVYRAFLEYLYTDSisLSPEDAIG------- 89
                        90       100       110
                ....*....|....*....|....*....|
gi 19387277 288 reVFEAADMYAMERLKLMCASNLCRFIGDD 317
Cdd:cd18354  90 --LLDLATFYRENRLKKLCQQTIKQGICEE 117
BTB_POZ_ZBTB8A_BOZF1 cd18329
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-274 4.69e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 8A (ZBTB8A); ZBTB8A, also called BTB/POZ and zinc-finger domain-containing factor or BTB/POZ and zinc-finger domains factor on chromosome 1 (BOZ-F1), is a novel proto-oncoprotein that stimulates cell proliferation. It binds to all the proximal GC boxes to repress transcription, and it inhibits p53 acetylation without affecting p53 stability. It may be involved in gastric adenocarcinoma cell differentiation, cancer invasion, and metastasis. ZBTB8A contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349638 [Multi-domain]  Cd Length: 116  Bit Score: 39.04  E-value: 4.69e-04
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLyGQVGNEASSPAIRLREM-SPEAFGAVLHYVYHDSLP 274
Cdd:cd18329  23 DCSILVEGQVFKAHRNVLFASSGYFKMLL-SQNAKETGQPTVATFDVfSPDTFTIILDFVYSGKLS 87
BTB_POZ_KLHL2-like cd18235
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 5.11e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins, KLHL2 and KLHL3; The family includes Kelch-like proteins, KLHL2 and KLHL3. KLHL2 is a novel actin-binding protein predominantly expressed in brain. It plays a role in the reorganization of the actin cytoskeleton, and promotes growth of cell projections in oligodendrocyte precursors. KLHL2 and KLHL3 each functions as a component of an E3 ubiquitin ligase complex that mediates the ubiquitination of target proteins. They contain a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349544 [Multi-domain]  Cd Length: 121  Bit Score: 39.33  E-value: 5.11e-04
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18235  23 DVILVADGVEIPAHRVVLASCSPYFHAMFTGDL-SESRANRVTLQDVDGKALLLLIDYVY 81
BTB_POZ_KLHL2_Mayven cd18338
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
194-269 5.56e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 2 (KLHL2); KLHL2, also called actin-binding protein Mayven, is a novel actin-binding protein predominantly expressed in the brain. It plays a role in the reorganization of the actin cytoskeleton, and promotes growth of cell projections in oligodendrocyte precursors. KLHL2 is a component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, such as NPTXR, leading most often to their proteasomal degradation. It contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349647 [Multi-domain]  Cd Length: 121  Bit Score: 39.28  E-value: 5.56e-04
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 19387277 194 HARNA---MEFLLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18338   4 HMKKAfkvMNELRSQNLLCDVTIVAEDVEIAAHRVVLAACSPYFHAMFTGEM-SESRAKRVRIKEVDGWTLKMLIDYVY 81
BTB_POZ_ARMC5 cd18191
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
205-269 5.69e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in armadillo repeat-containing protein 5 (ARMC5); ARMC5 plays a role in steroidogenesis, and modulates the expression and cortisol production of steroidogenic enzymes. It negatively regulates adrenal cells survival. It contains armadillo (ARM) repeats and a BTB domain, which is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349500 [Multi-domain]  Cd Length: 100  Bit Score: 38.64  E-value: 5.69e-04
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 19387277 205 GDAPFDLEihvGDATFGAHRLALAGQSLYFRKLLYGQVGnEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18191   2 HDLRFLLD---GGTQLPASRAALTGASEVFRAMLEGGFA-EAQQDLVPLRQVPSGAFLPVLHYLH 62
BTB_POZ_NS1BP cd18306
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-310 5.76e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Influenza virus NS1A-binding protein (NS1-BP); NS1-BP is also called NS1-binding protein, aryl hydrocarbon receptor-associated protein 3 (ARA3), or IVNS1ABP. It is a novel protein that interacts with the influenza A virus nonstructural NS1 protein, which is relocalized in the nuclei of infected cells. It plays a role in cell division and in the dynamic organization of the actin skeleton as a stabilizer of actin filaments by association with F-actin through its kelch repeats. It also interacts with alpha-enolase/MBP-1 and is involved in c-Myc gene transcriptional control. NS1-BP contains BTB and BACK domains at the N-terminal region and kelch repeats at the C-terminal region. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349615 [Multi-domain]  Cd Length: 124  Bit Score: 39.17  E-value: 5.76e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLlYGQVGNEASSPAIRLREMSPEAFGAVLHYVYHDSLppEANKGRnaaamARE 289
Cdd:cd18306  20 DVILQVGGHEIPAHRAVLACASPYLFEL-FSSDSDGESILTVKLDGLDPDAVEVLVNYAYTSRL--EVPADL-----VKS 91
                        90       100
                ....*....|....*....|.
