NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|13957745|gb|AAK50633|]
View 

germ cell-less protein [Oryzias latipes]

Protein Classification

germ cell-less family protein (domain architecture ID 13033696)

germ cell-less family protein similar to Drosophila melanogaster protein germ cell-less (GCL), a key regulator required for the specification of pole cells and primordial germ cell formation in embryos

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
BTB_POZ_GCL cd18305
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
64-178 4.84e-76

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; GCL proteins are nuclear envelope proteins highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in embryos. Both, human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 2 (GMCL2), also called germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L), may function in spermatogenesis. They may also be substrate-specific adaptors of E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. They contain BTB and BACK domains. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


:

Pssm-ID: 349614 [Multi-domain]  Cd Length: 115  Bit Score: 234.10  E-value: 4.84e-76
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  64 TSRYIYQTLFLNGENSDIRIRALGQEWNLHKVYLCQSGYFSSMFSGSWKESNMMEINLEIPDQNIDTEALQVVFGSLYRD 143
Cdd:cd18305   1 TSKYIYQTLFLNGENSDITICALGREWKLHKIYLCQSGYFASMFSGSWKESKETVINLEIPDDNITVEALNVVFGSLYRD 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 13957745 144 DVLIKPSRVISVLAGACMLQLDGLIQQCGETMKEN 178
Cdd:cd18305  81 EIEIKPSRVVSILAAATLLQLDGLIQQCSEVMKET 115
BACK_GCL cd18495
BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less ...
179-256 1.12e-43

BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; The GCL protein is a nuclear envelope protein highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in Drosophila embryos. Both human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L) may function in spermatogenesis. They may also be substrate-specific adaptors of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.


:

Pssm-ID: 350570  Cd Length: 78  Bit Score: 148.55  E-value: 1.12e-43
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13957745 179 ISAKTVCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQSSDLFVMQVEMDVYTALKKWMFL 256
Cdd:cd18495   1 ISAKTVCSYYEAACMYGLTEVKKKCLEWLLRNLMTSQNVTLLRELSIELMEQLIASPNLFVMQVEMDVYTLLKKWLFL 78
 
Name Accession Description Interval E-value
BTB_POZ_GCL cd18305
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
64-178 4.84e-76

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; GCL proteins are nuclear envelope proteins highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in embryos. Both, human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 2 (GMCL2), also called germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L), may function in spermatogenesis. They may also be substrate-specific adaptors of E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. They contain BTB and BACK domains. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349614 [Multi-domain]  Cd Length: 115  Bit Score: 234.10  E-value: 4.84e-76
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  64 TSRYIYQTLFLNGENSDIRIRALGQEWNLHKVYLCQSGYFSSMFSGSWKESNMMEINLEIPDQNIDTEALQVVFGSLYRD 143
Cdd:cd18305   1 TSKYIYQTLFLNGENSDITICALGREWKLHKIYLCQSGYFASMFSGSWKESKETVINLEIPDDNITVEALNVVFGSLYRD 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 13957745 144 DVLIKPSRVISVLAGACMLQLDGLIQQCGETMKEN 178
Cdd:cd18305  81 EIEIKPSRVVSILAAATLLQLDGLIQQCSEVMKET 115
BACK_GCL cd18495
BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less ...
179-256 1.12e-43

BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; The GCL protein is a nuclear envelope protein highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in Drosophila embryos. Both human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L) may function in spermatogenesis. They may also be substrate-specific adaptors of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.


Pssm-ID: 350570  Cd Length: 78  Bit Score: 148.55  E-value: 1.12e-43
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13957745 179 ISAKTVCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQSSDLFVMQVEMDVYTALKKWMFL 256
Cdd:cd18495   1 ISAKTVCSYYEAACMYGLTEVKKKCLEWLLRNLMTSQNVTLLRELSIELMEQLIASPNLFVMQVEMDVYTLLKKWLFL 78
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
69-178 3.63e-15

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerized PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


Pssm-ID: 334194 [Multi-domain]  Cd Length: 108  Bit Score: 71.15  E-value: 3.63e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745    69 YQTLFLNGENSDIRIRA-LGQEWNLHKVYLC-QSGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVL 146
Cdd:pfam00651   1 LNELREQGKLCDVTLVVgDGKEFRAHKAVLAaCSPYFKALFSGQEEESSVSEIELD----DVSPEDFEALLEFMYTGELE 76
                          90       100       110
                  ....*....|....*....|....*....|..
gi 13957745   147 IKPSRVISVLAGACMLQLDGLIQQCGETMKEN 178
Cdd:pfam00651  77 ISEENVDDLLAAADKLQIPSLVDKCEEFLIQS 108
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
80-179 1.96e-13

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585 [Multi-domain]  Cd Length: 97  Bit Score: 65.79  E-value: 1.96e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745     80 DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:smart00225   1 DVTLVVGGKKFHAHKAVLAAhSPYFKALFSSDFKESDKSEIYLD----DVSPEDFRALLNFLYTGKLDLPEENVEELLEL 76
                           90       100
                   ....*....|....*....|.
gi 13957745    159 ACMLQLDGLIQQCGETMKENI 179
Cdd:smart00225  77 ADYLQIPGLVELCEEFLLKLL 97
BACK smart00875
BTB And C-terminal Kelch; The BACK domain is found juxtaposed to the BTB domain; they are ...
184-254 2.11e-10

BTB And C-terminal Kelch; The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues.


Pssm-ID: 197943  Cd Length: 101  Bit Score: 57.35  E-value: 2.11e-10
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 13957745    184 VCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQSSDLFVMQvEMDVYTALKKWM 254
Cdd:smart00875   1 CLGIRRFADAHGLEELAEKALRFILQNFSEVSSSEEFLELPLEQLLELLSSDDLNVSS-EEEVFEAVLRWV 70
PHA03098 PHA03098
kelch-like protein; Provisional
71-253 1.03e-04

kelch-like protein; Provisional


Pssm-ID: 222983 [Multi-domain]  Cd Length: 534  Bit Score: 44.76  E-value: 1.03e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745   71 TLFLNGENSDIR--IRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKEsnmMEINLeipdqNIDTEALQVVFGSLYRDDVLI 147
Cdd:PHA03098   2 YSFELQKFCDESiiIVNGGGIIKVHKIILSSsSEYFKKMFKNNFKE---NEINL-----NIDYDSFNEVIKYIYTGKINI 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  148 KPSRVISVLAGACMLQLDGLIQQCGETMKENISAKTVCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEV 227
Cdd:PHA03098  74 TSNNVKDILSIANYLIIDFLINLCINYIIKIIDDNNCIDIYRFSFFYGCKKLYSAAYNYIRNNIELIYNDPDFIYLSKNE 153
                        170       180
                 ....*....|....*....|....*.
gi 13957745  228 MEQLIQSSDLFVMQvEMDVYTALKKW 253
Cdd:PHA03098 154 LIKILSDDKLNVSS-EDVVLEIIIKW 178
BACK pfam07707
BTB And C-terminal Kelch; This domain is found associated with pfam00651 and pfam01344. The ...
184-253 2.91e-04

BTB And C-terminal Kelch; This domain is found associated with pfam00651 and pfam01344. The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues. This family appears to be closely related to the BTB domain (Finn RD, personal observation).


Pssm-ID: 311578  Cd Length: 101  Bit Score: 39.84  E-value: 2.91e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 13957745   184 VCGYYHCASIYGLDSVMKKCLEWLLNNLMT-HQNVDLMkELGVEVMEQLIQSSDLFVmQVEMDVYTALKKW 253
Cdd:pfam07707   1 CLGIYDFADTYGCTELAEAALRFILQNFLEvAKSEEFL-ELSLEQLLELLSSDELNV-ESEEEVFEAVIRW 69
 
Name Accession Description Interval E-value
BTB_POZ_GCL cd18305
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
64-178 4.84e-76

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; GCL proteins are nuclear envelope proteins highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in embryos. Both, human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 2 (GMCL2), also called germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L), may function in spermatogenesis. They may also be substrate-specific adaptors of E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. They contain BTB and BACK domains. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349614 [Multi-domain]  Cd Length: 115  Bit Score: 234.10  E-value: 4.84e-76
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  64 TSRYIYQTLFLNGENSDIRIRALGQEWNLHKVYLCQSGYFSSMFSGSWKESNMMEINLEIPDQNIDTEALQVVFGSLYRD 143
Cdd:cd18305   1 TSKYIYQTLFLNGENSDITICALGREWKLHKIYLCQSGYFASMFSGSWKESKETVINLEIPDDNITVEALNVVFGSLYRD 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 13957745 144 DVLIKPSRVISVLAGACMLQLDGLIQQCGETMKEN 178
Cdd:cd18305  81 EIEIKPSRVVSILAAATLLQLDGLIQQCSEVMKET 115
BACK_GCL cd18495
BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less ...
179-256 1.12e-43

BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; The GCL protein is a nuclear envelope protein highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in Drosophila embryos. Both human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L) may function in spermatogenesis. They may also be substrate-specific adaptors of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.