gi 19387277 290 VFEAADMYAMERLKLMCASNL 310
Cdd:cd18306  92 VYSAAKKLKMDRVKKACGDFL 112
BTB_POZ_KLHL7 cd18237
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-310 7.00e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 7 (KLHL7); KLHL7 is a component of a Cul3-based E3 ubiquitin ligase complex and is involved in the ubiquitination of target proteins for proteasome-mediated degradation. Mutations in KLHL7 causes autosomal-dominant retinitis pigmentosa. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349546 [Multi-domain]  Cd Length: 126  Bit Score: 39.01  E-value: 7.00e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEANKgrnaaamARE 289
Cdd:cd18237  23 DVILIVEGREIKAHRVVLAAASHFFHLMFTSNM-TESKSSEVELKDAEPDIIELLVEFAYTARISVNSNN-------VQS 94
                        90       100
                ....*....|....*....|.
gi 19387277 290 VFEAADMYAMERLKLMCASNL 310
Cdd:cd18237  95 LLDAANQYQIEPVKKMCVDFL 115
BTB_POZ_KLHL16_gigaxonin cd18245
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-314 7.05e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in gigaxonin; Gigaxonin, also called Kelch-like protein 16 (KLHL16), may be a cytoskeletal component that directly or indirectly plays an important role in neurofilament architecture. It may also act as a substrate-specific adaptor of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including tubulin folding cofactor B (TBCB), microtubule-associated protein MAP1B, and glial fibrillary acidic protein (GFAP). Gigaxonin is mutated in giant axonal neuropathy. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349554 [Multi-domain]  Cd Length: 111  Bit Score: 38.47  E-value: 7.05e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLL-YGQVGNEASSPAIRLREMSPEAFGAVLHYVYHD--SLPPEANKGrnaaam 286
Cdd:cd18245  16 DATLVVGGEEIPVQKNVLAAASPYFRAKLnYNPPKDDGSTYKIELEGISVEVMEEILDYIYTGqiKLSEDNIQD------ 89
                        90       100
                ....*....|....*....|....*...
gi 19387277 287 areVFEAADMYAMERLKLMCasnlCRFI 314
Cdd:cd18245  90 ---IVQAADLLLMTDLKDLC----CEFL 110
BTB_POZ_KLHL18 cd18247
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 8.54e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 18 (KLHL18); KLHL18 acts as a substrate-specific adaptor for a Cullin3 E3 ubiquitin-protein ligase complex that regulates mitotic entry and ubiquitylates Aurora-A. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349556 [Multi-domain]  Cd Length: 116  Bit Score: 38.42  E-value: 8.54e-04
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGnEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18247  21 DVTLKVGDQKFSAHRIVLAATIPYFHAMFTHDMV-ESKQDEITMQGIEPSALEALINFAY 79
BTB_POZ_KBTBD3_BKLHD3 cd18271
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
209-269 8.66e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 3 (KBTBD3); KBTBD3, also called BTB and kelch domain-containing protein 3 (BKLHD3), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349580 [Multi-domain]  Cd Length: 130  Bit Score: 38.66  E-value: 8.66e-04
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 19387277 209 FDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18271  25 FDFNIIVKDETIPCHRCVLAACSDFFRAMFEVNM-KERDDGSVTISNLSPKAVKAFLDYAY 84
BTB_POZ_ZBTB2 cd18193
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-276 9.24e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 2 (ZBTB2); ZBTB2 is a POZ domain Kruppel-like zinc finger (POK) family transcription factor acting as a potent repressor of the ARF-HDM2-p53-p21 pathway, which is important in cell cycle regulation. It represses transcription of the ARF, p53, and p21 genes, but activates the HDM2 gene. ZBTB2 contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349502 [Multi-domain]  Cd Length: 115  Bit Score: 38.43  E-value: 9.24e-04
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQvgneaSSPAIRLR--EMSPEAFGAVLHYVYHDSLPPE 276
Cdd:cd18193  23 DCTVAIGDVYFKAHKSVLASFSNYFKMLFVHQ-----TSECVRLKptDIQPDIFSYLLHLMYTGKMAPQ 86
BTB_POZ_KLHL41_KBTBD10 cd18341
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
202-312 9.63e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 41 (KLHL41); KLHL41 is also called Kel-like protein 23, Kelch repeat and BTB domain-containing protein 10 (KBTBD10), Kelch-related protein 1 (Krp1), or sarcosine. It is a novel kelch-related protein that is involved in pseudopod elongation in transformed cells. It is also involved in skeletal muscle development and differentiation. It regulates proliferation and differentiation of myoblasts and plays a role in myofibril assembly by promoting lateral fusion of adjacent thin fibrils into mature, wide myofibrils. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349650 [Multi-domain]  Cd Length: 133  Bit Score: 38.67  E-value: 9.63e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 202 LLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLppEANKGR 281
Cdd:cd18341  21 LLDENKFVDCTLKAGDKSLPCHRLILAACSPYFREYFLSEE-SEEKKKEVVLDNVDPNIMDMILKYLYSAEI--DLNDGN 97
                        90       100       110
                ....*....|....*....|....*....|.
gi 19387277 282 naaamAREVFEAADMYAMERLKLMCASNLCR 312
Cdd:cd18341  98 -----VQDIFALASRFQIPSVFTVCVTYLQK 123
BTB1_POZ_BTBD7 cd18283
first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
210-276 1.13e-03

first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 7 (BTBD7); BTBD7 is a crucial regulator that is essential for region-specific epithelial cell dynamics and branching morphogenesis. It has been implicated in various cancers. BTBD7 contains two BTB domains. This model corresponds to the first domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349592 [Multi-domain]  Cd Length: 92  Bit Score: 37.70  E-value: 1.13e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSPA-IRLREMSPEAFGAVLHYVYHDSLPPE 276
Cdd:cd18283   4 DVDLVFQGTCFPVHRAILSARCPFFRDLLSSSPGYGAEIPVdLPTAGIDVPMFSALLRYLYTGEFGSE 71
BTB_POZ_ZBTB22_BING1 cd18210
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 1.19e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 22 (ZBTB22); ZBTB22, also called protein BING1 or zinc finger protein 297, may be involved in transcriptional regulation. Its gene, together with BING 3-5, TAPASIN, DAXX, RGL2, and HKE2, form a dense cluster at the centromeric end of the major histocompatibility complex class I region. ZBTB22 contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349519 [Multi-domain]  Cd Length: 112  Bit Score: 37.90  E-value: 1.19e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSPAIrlreMSPEAFGAVLHYVY 269
Cdd:cd18210  23 DISIHVQGRVFRAHRAVLAASSPYFHDQVLLKNMSSISLPGV----MDPGAFESVLASAY 78
BTB_POZ_ZBTB4 cd18195
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 1.66e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 4 (ZBTB4); ZBTB4, also called KAISO-like zinc finger protein 1 (KAISO-L1), is a transcriptional repressor with bimodal DNA-binding specificity. It binds with a higher affinity to methylated CpG dinucleotides in the consensus sequence 5'-CGCG-3' but can also bind to the non-methylated consensus sequence 5'-CTGCNA-3', also known as the consensus kaiso binding site (KBS). It can also bind specifically to a single methyl-CpG pair and can bind hemimethylated DNA but with a lower affinity compared to methylated DNA. ZBTB4 contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349504 [Multi-domain]  Cd Length: 124  Bit Score: 37.95  E-value: 1.66e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQ--VGNEASSPAIRLREMSP----------EAFGAVLHYVY 269
Cdd:cd18195  20 DVTLIAGDTKFRAHRSVLAASSPYFRELLSSPlpLGAAAVAAAPGATQSPErvlelpgvkaGVFSDVLNFIY 91
BTB_POZ_KBTBD8 cd18274
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
219-307 2.38e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 8 (KBTBD8); KBTBD8, also called T-cell activation kelch repeat protein (TA-KRP), is a BTB-kelch family protein that is located in the Golgi apparatus and translocates to the spindle apparatus during mitosis. It acts as a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a regulator of neural crest specification. The BCR(KBTBD8) complex monoubiquitylates NOLC1 and its paralog TCOF1, the mutation of which underlies the neurocristopathy Treacher Collins syndrome. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349583 [Multi-domain]  Cd Length: 129  Bit Score: 37.66  E-value: 2.38e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 219 TFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLP-PEANkgrnaaamAREVFEAADMY 297
Cdd:cd18274  34 TFSCHRNVLAAISPYFRSMFTSGL-TESTQKEVRIVGVEAESMHLVLDYAYTSRVTlTEAN--------VQALFTAASIF 104
                        90
                ....*....|
gi 19387277 298 AMERLKLMCA 307
Cdd:cd18274 105 QIPSLQDQCA 114
BTB_POZ_KBTBD6_7 cd18273
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
220-312 2.40e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing proteins KBTBD6 and KBTBD7; KBTBD6 and KBTBD7 are substrate adaptors of a cullin-3 RING ubiquitin ligase complex that mediates ubiquitylation and proteasomal degradation of T-lymphoma and metastasis gene 1 (TIAM1), a RAC1-specific guanine exchange factor (GEF), by cooperating with gamma-aminobutyric acid receptor-associated proteins (GABARAP). KBTBD7 may also act as a new transcriptional activator in mitogen-activated protein kinase (MAPK) signaling. They both contain a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349582 [Multi-domain]  Cd Length: 142  Bit Score: 37.88  E-value: 2.40e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 220 FGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLP-PEANKGRnaaamareVFEAADMYA 298
Cdd:cd18273  46 FPCNRNVLAAASPYFKSMFTGGL-YESKQETVTIHDVDSESMALIIDYCYTGRVTlSEANVQR--------LYAAANMLQ 116
                        90
                ....*....|....