Pssm-ID: 350570  Cd Length: 78  Bit Score: 148.55  E-value: 1.12e-43
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13957745 179 ISAKTVCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQSSDLFVMQVEMDVYTALKKWMFL 256
Cdd:cd18495   1 ISAKTVCSYYEAACMYGLTEVKKKCLEWLLRNLMTSQNVTLLRELSIELMEQLIASPNLFVMQVEMDVYTLLKKWLFL 78
BTB_POZ_BTBD16 cd18291
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-187 3.78e-20

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 16 (BTBD16); BTBD16 is a BTB domain-containing protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349600  Cd Length: 114  Bit Score: 85.57  E-value: 3.78e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  67 YIYQTLFLNGENSDIRIRALGQEWNLHKVYLCQSGYFSSMFsgswkesNMMEINLEIPDQNIDTEALQVVFGSLYRDDVL 146
Cdd:cd18291   1 YYHSQKVARSACPDVVLECLGSFWELHSPYLCKSETLAELL-------KPVTISLNINDPLVTKEAFAVALGNLYNSEVE 73
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 13957745 147 IKPSRVISVLAGACMLQLDGLIQQCGETMKENISAKTVCGY 187
Cdd:cd18291  74 VNVEDAVGVLAAAALLRFPTLFQKCVKVMISSISSSTVCKF 114
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
69-178 3.63e-15

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerized PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


Pssm-ID: 334194 [Multi-domain]  Cd Length: 108  Bit Score: 71.15  E-value: 3.63e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745    69 YQTLFLNGENSDIRIRA-LGQEWNLHKVYLC-QSGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVL 146
Cdd:pfam00651   1 LNELREQGKLCDVTLVVgDGKEFRAHKAVLAaCSPYFKALFSGQEEESSVSEIELD----DVSPEDFEALLEFMYTGELE 76
                          90       100       110
                  ....*....|....*....|....*....|..
gi 13957745   147 IKPSRVISVLAGACMLQLDGLIQQCGETMKEN 178
Cdd:pfam00651  77 ISEENVDDLLAAADKLQIPSLVDKCEEFLIQS 108
BTB_POZ_ZBTB_KLHL-like cd18186
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
79-162 1.84e-14

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing (ZBTB) proteins, Kelch-like (KLHL) proteins, and similar proteins; This family includes a variety of BTB/POZ domain-containing proteins, such as zinc finger and BTB domain-containing (ZBTB) proteins and Kelch-like (KLHL) proteins. They have diverse functions, such as transcriptional regulation, chromatin remodeling, protein degradation and cytoskeletal regulation. Many BTB/POZ proteins contain one or two additional domains, such as kelch repeats, zinc-finger domains, FYVE (Fab1, YOTB, Vac1, and EEA1) fingers, or ankyrin repeats. These special additional domains or interaction partners provide unique characteristics and functions to BTB/POZ proteins. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349497 [Multi-domain]  Cd Length: 82  Bit Score: 68.35  E-value: 1.84e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHKVYLC-QSGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18186   2 CDVTLVVGGREFPAHRAVLAaRSPYFRAMFSSGMKESSSSEIELD----DVSPEAFEALLDYIYTGELELSEENVEELLA 77

                ....*
gi 13957745 158 GACML 162
Cdd:cd18186  78 AADKL 82
BACK_BTBD16 cd18492
BACK (BTB and C-terminal Kelch) domain found in BTB/POZ domain-containing protein 16 (BTBD16); ...
179-261 2.76e-14

BACK (BTB and C-terminal Kelch) domain found in BTB/POZ domain-containing protein 16 (BTBD16); BTBD16 is a BTB-domain-containing Kelch-like protein. Its function remains unclear. BTBD16 SNPs may be bipolar disorder (BD) genetic susceptibility variants exhibiting genetic background-dependent effects.


Pssm-ID: 350567  Cd Length: 97  Bit Score: 68.47  E-value: 2.76e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745 179 ISAKTVCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDL-MKELGVEVMEQLIQSSDLFVMQvEMDVYTALKKWMFLQ 257
Cdd:cd18492   1 IKSSTVCKFHRAACKYKQESLATACERWLELNLVPQLSSQIyLRDLPLELLHKILKSPRLFTFN-EYSLYKTLCYWVFLQ 79

                ....
gi 13957745 258 LNPS 261
Cdd:cd18492  80 LNPK 83
BTB2_POZ_BTBD8 cd18286
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
72-167 1.30e-13

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 8 (BTBD8); BTBD8 is a BTB-domain-containing Kelch-like protein that may play a role in developmental processes. It may also act as a protein-protein adaptor in a transcription complex and thus be involved in brain development. BTBD8 contains two BTB domains. This model corresponds to the second domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349595 [Multi-domain]  Cd Length: 121  Bit Score: 67.28  E-value: 1.30e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  72 LFLNGENSDIRIRALGQEWNLHKVYLC-QSGYFSSMFSGSWKESNMMEINLEIpdqnIDTEALQVVFGSLYRDDVLIKPS 150
Cdd:cd18286  11 LFLNGEDSDITIKVDGKTFKAHRCILCaRSSYFAAMLSGSWAESNSSEITLTG----VSHAAVSFVLLFIYGGVLDLPDD 86
                        90
                ....*....|....*...
gi 13957745 151 -RVISVLAGACMLQLDGL 167
Cdd:cd18286  87 vNLGELLSLADMYGLDGL 104
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
80-179 1.96e-13

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585 [Multi-domain]  Cd Length: 97  Bit Score: 65.79  E-value: 1.96e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745     80 DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:smart00225   1 DVTLVVGGKKFHAHKAVLAAhSPYFKALFSSDFKESDKSEIYLD----DVSPEDFRALLNFLYTGKLDLPEENVEELLEL 76
                           90       100
                   ....*....|....*....|.
gi 13957745    159 ACMLQLDGLIQQCGETMKENI 179
Cdd:smart00225  77 ADYLQIPGLVELCEEFLLKLL 97
BTB_POZ_KLHL10 cd18240
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
64-182 4.99e-12

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 10 (KLHL10); KLHL10 is a substrate-specific adaptor of a CUL3-based E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins specifically in the testis during spermatogenesis. Haploinsufficiency of Klhl10 causes infertility in male mice. KLHL10 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349549 [Multi-domain]  Cd Length: 120  Bit Score: 62.73  E-value: 4.99e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  64 TSRYIYQTLFLNGENSDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINleIPDqnIDTEALQVVFGSLYR 142
Cdd:cd18240   3 MACNVFNELRLEGKLCDVVIRVNGVEFPAHRNILCAcSPYFRALFTNGWNETEKKVYK--IPG--VSPEMMELIIEYAYT 78
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 13957745 143 DDVLIKPSRVISVLAGACMLQLDGLIQQCGETMKENISAK 182
Cdd:cd18240  79 RTVPITAENVEELLPAADQFNIMGIVKACCDFLEDQLCPE 118
BTB_POZ_KLHL8 cd18238
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
72-179 2.54e-11

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 8 (KLHL8); KLHL8 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex required for the ubiquitination and degradation of rapsyn, a postsynaptic protein required for clustering of nicotinic acetylcholine receptors (nAChRs) at the neuromuscular junction. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349547 [Multi-domain]  Cd Length: 120  Bit Score: 60.77  E-value: 2.54e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  72 LFLNGENSDIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPS 150
Cdd:cd18238   9 FYENGELCDVTLKVGEKSIHCHRLVLaCVSPYFRAMFTSEMAESKQDSITI----KDIDEEAVELLVDFAYTGKLTLTVD 84
                        90       100
                ....*....|....*....|....*....
gi 13957745 151 RVISVLAGACMLQLDGLIQQCGETMKENI 179
Cdd:cd18238  85 NVQSLLYAASLLQVEEVAKACCEFMKDHL 113
BACK smart00875
BTB And C-terminal Kelch; The BACK domain is found juxtaposed to the BTB domain; they are ...
184-254 2.11e-10

BTB And C-terminal Kelch; The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues.