gi 19387277 299 MERLKLMCASNLCR 312
Cdd:cd18273 117 LEYVREACASFLAR 130
BTB_POZ_KLHL12_C3IP1_DKIR cd18242
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 2.46e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 12 (KLHL12); KLHL12, also called CUL3-interacting protein 1 (C3IP1) or DKIR homolog, is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a negative regulator of the Wnt signaling pathway and ER-Golgi transport. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349551 [Multi-domain]  Cd Length: 124  Bit Score: 37.42  E-value: 2.46e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18242  23 DVTLRVEGKEFPAHRIVLAACSDYFCAMFTSEM-SEKGKSEVELQGLTASTMEILLDFVY 81
BTB_POZ_calicin cd18307
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-306 2.63e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in calicin; Calicin is a basic cytoskeletal protein involved in the formation and maintenance of the highly regular organization of the postacrosomal perinuclear theca, the calyx of mammalian spermatozoa. It contains BTB and BACK domains at the N-terminal region and kelch repeats at the C-terminal region. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349616 [Multi-domain]  Cd Length: 97  Bit Score: 36.71  E-value: 2.63e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYG---QVGNEASSpAIRLREMSPEAFGAVLHYVYhdslppeANKGRNAAAM 286
Cdd:cd18307   3 DVVISVDNHSFAAHRNVLAAVSPFVKSLISSndmKATDELSI-TIDCDYLSPETVEQLLDYFY-------TGKIVISEKN 74
                        90       100
                ....*....|....*....|
gi 19387277 287 AREVFEAADMYAMERLKLMC 306
Cdd:cd18307  75 VEDLLKGAKYFNIPRLKDHC 94
BTB_POZ_BTBD3 cd18348
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
191-273 3.02e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 3 (BTBD3); BTBD3 is a BTB-domain-containing Kelch-like protein that controls dendrite orientation toward active axons in the mammalian neocortex. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349657 [Multi-domain]  Cd Length: 131  Bit Score: 37.31  E-value: 3.02e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 191 PSCHARNAMEF--LLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSpaIRLREMSPEAFGAVLHYV 268
Cdd:cd18348   6 PTIRERNAVMFnnDLMADIHFVVGPPGGTQRLPGHKYVLAVGSSVFHAMFYGELAEDKDE--IRIPDVEPAAFLAMLKYI 83

                ....*
gi 19387277 269 YHDSL 273
Cdd:cd18348  84 YCDEI 88
BTB_POZ_ZBTB24_ZNF450 cd18212
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-288 3.30e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 24 (ZBTB24); ZBTB24, also called zinc finger protein 450, functions as a transcription factor essentially involved in B-cell functions in humans. The loss-of-function mutations in ZBTB24 can cause ICF2 (immunodeficiency, centromeric instability and facial anomalies syndrome 2) with immunological characteristics of greatly reduced serum antibodies and circulating memory B cells. ZBTB24 contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349521 [Multi-domain]  Cd Length: 118  Bit Score: 36.70  E-value: 3.30e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFrKLLYGQVGnEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEANKGRNAAAMAR 288
Cdd:cd18212  25 DITLIVENVQFRAHKALLAASSEYF-SMMFADEG-EVGQSIYMLEGMVAETFGALLEFIYTGCLQVGEKSLEQILATAQ 101
BTB_POZ_ZBTB8 cd18199
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-274 3.35e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 8 (ZBTB8); There are two ZBTB8 isoforms: ZBTB8A and ZBTB8B. ZBTB8A is a novel proto-oncoprotein that stimulates cell proliferation. ZBTB8B may be involved in transcriptional regulation. They both contain a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349508 [Multi-domain]  Cd Length: 113  Bit Score: 36.63  E-value: 3.35e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSPAIRLREMSPEAFGAVLHYVYHDSLP 274
Cdd:cd18199  20 DCSIIVEGRIFKAHRNVLFASSGYFRMLLSHYIQDTGRPSTASFDVFSSDAFSIILDFVYSGKLS 84
BTB_POZ_ZBTB44 cd18228
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-273 3.74e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 44 (ZBTB44); ZBTB44, also called BTB/POZ domain-containing protein 15 (BTBD15) or zinc finger protein 851 (ZNF851), may be involved in transcriptional regulation. Single-nucleotide polymorphisms of ZBTB44 showed a suggestive association with disease progression of Crohn's disease. ZBTB44 has also preferentially been recognized by sera of patients with peripheral T-cell lymphoma (PTCL). It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349537 [Multi-domain]  Cd Length: 126  Bit Score: 36.76  E-value: 3.74e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEA--SSPA----IRLREMSPEAFGAVLHYVYHDSL 273
Cdd:cd18228  21 DVTIRVQDKIFRAHKVVLAACSDFFRSKLVGQASPRLvlVSPAgkcvLDLHHVTVTGFAPLLEYAYTSTL 90
BTB_POZ_KLHL28_BTBD5 cd18257
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-314 4.33e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 28 (KLHL28); KLHL28, also called BTB/POZ domain-containing protein 5 (BTBD5), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349566 [Multi-domain]  Cd Length: 118  Bit Score: 36.36  E-value: 4.33e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYhdslppeanKGRNAAAMA-- 287
Cdd:cd18257  20 DVVLRVGDVKIHAHKVVLASCSPYFKAMFTGNL-SEKENSEVEFQCIDETALQAIVEYAY---------TGTVFISQAtv 89
                        90       100
                ....*....|....*....|....*..
gi 19387277 288 REVFEAADMYAMERLKLMCasnlCRFI 314
Cdd:cd18257  90 ESLLPAANLLQIKLVLKEC----CDFL 112
BTB_POZ_ZBTB14 cd18204
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 4.47e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 14 (ZBTB14); ZBTB14 is also called zinc finger protein 161 (Zfp-161), zinc finger protein 478, zinc finger protein 5 (ZF5), or Zfp-5. It is a novel transcriptional activator of the dopamine transporter, binding it's promoter at the consensus sequence 5'-CCTGCACAGTTCACGGA-3'. It also binds to 5'-d(GCC)(n)-3' trinucleotide repeats in promoter regions and acts as a repressor of the FMR1 gene. ZBTB14 acts as a transcriptional repressor of MYC and thymidine kinase promoters. It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349513 [Multi-domain]  Cd Length: 114  Bit Score: 36.55  E-value: 4.47e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLygQVGNEASSPAIRLREMSPEAFGAVLHYVY 269
Cdd:cd18204  20 DIAIVVEDVKFRAHRCVLAACSTYFKKLF--KKLEVDSSSVIEIDFLRSDIFEEVLNYMY 77
BTB_POZ_ZBTB33_KAISO cd18219
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-273 5.21e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kaiso; Kaiso, also called zinc finger and BTB domain-containing protein 33 (ZBTB33), is a DNA methylation-dependent transcriptional repressor that binds to methylated CpG dinucleotides in the consensus sequence 5'-CGCG-3'. It also binds to the non-methylated consensus sequence 5'-CTGCNA-3', also known as the consensus kaiso binding site (KBS). It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349528 [Multi-domain]  Cd Length: 106  Bit Score: 35.96  E-value: 5.21e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLL--YGQVgneasspaIRLREMSPEAFGAVLHYVYHDSL 273
Cdd:cd18219  23 DVTVIVEDRKFRAHKNILSASSTYFHQLFsvAGQV--------VELNFIRADIFAEILNYIYSSKI 80
BTB_POZ_RCBTB1_2 cd18298
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-314 5.26e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in RCC1 and BTB domain-containing proteins, RCBTB1 and RCBTB2; The RCC1-related guanine nucleotide exchange factor (GEF) family includes RCC1 and BTB domain-containing proteins, RCBTB1 and RCBTB2, both of which are chromosome condensation regulator-like guanine nucleotide exchange factors. They contain an RCC1 repeat, a BTB domain, and a BACK domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349607 [Multi-domain]  Cd Length: 108  Bit Score: 36.08  E-value: 5.26e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGqVGNEASSPAIRLREMSPEAFGAVLHYVYHD--SLPPEankgrNAAAMa 287
Cdd:cd18298  14 DLKFRVDGKYIYVHKAILKIRCEYFRSMFQS-HWNEDDKNVIEIDQYSYPVYYAFLRYLYTDqvDLPPE-----DAIGL- 86
                        90       100
                ....*....|....*....|....*..