Pssm-ID: 197943  Cd Length: 101  Bit Score: 57.35  E-value: 2.11e-10
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 13957745    184 VCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQSSDLFVMQvEMDVYTALKKWM 254
Cdd:smart00875   1 CLGIRRFADAHGLEELAEKALRFILQNFSEVSSSEEFLELPLEQLLELLSSDDLNVSS-EEEVFEAVLRWV 70
BTB_POZ_KBTBD2_BKLHD1 cd18270
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
79-182 3.05e-10

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 2 (KBTBD2); KBTBD2, also called BTB and kelch domain-containing protein 1 (BKLHD1), plays an essential role in the regulation of insulin-signaling pathway. It is a BTB-Kelch family substrate recognition subunit of the Cullin-3-based E3 ubiquitin ligase, which targets p85alpha, the regulatory subunit of the phosphoinositol-3-kinase (PI3K) heterodimer, causing p85alpha ubiquitination and proteasome-mediated degradation. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349579 [Multi-domain]  Cd Length: 133  Bit Score: 58.09  E-value: 3.05e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18270  27 TDIVLIVEGTEFPCHKMVLATcSSYFRAMFMSGLSESKQTHVHL----RNVDAATLQIIITYAYTGNLAINDSTVEQLYE 102
                        90       100
                ....*....|....*....|....*
gi 13957745 158 GACMLQLDGLIQQCGETMKENISAK 182
Cdd:cd18270 103 TACFLQVEDVLQRCREYLIKKINAE 127
BTB_POZ_KLHL18 cd18247
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
88-177 3.51e-10

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 18 (KLHL18); KLHL18 acts as a substrate-specific adaptor for a Cullin3 E3 ubiquitin-protein ligase complex that regulates mitotic entry and ubiquitylates Aurora-A. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349556 [Multi-domain]  Cd Length: 116  Bit Score: 57.29  E-value: 3.51e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  88 QEWNLHKVYLCQS-GYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLAGACMLQLDG 166
Cdd:cd18247  29 QKFSAHRIVLAATiPYFHAMFTHDMVESKQDEITM----QGIEPSALEALINFAYSGRIAIDTSNVQSLLVGASFLQLQS 104
                        90
                ....*....|.
gi 13957745 167 LIQQCGETMKE 177
Cdd:cd18247 105 VKDACCEFLKE 115
BTB_POZ_KLHL1-like cd18234
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-171 3.70e-09

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins KLHL1, KLHL4 and KLHL5; This family contains the Kelch-like proteins: KLHL1, KLHL4 and KLHL5, all of which share high identity and similarity with the Drosophila kelch protein, a component of ring canals. KLHL1 is a neuronal actin-binding protein that modulates voltage-gated CaV2.1 (P/Q-type) and CaV3.2 (alpha1H T-type) calcium channels. Family members contain a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349543 [Multi-domain]  Cd Length: 105  Bit Score: 53.91  E-value: 3.70e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRAlgqewnlHKVYLCQ-SGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:cd18234  10 DRRIPA-------HRLVLSAvSDYFAAMFTNDVREATEEEIKLK----DVDPDALWTLVQYCYTGRLELKEDNVESLLAT 78
                        90
                ....*....|...
gi 13957745 159 ACMLQLDGLIQQC 171
Cdd:cd18234  79 ACLLQLSEVVEAC 91
BTB_POZ_KLHL35 cd18265
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
79-181 1.11e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 35 (KLHL35); KLHL35 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. Significant differences in DNA methylation of the KLHL35 gene in abdominal aortic aneurysm (AAA) patients compared to non-AAA controls suggest a potential role in AAA pathology. Hypermethylation of the KLHL35 gene has also been associated with the development of hepatocellular carcinoma. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349574 [Multi-domain]  Cd Length: 128  Bit Score: 53.24  E-value: 1.11e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18265  24 TDVVLLVDGKDFPCHRATLSAnSAYFRAMFGGHLKESRQAVVEI----QKVSAAAMEVLLDYMYGGGLRIQEDNVESVLE 99
                        90       100
                ....*....|....*....|....
gi 13957745 158 GACMLQLDGLIQQCGETMKENISA 181
Cdd:cd18265 100 ASDLLQVSKLREACVRFLEGQLHP 123
BTB_POZ_KLHL27_IPP cd18256
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-181 1.81e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in intracisternal A particle-promoted polypeptide (IPP); IPP, also called Kelch-like protein 27 (KLHL27) or actin-binding protein IPP, is an actin-binding protein that may play a role in organizing the actin cytoskeleton. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349565 [Multi-domain]  Cd Length: 125  Bit Score: 52.41  E-value: 1.81e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYLCQSG-YFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:cd18256  22 DVQLQVGMELFSVHRLVLAASSpYFAALFAGGMSESSKDVVQI----HGVEPDIFHILLDFIYTGVVEVTVSNVQELLVA 97
                        90       100
                ....*....|....*....|...
gi 13957745 159 ACMLQLDGLIQQCGETMKENISA 181
Cdd:cd18256  98 ADMLQLTEVVEICCEFLKGQLHP 120
BTB_POZ_KLHL34 cd18264
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
69-185 5.31e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 34 (KLHL34); KLHL34 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The methylation status of KLHL34 cg14232291 appears to be predictive of pathologic response to preoperative chemoradiation therapy in rectal cancer patients. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349573 [Multi-domain]  Cd Length: 136  Bit Score: 51.72  E-value: 5.31e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  69 YQTLFLNGENSDIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKESNMMEINLEIPdqniDTEALQVVFGSLYRDDVLI 147
Cdd:cd18264  19 YQSLRAEGFLCDVVLEAEGNEFPAHRSLLaCSSDYFRALFKDYTQESKARVIHLPVV----SAAGLQRVLDFIYTSWLSL 94
                        90       100       110
                ....*....|....*....|....*....|....*...
gi 13957745 148 KPSRVISVLAGACMLQLDGLIQQCGETMKENISAKTVC 185
Cdd:cd18264  95 SLDTLEDTLEAASYLQVTEAIGLCSQYLINNLAPENCC 132
BTB_POZ_KLHL12_C3IP1_DKIR cd18242
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-173 7.09e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 12 (KLHL12); KLHL12, also called CUL3-interacting protein 1 (C3IP1) or DKIR homolog, is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a negative regulator of the Wnt signaling pathway and ER-Golgi transport. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349551 [Multi-domain]  Cd Length: 124  Bit Score: 50.90  E-value: 7.09e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:cd18242  23 DVTLRVEGKEFPAHRIVLAAcSDYFCAMFTSEMSEKGKSEVEL----QGLTASTMEILLDFVYTETVHVTVENVQELLPA 98
                        90
                ....*....|....*
gi 13957745 159 ACMLQLDGLIQQCGE 173
Cdd:cd18242  99 ACLLQLKGVKQACCE 113
BTB_POZ_KLHL37_ENC1 cd18267
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-179 1.42e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ectoderm-neural cortex protein 1 (ENC-1); ENC-1 is also called Kelch-like protein 37 (KLHL37), nuclear matrix protein NRP/B, or p53-induced gene 10 protein. It is an actin-binding nuclear matrix protein that associates with p110(RB), and is involved in the regulation of neuronal process formation and in differentiation of neural crest cells. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349576 [Multi-domain]  Cd Length: 147  Bit Score: 50.76  E-value: 1.42e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  70 QTLFlngenSDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipDQNIDTEALQVVFGSLYRDDVLIK 148
Cdd:cd18267  37 QRLF-----TDVLLHAGNRSFPCHRAVLAAcSRYFEAMFSGGLKESQDSEVNF---HDSIHPEVLELLLDYAYSSRVIIN 108
                        90       100       110
                ....*....|....*....|....*....|.
gi 13957745 149 PSRVISVLAGACMLQLDGLIQQCGETMKENI 179
Cdd:cd18267 109 EENAESLLEAGDMLEFQDIRDACAEFLEKNL 139
BTB2_POZ_ABTB1_BPOZ1 cd18296
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
93-179 1.74e-07

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ankyrin repeat and BTB/POZ domain-containing protein 1 (ABTB1); ABTB1, also called elongation factor 1A-binding protein or bood POZ containing gene type 1 (BPOZ-1), is an anti-proliferative factor that may act as a mediator of the phosphatase and tensin homolog (PTEN) growth-suppressive signaling pathway. It may play a role in developmental processes. ABTB1 contains an ankyrin repeat and two BTB domains. This model corresponds to the second BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349605 [Multi-domain]  Cd Length: 121  Bit Score: 49.60  E-value: 1.74e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  93 HKVYLC-QSGYFSSMFSGSWKES--NMMEIN-LEIPDQNIDTEALQVVFgsLYRDDVLIKPSRVISVLAGACMLQLDGLI 168
Cdd:cd18296  32 HKAFFCgRSDYFKALLRDHFAESeeNNGSIPvVTLHDVSPEVFAIVLYY--IYTDDTDLPPENAYDVLYVADMYLLPGLK 109
                        90
                ....*....|.
gi 13957745 169 QQCGETMKENI 179
Cdd:cd18296 110 RLCGTVLAQSL 120
BTB_POZ_KLHL28_BTBD5 cd18257
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
76-171 1.86e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 28 (KLHL28); KLHL28, also called BTB/POZ domain-containing protein 5 (BTBD5), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349566 [Multi-domain]  Cd Length: 118  Bit Score: 49.46  E-value: 1.86e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  76 GENSDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVIS 154
Cdd:cd18257  16 HELCDVVLRVGDVKIHAHKVVLAScSPYFKAMFTGNLSEKENSEVEF----QCIDETALQAIVEYAYTGTVFISQATVES 91
                        90
                ....*....|....*..
gi 13957745 155 VLAGACMLQLDGLIQQC 171
Cdd:cd18257  92 LLPAANLLQIKLVLKEC 108
BTB_POZ_KBTBD6_7 cd18273
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
81-194 2.54e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing proteins KBTBD6 and KBTBD7; KBTBD6 and KBTBD7 are substrate adaptors of a cullin-3 RING ubiquitin ligase complex that mediates ubiquitylation and proteasomal degradation of T-lymphoma and metastasis gene 1 (TIAM1), a RAC1-specific guanine exchange factor (GEF), by cooperating with gamma-aminobutyric acid receptor-associated proteins (GABARAP). KBTBD7 may also act as a new transcriptional activator in mitogen-activated protein kinase (MAPK) signaling. They both contain a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349582 [Multi-domain]  Cd Length: 142  Bit Score: 49.82  E-value: 2.54e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  81 IRIRALGQEWNLHKVYLCQ-------SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVI 153
Cdd:cd18273  31 IEVNGPGSGPGSGRLFPCNrnvlaaaSPYFKSMFTGGLYESKQETVTI----HDVDSESMALIIDYCYTGRVTLSEANVQ 106
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 13957745 154 SVLAGACMLQLDGLIQQCGETMKENISaktvcgYYHCASIY 194
Cdd:cd18273 107 RLYAAANMLQLEYVREACASFLARRLD------LSNCVGIL 141
BTB_POZ_KLHL26 cd18255
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-183 4.66e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 26 (KLHL26); KLHL26 is encoded by the klhl26 gene, which is regulated by p53 via fuzzy tandem repeats. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349564 [Multi-domain]  Cd Length: 121  Bit Score: 48.54  E-value: 4.66e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYL--CqSGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18255  20 DVTLIADGQRFQAHKVVLasC-SDYFRAMFTGGMRESSQDEIEL----KGVSAKGLKHILDFAYTSELTLDLDCIQDVLG 94
                        90       100
                ....*....|....*....|....*.
gi 13957745 158 GACMLQLDGLIQQCGETMKENISAKT 183
Cdd:cd18255  95 AAVHLQMLPVVELCEEFLKSAMSVEN 120
BTB_POZ_ABTB2-like cd18297
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
72-185 8.31e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) and similar proteins; This family includes ABTB2, BTBD11, plant ARM repeat protein interacting with ABF2 (ARIA), and similar proteins. ABTB2, also called bood POZ containing gene type 2 (BPOZ-2), is a scaffold protein that controls the degradation of many biological proteins ranging from embryonic development to tumor progression. It may be involved in the initiation of hepatocyte growth. ABTB2 functions as an adaptor protein for the E3 ubiquitin ligase scaffold protein Cullin-3. It directly binds to eukaryotic elongation factor 1A1 (eEF1A1) to promote eEF1A1 ubiquitylation and degradation, and prevent translation. The BTBD11 gene has been recently identified as an all-trans retinoic acid (atRA)-responsive gene that lies downstream of atRA and its receptors in the regulation of neurite outgrowth and cell adhesion in neural as well as non-neural tissues. ARIA is an armadillo (ARM) repeat and BTB domain-containing protein that acts as a positive regulator of ABA response via the modulation of the transcriptional activity of ABF2. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349606 [Multi-domain]  Cd Length: 117  Bit Score: 47.65  E-value: 8.31e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  72 LFLNGENSDIRIRALGQEWNLHKVYLC-QSGYFSSMFSGSWKESNMMEInlEIPDqnIDTEALQVVFGSLYR---DDVLI 147
Cdd:cd18297   6 YVNNPEMSDVTFLVEGRPFYAHKIVLVtASDRFKSMLSSGSTEAQTPVI--EIPD--IRYDIFQLMMQYLYTggvESLDV 81
                        90       100       110
                ....*....|....*....|....*....|....*...
gi 13957745 148 KPSRVISVLAGACMLQLDGLIQQCgetmkENISAKTVC 185
Cdd:cd18297  82 AQDDALELLRAASFFQLDGLKRHC-----EILLSQQID 114
BTB_POZ_KLHL19_KEAP1 cd18248
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
93-171 1.13e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like ECH-associated protein 1 (KEAP1); KEAP1, also called cytosolic inhibitor of Nrf2 (INrf2) or Kelch-like protein 19 (KLHL19), is a redox-regulated substrate adaptor protein for a Cullin3-dependent ubiquitin ligase complex that targets NFE2L2/NRF2 for ubiquitination and degradation by the proteasome, thus resulting in the suppression of its transcriptional activity and the repression of antioxidant response element-mediated detoxifying enzyme gene expression. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349557 [Multi-domain]  Cd Length: 124  Bit Score: 47.37  E-value: 1.13e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  93 HKVYLCQ-SGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVLIKPSRVISVLAGACMLQLDGLIQQC 171
Cdd:cd18248  40 HKVVLASsSPYFKAMFTSGLRECGMEVVPIE----GVHPCVMSRLIEFAYTASISVGEKCVLHVLPGAVMYQMDSVVKAC 115
BTB_POZ_KLHL4 cd18336
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
93-171 1.71e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 4 (KLHL4); KLHL4 shares high identity and similarity with the Drosophila kelch protein, a component of ring canals. It may be associated with X-linked cleft palate (CPX) and is also a candidate gene in the impairment of mullerian duct development. In addition, it has been identified as a target of insulin-like growth factor binding protein 5 (IGFBP5). KLHL4 contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349645 [Multi-domain]  Cd Length: 126  Bit Score: 46.96  E-value: 1.71e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  93 HKVYLCQ-SGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVLIKPSRVISVLAGACMLQLDGLIQQC 171
Cdd:cd18336  34 HRLVLSAvSDYFAAMFTNDVREAKQEEIKME----GVDPDALKALVHYAYTGVLELKEDTIESLLAAACLLQLSQVIDVC 109
BTB_POZ_KBTBD8 cd18274
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-175 1.91e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 8 (KBTBD8); KBTBD8, also called T-cell activation kelch repeat protein (TA-KRP), is a BTB-kelch family protein that is located in the Golgi apparatus and translocates to the spindle apparatus during mitosis. It acts as a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a regulator of neural crest specification. The BCR(KBTBD8) complex monoubiquitylates NOLC1 and its paralog TCOF1, the mutation of which underlies the neurocristopathy Treacher Collins syndrome. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349583 [Multi-domain]  Cd Length: 129  Bit Score: 46.90  E-value: 1.91e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  70 QTLFLNGENSDIRIRA-LGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLI 147
Cdd:cd18274  14 KAMYDEGQLTDIVVEVdHGKTFSCHRNVLAAiSPYFRSMFTSGLTESTQKEVRI----VGVEAESMHLVLDYAYTSRVTL 89
                        90       100
                ....*....|....*....|....*...
gi 13957745 148 KPSRVISVLAGACMLQLDGLIQQCGETM 175
Cdd:cd18274  90 TEANVQALFTAASIFQIPSLQDQCAQFM 117
BTB_POZ_KLHL7 cd18237
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
59-186 2.42e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 7 (KLHL7); KLHL7 is a component of a Cul3-based E3 ubiquitin ligase complex and is involved in the ubiquitination of target proteins for proteasome-mediated degradation. Mutations in KLHL7 causes autosomal-dominant retinitis pigmentosa. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349546 [Multi-domain]  Cd Length: 126  Bit Score: 46.71  E-value: 2.42e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  59 KKLKSTSRYIYQTLFLNGENSDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVF 137
Cdd:cd18237   2 AKLLADFMGVMNNMRKQKTLCDVILIVEGREIKAHRVVLAAaSHFFHLMFTSNMTESKSSEVEL----KDAEPDIIELLV 77
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*....
gi 13957745 138 GSLYRDDVLIKPSRVISVLAGACMLQLDGLIQQCGETMKENISAKTVCG 186
Cdd:cd18237  78 EFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQLDASNCLG 126
BTB_POZ_KLHL20_KLEIP cd18249
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
77-176 4.39e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 20 (KLHL20); KLHL20, also called Kelch-like ECT2-interacting protein (KLEIP) or Kelch-like protein X, is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex involved in interferon response and anterograde Golgi to endosome transport. KLHL20 plays a role in actin assembly at cell-cell contact sites of Madin-Darby canine kidney cells. It also controls endothelial migration and sprouting angiogenesis. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349558 [Multi-domain]  Cd Length: 128  Bit Score: 45.91  E-value: 4.39e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  77 ENSDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISV 155
Cdd:cd18249  22 ELCDVVLVVGAKKIYAHRVILSAcSPYFRAMFTGELAESRQTEVTI----RDIDERAMELLIDFAYTSQITVEEGNVQTL 97
                        90       100
                ....*....|....*....|.
gi 13957745 156 LAGACMLQLDGLIQQCGETMK 176
Cdd:cd18249  98 LPAACLLQLAEIQEVCCEFLK 118
BTB_POZ_KLHL6 cd18236
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
77-177 4.50e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 6 (KLHL6); KLHL6 is a BTB-kelch protein with a lymphoid tissue-restricted expression pattern. It is involved in B-lymphocyte antigen receptor signaling and germinal center formation. It belongs to the KLHL gene family, which is composed of an N-terminal BTB-POZ domain and four to six Kelch motifs in tandem. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349545 [Multi-domain]  Cd Length: 129  Bit Score: 46.00  E-value: 4.50e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  77 ENS--DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVI 153
Cdd:cd18236  21 ENSltDVILCVDSQEFSCHRVVLAAaSNYFRAMFCNDLKEKYEEKIII----KGVDAETMQILLDYTYTSKVLITKQNVQ 96
                        90       100
                ....*....|....*....|....
gi 13957745 154 SVLAGACMLQLDGLIQQCGETMKE 177
Cdd:cd18236  97 RVLEAASLFQFLRMVDACASFLTE 120
BACK_BTBD17 cd18493
BACK (BTB and C-terminal Kelch) domain found in BTB/POZ domain-containing protein 17 (BTBD17); ...
180-254 1.52e-05

BACK (BTB and C-terminal Kelch) domain found in BTB/POZ domain-containing protein 17 (BTBD17); BTBD17, also termed galectin-3-binding protein-like, is a BTB-domain-containing Kelch-like protein. Its function remains unclear. It may be involved in hepatocellular carcinoma development and progression.


Pssm-ID: 350568  Cd Length: 74  Bit Score: 42.57  E-value: 1.52e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13957745 180 SAKTVCGYYHCASIYGLDSVMKKCLEWLLNNLmthQNVDLMKE---LGVEVMEQLIQSSDLfVMQVEMDVYTALKKWM 254
Cdd:cd18493   1 SVNHAVSWLQYAKMCGHKELAEACLEFIAWNF---EKVLKSPDwlnLDLDLLVSLLQSSDL-VVEDEYTLFQAVEKWL 74
BTB_POZ_trishanku-like cd18314
BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in ...
77-171 1.57e-05

BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in Dictyostelium discoideum trishanku and similar proteins; Trishanku is a novel regulator required for normal morphogenesis and cell-type stability in Dictyostelium discoideum. It contains a BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349623 [Multi-domain]  Cd Length: 96  Bit Score: 43.49  E-value: 1.57e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  77 ENSDIRIRALGQEWNLHKVYLC-QSGYFSSMFSGSWKESNMMEINLEIPDQNIDTEALQVvfgsLYRDDVLIKPSRVISV 155
Cdd:cd18314   5 EFSDVVLCVGDRKFFAHRIVLCaRSPVFRSMLTGSMIESNLKEVTLEDVEPEIFETVLKY----MYTGQVTLSEENVLDL 80
                        90
                ....*....|....*.
gi 13957745 156 LAGACMLQLDGLIQQC 171
Cdd:cd18314  81 LMLASKYQVPDLEKLC 96
BTB_POZ_KLHL38 cd18268
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
79-180 2.26e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 38 (KLHL38); KLHL38 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The KLHL38 gene is significantly up-regulated during diapause, a temporary arrest of development during early ontogeny. It may also function in preadipocyte differentiation in the chicken. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349577 [Multi-domain]  Cd Length: 129  Bit Score: 43.62  E-value: 2.26e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHK-VYLCQSGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18268  24 TDVILCTGDKEIPCHRnVLASSSPYFRAMFCNNFRESSQAKVDL----KGIDSDVLDQIVDYVYTGEILITRDNVLPLME 99
                        90       100
                ....*....|....*....|...
gi 13957745 158 GACMLQLDGLIQQCGETMKENIS 180
Cdd:cd18268 100 AASMLQYPKLFEACSLYLQDQLT 122
BTB2_POZ_IBtk cd18302
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
79-182 3.40e-05

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in inhibitor of Bruton tyrosine kinase (IBtk); IBtk is an inhibitor or negative regulator of Bruton tyrosine kinase (Btk), which is required for B-cell differentiation and development. IBtk binds to the PH domain of Btk and down-regulates the Btk kinase activity. It contains two BTB domains. This model corresponds to the second BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349611 [Multi-domain]  Cd Length: 113  Bit Score: 42.74  E-value: 3.40e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRAL-GQEWNLHKVYLC-QSGYFSSMFSGSWKE-SNMMEINLEIPdqnidTEALQVVFGSLYRDDVL-IKPSR--- 151
Cdd:cd18302   6 YDVTIVSEdGKEFPCHKCVLVaRLEYFHSMLSSSWIEaSSCSALTMPIP-----SDILEIILDYLYTDEASaVKESQnve 80
                        90       100       110
                ....*....|....*....|....*....|..
gi 13957745 152 -VISVLAGACMLQLDGLIQQCGETMKENISAK 182
Cdd:cd18302  81 fLCNVLVIADQLLITRLKEICEVALVELLSLK 112
BTB_POZ_KLHL17_actinfilin cd18246
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-171 3.86e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 17 (KLHL17); KLHL17, also called actinfilin, is a substrate-recognition component of some cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes. It acts as a Cullin 3 (Cul3) substrate adaptor that links GLUR6 to the E3 ubiquitin-ligase complex, and mediates the ubiquitination and subsequent degradation of GLUR6. It may play a role in actin-based neuronal function. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349555 [Multi-domain]  Cd Length: 139  Bit Score: 43.48  E-value: 3.86e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:cd18246  41 DIVLHVGTKEIKAHKVVLAScSPYFHAMFTNEMSESRQTHVTL----HDIDPQALEQLVQYAYTAEIVVGEGNVQTLLPA 116
                        90
                ....*....|...
gi 13957745 159 ACMLQLDGLIQQC 171
Cdd:cd18246 117 ASLLQLNGVRDAC 129
BTB_POZ_ARIA_plant cd18352
BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in ...
79-184 4.26e-05

BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in plant ARM repeat protein interacting with ABF2 (ARIA) and similar proteins; ARIA is an armadillo (ARM) repeat and BTB domain-containing protein that acts as a positive regulator of ABA response via the modulation of the transcriptional activity of ABF2, a transcription factor which controls ABA-dependent gene expression via the G-box-type ABA-responsive elements. ARIA is a novel abscisic acid signaling component. It negatively regulates seed germination and young seedling growth. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349661 [Multi-domain]  Cd Length: 116  Bit Score: 42.85  E-value: 4.26e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHKV-YLCQSGYFSSMFSGSWKESNMMEInlEIPdqNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18352  14 SDVTFLVEGRRFYAHRIaLLASSDAFRAMFDGGYREKEARDI--EIP--NIRWEVFELMMRFIYTGSVDITNDIAKDLLR 89
                        90       100
                ....*....|....*....|....*..
gi 13957745 158 GACMLQLDGLIQQCGETMKENISAKTV 184
Cdd:cd18352  90 AADQYLLEGLKRLCEYTIAQDLTLENI 116
BTB_POZ_KLHL32 cd18261
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-171 4.56e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 32 (KLHL32); KLHL32, also called BTB and kelch domain-containing protein 5 (BKLHD5), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. Deletion of KLHL32 may be ssociated with Tourette syndrome and obsessive-compulsive disorder. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349570 [Multi-domain]  Cd Length: 133  Bit Score: 43.03  E-value: 4.56e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:cd18261  30 DITLVAEEQKFHAHKAVLAAcSDYFRAMFSLCMVESEADEVNL----HGVTSLGLKQALDFAYTGQILLEPGVIQDVLAA 105
                        90
                ....*....|...
gi 13957745 159 ACMLQLDGLIQQC 171
Cdd:cd18261 106 GSHLQLLELLSLC 118
BTB_POZ_BTBD9 cd18287
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
72-122 4.90e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 9 (BTBD9); BTBD9 is a risk factor for Restless Legs Syndrome (RLS) encoding a Cullin-3 substrate adaptor. The BTBD9 gene may be associated with antipsychotic-induced RLS in schizophrenia. Mutations in BTBD9 lead to reduced dopamine, increased locomotion and sleep fragmentation. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349596 [Multi-domain]  Cd Length: 119  Bit Score: 42.61  E-value: 4.90e-05
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|..
gi 13957745  72 LFLNGENSDIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKESNMMEINLE 122
Cdd:cd18287  16 LFLNEEYSDVTFVVEEKRFPAHRVILaARSEYFRALLYGGMRESQQSEIELK 67
BTB_POZ_RCBTB1_2 cd18298
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
73-177 5.84e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in RCC1 and BTB domain-containing proteins, RCBTB1 and RCBTB2; The RCC1-related guanine nucleotide exchange factor (GEF) family includes RCC1 and BTB domain-containing proteins, RCBTB1 and RCBTB2, both of which are chromosome condensation regulator-like guanine nucleotide exchange factors. They contain an RCC1 repeat, a BTB domain, and a BACK domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349607 [Multi-domain]  Cd Length: 108  Bit Score: 42.24  E-value: 5.84e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  73 FLNGENSDIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKESNMMEInleipdqnIDTEALQVVFGS----LYRDDVLI 147
Cdd:cd18298   7 FNDPRTSDLKFRVDGKYIYVHKAILkIRCEYFRSMFQSHWNEDDKNVI--------EIDQYSYPVYYAflryLYTDQVDL 78
                        90       100       110
                ....*....|....*....|....*....|
gi 13957745 148 KPSRVISVLAGACMLQLDGLIQQCGETMKE 177
Cdd:cd18298  79 PPEDAIGLLDLANSYCEERLKKLCEDIIKQ 108
BTB_POZ_KLHL2-like cd18235
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-173 6.51e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins, KLHL2 and KLHL3; The family includes Kelch-like proteins, KLHL2 and KLHL3. KLHL2 is a novel actin-binding protein predominantly expressed in brain. It plays a role in the reorganization of the actin cytoskeleton, and promotes growth of cell projections in oligodendrocyte precursors. KLHL2 and KLHL3 each functions as a component of an E3 ubiquitin ligase complex that mediates the ubiquitination of target proteins. They contain a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349544 [Multi-domain]  Cd Length: 121  Bit Score: 42.41  E-value: 6.51e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYL--CqSGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18235  23 DVILVADGVEIPAHRVVLasC-SPYFHAMFTGDLSESRANRVTL----QDVDGKALLLLIDYVYTAEIQVTEENVQVLLP 97
                        90
                ....*....|....*.
gi 13957745 158 GACMLQLDGLIQQCGE 173
Cdd:cd18235  98 AANLLQLTDVRDACCD 113
BTB_POZ_KBTBD12 cd18276
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
77-186 7.74e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 12 (KBTBD12); KBTBD12, also called Kelch domain-containing protein 6 (KLHDC6), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349585 [Multi-domain]  Cd Length: 127  Bit Score: 42.10  E-value: 7.74e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  77 ENSDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISV 155
Cdd:cd18276  20 ELTDVVLVAEGEKFPCHRLVLAAfSPYFKAMFTCGLMECSQREVVL----HDITAESVSIILNYMYSSDLHLTNSNVQGV 95
                        90       100       110
                ....*....|....*....|....*....|.
gi 13957745 156 LAGACMLQLDGLIQQCGETMKENISAKTVCG 186
Cdd:cd18276  96 ATAAFFLQMEDIFSVCQKYMMDHMDASNCLG 126
PHA03098 PHA03098
kelch-like protein; Provisional
71-253 1.03e-04

kelch-like protein; Provisional


Pssm-ID: 222983 [Multi-domain]  Cd Length: 534  Bit Score: 44.76  E-value: 1.03e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745   71 TLFLNGENSDIR--IRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKEsnmMEINLeipdqNIDTEALQVVFGSLYRDDVLI 147
Cdd:PHA03098   2 YSFELQKFCDESiiIVNGGGIIKVHKIILSSsSEYFKKMFKNNFKE---NEINL-----NIDYDSFNEVIKYIYTGKINI 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  148 KPSRVISVLAGACMLQLDGLIQQCGETMKENISAKTVCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEV 227
Cdd:PHA03098  74 TSNNVKDILSIANYLIIDFLINLCINYIIKIIDDNNCIDIYRFSFFYGCKKLYSAAYNYIRNNIELIYNDPDFIYLSKNE 153
                        170       180
                 ....*....|....*....|....*.
gi 13957745  228 MEQLIQSSDLFVMQvEMDVYTALKKW 253
Cdd:PHA03098 154 LIKILSDDKLNVSS-EDVVLEIIIKW 178
BTB_POZ_ZBTB28_BCL6B cd18332
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
79-171 1.26e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in B-cell CLL/lymphoma 6 member B protein (BCL6B); BCL6B is also called Bcl6-associated zinc finger protein, zinc finger protein 62, or zinc finger and BTB domain-containing protein 28 (ZBTB28). It is a sequence-specific transcriptional repressor in association with BCL-6. It may function in a narrow stage or be related to some events in the early B-cell development. BCL6B plays an important role as a potential tumor suppressor in gastric cancer; it is found preferentially methylated in gastric cancer. It also inhibits both colorectal cancer growth and hepatocellular carcinoma metastases. BCL6B contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349641 [Multi-domain]  Cd Length: 114  Bit Score: 41.38  E-value: 1.26e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHK-VYLCQSGYFSSMFSGSWKESNMMeinLEIPdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18332  20 TDVTLLVGGTPLRAHKaVLIACSGFFYSIFSGRVGEGVSV---LTLP-SGLEARGFQLLLDFMYTSRLPLTPRTVPAVLA 95
                        90
                ....*....|....
gi 13957745 158 GACMLQLDGLIQQC 171
Cdd:cd18332  96 AATYLQMEHVVETC 109
BTB_POZ_KLHL3 cd18339
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-179 1.89e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 3 (KLHL3); KLHL3 is a component of an E3 ubiquitin ligase complex that regulates blood pressure by targeting With-No-Lysine (WNK) kinases for degradation. It contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349648 [Multi-domain]  Cd Length: 121  Bit Score: 40.86  E-value: 1.89e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEInlEIPDqnIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:cd18339  23 DVTIVAEDVEIEAHRVVLAAcSPYFCAMFTGDMSESKAKKI--EIKD--VDGQTLSKLIDYIYTAEIEVTEENVQVLLPA 98
                        90       100
                ....*....|....*....|.
gi 13957745 159 ACMLQLDGLIQQCGETMKENI 179
Cdd:cd18339  99 ASLLQLMDVRQNCCDFLQSQL 119
BTB_POZ_KLHL21 cd18250
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
79-181 1.89e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 21 (KLHL21); KLHL21 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for efficient chromosome alignment and cytokinesis. The BCR(KLHL21) E3 ubiquitin ligase complex regulates localization of the chromosomal passenger complex (CPC) from chromosomes to the spindle midzone in anaphase and mediates the ubiquitination of aurora B. KLHL21 also targets IkappaB kinase-beta to regulate nuclear factor kappa-light chain enhancer of activated B cells (NF-kappaB) signaling negatively. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349559 [Multi-domain]  Cd Length: 124  Bit Score: 40.91  E-value: 1.89e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18250  22 FDVTLCAGGREFPCHRTVLAAaSSYFRAMFAGELRESRADRVVL----HGVSAEILGLLLDFSYTGRVTVTQDNVEALLR 97
                        90       100
                ....*....|....*....|....
gi 13957745 158 GACMLQLDGLIQQCGETMKENISA 181
Cdd:cd18250  98 AADLFQFPSVKEACCAYLQQRLDV 121
BTB_POZ_BTBD1_2 cd18281
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
62-181 2.47e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing proteins, BTBD1 and BTBD2; This family includes BTB/POZ domain-containing proteins BTBD1 and BTBD2, both of which are BTB-domain-containing Kelch-like proteins that interact with DNA topoisomerase 1 (Topo1), a key enzyme of cell survival. BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349590 [Multi-domain]  Cd Length: 127  Bit Score: 40.88  E-value: 2.47e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  62 KSTSRYIYQTLFLNGENSDIRIrALGQEWN-----LHKVYLC-QSGYFSSMFSGSWKESNMmEInlEIPDqnIDTEALQV 135
Cdd:cd18281   6 KTTVKERFAFLFNNETLSDVHF-IVGKGDNeqripAHKFVLSiGSAVFDAMFNGGMATTSA-EI--ELPD--VEPAAFLA 79
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*.
gi 13957745 136 VFGSLYRDDVLIKPSRVISVLAGACMLQLDGLIQQCGETMKENISA 181
Cdd:cd18281  80 LLRFLYSDEVQIGPETVMTTLYTAKKYAVPALESACVEFLKKNLSS 125
BTB_POZ_ZBTB27_BCL6 cd18331
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
79-171 2.62e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in B-cell lymphoma 6 protein (BCL-6); BCL-6 is also called B-cell lymphoma 5 protein (BCL-5), zinc finger and BTB domain-containing protein 27 (ZBTB27), protein LAZ-3, or zinc finger protein 51 (ZNF51). It is a transcriptional repressor mainly required for germinal center (GC) formation and antibody affinity maturation, which have different mechanisms of action specific to the lineage and biological functions. It represses its target genes by binding directly to the DNA sequence 5'-TTCCTAGAA-3' or indirectly by repressing the transcriptional activity of transcription factors. It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349640 [Multi-domain]  Cd Length: 118  Bit Score: 40.61  E-value: 2.62e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHK-VYLCQSGYFSSMFSGSWKeSNMMEINLeipDQNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18331  25 TDVVIVVSREQFRAHKtVLMACSGLFYSIFTDQLK-CNLSVINL---DPEINPEGFNILLDFMYTSRLNLREGNIMAVMA 100
                        90
                ....*....|....
gi 13957745 158 GACMLQLDGLIQQC 171
Cdd:cd18331 101 TAMYLQMEHVVDTC 114
BACK pfam07707
BTB And C-terminal Kelch; This domain is found associated with pfam00651 and pfam01344. The ...
184-253 2.91e-04

BTB And C-terminal Kelch; This domain is found associated with pfam00651 and pfam01344. The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues. This family appears to be closely related to the BTB domain (Finn RD, personal observation).


Pssm-ID: 311578  Cd Length: 101  Bit Score: 39.84  E-value: 2.91e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 13957745   184 VCGYYHCASIYGLDSVMKKCLEWLLNNLMT-HQNVDLMkELGVEVMEQLIQSSDLFVmQVEMDVYTALKKW 253
Cdd:pfam07707   1 CLGIYDFADTYGCTELAEAALRFILQNFLEvAKSEEFL-ELSLEQLLELLSSDELNV-ESEEEVFEAVIRW 69
BACK cd14733
BACK (BTB and C-terminal Kelch) domain; The BACK domain is found in architectures C-terminal ...
180-234 3.05e-04

BACK (BTB and C-terminal Kelch) domain; The BACK domain is found in architectures C-terminal to a BTB domain, in a diverse set of architectures together with Kelch, MATH, and/or TAZ domains. It is involved in interactions with the Cullin3 (Cul3) ubiquitin ligase complex, as well as in homo-oligomerization. Most proteins containing the BACK domain are understood to function as adaptor proteins that play a role in ubiquitination of various substrates.


Pssm-ID: 350515  Cd Length: 55  Bit Score: 38.41  E-value: 3.05e-04
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*
gi 13957745 180 SAKTVCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQS 234
Cdd:cd14733   1 DPENCLGILELADLYNLEELKEKALKFILENFEEVSKSEEFLELSVELLLELLSS 55
BTB2_POZ_RhoBTB cd18300
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
72-171 3.29e-04

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Rho-related BTB domain-containing proteins (RhoBTB); RhoBTB proteins constitute a subfamily of atypical members within the Rho family of small guanosine triphosphatases (GTPases), which is characterized by containing a GTPase domain (in most cases, non-functional) followed by a proline-rich region, a tandem of 2 BTB domains, and a conserved C-terminal region. In humans, the RhoBTB subfamily consists of 3 isoforms: RhoBTB1, RhoBTB2, and RhoBTB3. Orthologs are present in several other eukaryotes, such as Drosophila and Dictyostelium, but have been lost in plants and fungi. This model corresponds to the second BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349609 [Multi-domain]  Cd Length: 108  Bit Score: 39.92  E-value: 3.29e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  72 LFLN-GENSDIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKESNMMEInlEIPDQNIDTeaLQVVFGSLYRDDVLIKP 149
Cdd:cd18300   2 LFLNkGLFSDVTFIVEDGTIPAHKALLvARCDVMAAMFGGNFRESSAKEV--ELPGVSKET--FLALLEYLYTDQAPILE 77
                        90       100
                ....*....|....*....|...
gi 13957745 150 SR-VISVLAGACMLQLDGLIQQC 171
Cdd:cd18300  78 DGdCVGLIVLANRLCLPRLVALC 100
BTB_POZ_KLHL24_KRIP6 cd18253
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
79-179 3.63e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 24 (KLHL24); KLHL24, also called kainate receptor-interacting protein for GluR6 (KRIP6) or protein DRE1, is necessary to maintain the balance between intermediate filament stability and degradation, a process that is essential for skin integrity. KLHL24 is a component of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that mediates ubiquitination of KRT14 and controls its levels during keratinocyte differentiation. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349562 [Multi-domain]  Cd Length: 121  Bit Score: 40.20  E-value: 3.63e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKESNMM--EINleipdqNIDTEALQVVFGSLYRDDVLIKPSRVISV 155
Cdd:cd18253  19 TDVIICVEGREFPCHRAILsACSSYFRAMFCNDHRESREMlvEIN------GILAEAMDCFLQYVYTGKVKITTENVQYL 92
                        90       100
                ....*....|....*....|....
gi 13957745 156 LAGACMLQLDGLIQQCGETMKENI 179
Cdd:cd18253  93 FETSSLFQISPLRDACAKFLEEQL 116
BTB_POZ_KLHL23 cd18252
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
69-171 5.19e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 23 (KLHL23); KLHL23 overexpression is associated with increased cell proliferation and invasion in gastric cancer. Downregulation of KLHL23 is associated with invasion, metastasis, and poor prognosis of hepatocellular carcinoma and pancreatic cancer. KLHL23 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349561 [Multi-domain]  Cd Length: 127  Bit Score: 39.81  E-value: 5.19e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  69 YQTLFLNGENSDIRIR-ALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVL 146
Cdd:cd18252  12 FRTFYLDGLFTDITLQcASGQIFHCHKAALAAcSSYFKVMFTADMKEKSNNVIKL----SGIDHDILEALVNYVYTSQIC 87
                        90       100
                ....*....|....*....|....*
gi 13957745 147 IKPSRVISVLAGACMLQLDGLIQQC 171
Cdd:cd18252  88 ITERNVQSLLEAADLLQFISVKKAC 112
BTB_POZ_KLHL2_Mayven cd18338
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-179 5.49e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 2 (KLHL2); KLHL2, also called actin-binding protein Mayven, is a novel actin-binding protein predominantly expressed in the brain. It plays a role in the reorganization of the actin cytoskeleton, and promotes growth of cell projections in oligodendrocyte precursors. KLHL2 is a component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, such as NPTXR, leading most often to their proteasomal degradation. It contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349647 [Multi-domain]  Cd Length: 121  Bit Score: 39.67  E-value: 5.49e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:cd18338  23 DVTIVAEDVEIAAHRVVLAAcSPYFHAMFTGEMSESRAKRVRI----KEVDGWTLKMLIDYVYTAEIQVTEENVQVLLPA 98
                        90       100
                ....*....|....*....|.
gi 13957745 159 ACMLQLDGLIQQCGETMKENI 179
Cdd:cd18338  99 AGLLQLQDVKKTCCEFLESQL 119
BTB_POZ_BTBD17 cd18292
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-175 6.14e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 17 (BTBD17); BTBD17, also called galectin-3-binding protein-like, is a BTB domain-containing protein. Its function remains unclear. It may be associated with hepatocellular carcinoma. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349601 [Multi-domain]  Cd Length: 114  Bit Score: 39.19  E-value: 6.14e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  70 QTLFLNGENSDIRIRALGQEWNLHKVYLC-QSGYFSSMFS-GSWKESNMMEINLEIPDQNIDtealqvVFGS----LYRD 143
Cdd:cd18292   9 AQLYNNEELSDIVLRVGGKVFHAHRLILAkSSDVFRVMLSnDWWSESKQSEIELVEDPECAA------VFEKflryLYTG 82
                        90       100       110
                ....*....|....*....|....*....|..
gi 13957745 144 DVLIKPSRVISVLAGACMLQLDGLIQQCGETM 175
Cdd:cd18292  83 QISVNLETALPLLMLADKYNVTDLKQLCVDFM 114
BTB_POZ_KBTBD4 cd18272
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
79-183 6.16e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 4 (KBTBD4); KBTBD4, also called BTB and kelch domain-containing protein 4 (BKLHD4), is a BTB-BACK-Kelch domain protein belonging to a large family of cullin-RING ubiquitin ligase adaptors that facilitate the ubiquitination of target substrates. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349581 [Multi-domain]  Cd Length: 140  Bit Score: 39.88  E-value: 6.16e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18272  33 ADVTISVEGKEFQLHRLVLsAQSCFFRSMFTSNLKEARNRVIEL----KDVSESVFQLLVDYIYHGTVKLRVEELQETYE 108
                        90       100
                ....*....|....*....|....*.
gi 13957745 158 GACMLQLDGLIQQCGETMKENISAKT 183
Cdd:cd18272 109 VADMYQLTALFEECSRFLARTVQVRN 134
BTB_POZ_KLHL25 cd18254
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
79-186 8.67e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 25 (KLHL25); KLHL25, also called ectoderm-neural cortex protein 2 (ENC-2), is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that is required for translational homeostasis. The BCR(KLHL25) ubiquitin ligase complex acts by mediating ubiquitination of hypophosphorylated EIF4EBP1 (4E-BP1). Cullin3-KLHL25 ubiquitin ligase also targets ATP-citrate lyase (ACLY), a key enzyme for lipid synthesis, for degradation to inhibit lipid synthesis and tumor progression. KLHL25 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349563 [Multi-domain]  Cd Length: 128  Bit Score: 39.22  E-value: 8.67e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  79 SDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLEipdQNIDTEALQVVFGSLYRDDVLIKPSRVISVLA 157
Cdd:cd18254  23 TDVTLWAGNRSFPCHRAVLAAcSRYFEAMFSNGLRESLDSTVNFH---DSLHPEVLELLLDFAYSSRIIINEENAESLLE 99
                        90       100
                ....*....|....*....|....*....
gi 13957745 158 GACMLQLDGLIQQCGETMKENISAKTVCG 186
Cdd:cd18254 100 AGDMLQFHDVRDAAAEFLEKNLYPSNCLG 128
BTB_POZ_BTBD11 cd18351
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
60-184 1.02e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 11 (BTBD11); BTBD11, also called ankyrin repeat and BTB/POZ domain-containing protein BTBD11, is a BTB-domain-containing protein. The BTBD11 gene has been recently identified as an all-trans retinoic acid (atRA)-responsive gene that lies downstream of atRA and its receptors in the regulation of neurite outgrowth and cell adhesion in neural as well as non-neural tissues. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349660 [Multi-domain]  Cd Length: 131  Bit Score: 39.19  E-value: 1.02e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  60 KLKSTSRYIYQtlFLNG-ENSDIRIRALGQEWNLHKVYL-CQSGYFSSMFSG-SWKESNMMEINleipdqNIDTEALQVV 136
Cdd:cd18351   7 KRKQTSRLDPH--FLNNkEMSDVTFLVEGRPFYAHKVLLfTASPRFKALLSNkPSAENTCIEIS------YVKYHIFQLV 78
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|.
gi 13957745 137 FGSLY---RDDVLIKPSRVISVLAGACMLQLDGLIQQCgetmkENISAKTV 184
Cdd:cd18351  79 MQYLYcggTESLLIKNNEIMELLSAAKFFQLEALQRHC-----EIICAKSI 124
BTB2_POZ_KLHL33 cd18263
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
72-183 1.15e-03

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 33 (KLHL33); KLHL33 contains BTB domains and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. KLHL33 gene expression in normal and tumor tissue suggest a significant association with prostate cancer risk. KLHL33 contains two BTB domains. This model corresponds to the second BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349572 [Multi-domain]  Cd Length: 118  Bit Score: 38.64  E-value: 1.15e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  72 LFLNGENSDIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLIKPS 150
Cdd:cd18263   7 LWEKGVGCDVQLEADGSIFRVHRVILaAGSDYFRAMFTSGMKESTQSVVQL----PTIPAKDLRLLISFAYSGILHLSWE 82
                        90       100       110
                ....*....|....*....|....*....|...
gi 13957745 151 RVISVLAGACMLQLDGLIQQCGETMKENISAKT 183
Cdd:cd18263  83 NLFEATCTALQLQISGALALCLDFLQREISPAR 115
BTB_POZ_BTBD19 cd18294
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
72-175 1.16e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 19 (BTBD19); BTBD19 is a BTB domain-containing protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349603 [Multi-domain]  Cd Length: 111  Bit Score: 38.38  E-value: 1.16e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  72 LFLNGENSDIR--IRALGQEWNLHKVYL-CQSGYFSSMFS-GSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDDVLI 147
Cdd:cd18294   8 LINNPEFSDVKflVGPERQEIFAHKCILaARCEVFRAMFLtGPQKESTQSPLVL----SDIEPEVFRAVLEFIYTNCVTL 83
                        90       100
                ....*....|....*....|....*...
gi 13957745 148 KPSRVISVLAGACMLQLDGLIQQCGETM 175
Cdd:cd18294  84 SNHTVIEVLAAAVEYGLDELRKLCERFI 111
BTB1_POZ_ABTB1_BPOZ1 cd18295
first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
70-176 1.27e-03

first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ankyrin repeat and BTB/POZ domain-containing protein 1 (ABTB1); ABTB1, also called elongation factor 1A-binding protein or bood POZ containing gene type 1 (BPOZ-1), is an anti-proliferative factor that may act as a mediator of the phosphatase and tensin homolog (PTEN) growth-suppressive signaling pathway. It may play a role in developmental processes. ABTB1 contains an ankyrin repeat and two BTB domains. This model corresponds to the first BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349604 [Multi-domain]  Cd Length: 119  Bit Score: 38.38  E-value: 1.27e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  70 QTLFLNGENSDIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKesNMMEINLEIPdqNIDTEALQVVFGSLYRDDVLIK 148
Cdd:cd18295  11 RRLLEQGSYSDVTFNVHGESFPAHRCILsARSPYFAEMFETKWK--DKREINLKHP--LVNPDAFRALLQYLYTGRLEIH 86
                        90       100       110
                ....*....|....*....|....*....|
gi 13957745 149 PSRVISV--LAGACmlQLDGLIQQCGETMK 176
Cdd:cd18295  87 VDDVEDCkrLAKQC--RLEELIEELEAKCK 114
BTB_POZ_BTBD2 cd18347
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
62-181 1.61e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 2 (BTBD2); BTBD2 is a BTB-domain-containing Kelch-like protein that interacts with DNA topoisomerase 1 (Topo1), a key enzyme of cell survival. BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349656 [Multi-domain]  Cd Length: 127  Bit Score: 38.52  E-value: 1.61e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  62 KSTSRYIYQTLFLNGENSDIRI---RALG-QEWNLHKVYLC-QSGYFSSMFSGSWKESNMmeiNLEIPDqnIDTEALQVV 136
Cdd:cd18347   6 KPTVQERFAFLFNNEVLSDVHFlvgKGLGsQRIPAHRFVLAvGSAVFDAMFNGGMATTST---EIELPD--VEPAAFLAL 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*
gi 13957745 137 FGSLYRDDVLIKPSRVISVLAGACMLQLDGLIQQCGETMKENISA 181
Cdd:cd18347  81 LKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRA 125
BTB_POZ_KLHL30 cd18259
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
70-186 1.79e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 30 (KLHL30); KLHL30 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349568 [Multi-domain]  Cd Length: 137  Bit Score: 38.66  E-value: 1.79e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  70 QTLFLNGENSDIRIRALGQEWNLHK--VYLCqSGYFSSMFSGSWKESnmMEINLEIPDqnIDTEALQVVFGSLYRDDVLI 147
Cdd:cd18259  24 QTLRSNPKLSDVTLLVGGREFPCHRsvLALC-SHYFNAMFTGDFVES--ISARVEIKD--VDPAVMESLIDFAYTGKLTI 98
                        90       100       110
                ....*....|....*....|....*....|....*....
gi 13957745 148 KPSRVISVLAGACMLQLDGLIQQCGETMKENISAKTVCG 186
Cdd:cd18259  99 NQGNVEALIRTSNRLQFPTVRKVCSRYLQQQIDATNCLG 137
PHA02713 PHA02713
hypothetical protein; Provisional
87-254 1.83e-03

hypothetical protein; Provisional


Pssm-ID: 165086 [Multi-domain]  Cd Length: 557  Bit Score: 40.76  E-value: 1.83e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745   87 GQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMM-EINLeipdQNIDTEALQVVFGSLYRDDvlIKPSRVISVLAGACMLQL 164
Cdd:PHA02713  35 GEEIKAHKTILAAgSKYFRTLFTTPMIIRDLVtRVNL----QMFDKDAVKNIVQYLYNRH--ISSMNVIDVLKCADYLLI 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  165 DGLIQQCGETMKENISAKTVCGYYHcaSIYGLD--SVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQSSDLFVMQV 242
Cdd:PHA02713 109 DDLVTDCESYIKDYTNHDTCIYMYH--RLYEMShiPIVKYIKRMLMSNIPTLITTDAFKKTVFEILFDIISTNDNVYLYR 186
                        170
                 ....*....|..
gi 13957745  243 EMDVYTALKKWM 254
Cdd:PHA02713 187 EGYKVTILLKWL 198
BTB_POZ_KLHL22 cd18251
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-171 2.37e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 22 (KLHL22); KLHL22 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex required for chromosome alignment and localization of polo-like kinase 1 (PLK1) at kinetochores. The BCR(KLHL22) ubiquitin ligase complex mediates mono-ubiquitination of PLK1, leading to PLK1 dissociation from phosphoreceptor proteins and subsequent removal from kinetochores, allowing silencing of the spindle assembly checkpoint (SAC) and chromosome segregation. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349560 [Multi-domain]  Cd Length: 125  Bit Score: 37.88  E-value: 2.37e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYLCQS-GYFSSMFSGSWKEsnmMEiNLEIPDQNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:cd18251  25 DVVLVVEGKPIEAHRILLAAScDYFRGMFAGGLRE---MQ