gi 19387277 288 revFEAADMYAMERLKLMCasnlCRFI 314
Cdd:cd18298  87 ---LDLANSYCEERLKKLC----EDII 106
BTB_POZ_KLHL38 cd18268
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-310 7.06e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 38 (KLHL38); KLHL38 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The KLHL38 gene is significantly up-regulated during diapause, a temporary arrest of development during early ontogeny. It may also function in preadipocyte differentiation in the chicken. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349577 [Multi-domain]  Cd Length: 129  Bit Score: 35.92  E-value: 7.06e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVgNEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEANKGRNaaamare 289
Cdd:cd18268  25 DVILCTGDKEIPCHRNVLASSSPYFRAMFCNNF-RESSQAKVDLKGIDSDVLDQIVDYVYTGEILITRDNVLP------- 96
                        90       100
                ....*....|....*....|.
gi 19387277 290 VFEAADMYAMERLKLMCASNL 310
Cdd:cd18268  97 LMEAASMLQYPKLFEACSLYL 117
BTB_POZ_KBTBD12 cd18276
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
220-309 7.23e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 12 (KBTBD12); KBTBD12, also called Kelch domain-containing protein 6 (KLHDC6), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349585 [Multi-domain]  Cd Length: 127  Bit Score: 35.94  E-value: 7.23e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19387277 220 FGAHRLALAGQSLYFRKLLY-GQVgnEASSPAIRLREMSPEAFGAVLHYVYHDSLPPEANKGRNAAAMA-----REVFEA 293
Cdd:cd18276  33 FPCHRLVLAAFSPYFKAMFTcGLM--ECSQREVVLHDITAESVSIILNYMYSSDLHLTNSNVQGVATAAfflqmEDIFSV 110
                        90
                ....*....|....*.
gi 19387277 294 ADMYAMERlklMCASN 309
Cdd:cd18276 111 CQKYMMDH---MDASN 123
BTB_POZ_ZBTB25_ZNF46_KUP cd18213
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
210-269 8.12e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 25 (ZBTB25); ZBTB25, also called zinc finger protein 46 (ZNF46) or zinc finger protein KUP, is a transcription repressor that facilitates viral RNA transcription and replication. It interacts with viral RNA-dependent RNA polymerase (RdRp) proteins and modulates their transcription activity. It also functions as a viral RNA-binding protein, binding preferentially to the U-rich sequence within 5' UTR of vRNA. ZBTB25 contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349522 [Multi-domain]  Cd Length: 128  Bit Score: 36.03  E-value: 8.12e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 19387277 210 DLEIHVGDATFGAHRLALAGQSLYFRKLLYGQvgneaSSPAIRLR--EMSPEAFGAVLHYVY 269
Cdd:cd18213  23 DCTVAIGDVYFKAHRAVLAAFSNYFKMIFIHQ-----SSECIKIQptDIQPDIFSYLLHIMY 79
BTB_POZ_BTBD3_6 cd18282
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
222-278 8.21e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing proteins, BTBD3 and BTBD6; This family includes BTB/POZ domain-containing proteins BTBD3 and BTBD6, both of which are BTB-domain-containing Kelch-like proteins. BTBD3 controls dendrite orientation toward active axons in mammalian neocortex. BTBD6 is required for proper embryogenesis and plays an essential evolutionary conserved role during neuronal development. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349591 [Multi-domain]  Cd Length: 108  Bit Score: 35.45  E-value: 8.21e-03
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 19387277 222 AHRLALAGQSLYFRKLLYGQVGNEASSpaIRLREMSPEAFGAVLHYVYHDSLPPEAN 278
Cdd:cd18282  25 AHKYVLATGSSVFYAMFYGGLAENKNE--IEIPDVEPAAFLNLLRYLYCDEIDLEPD 79
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH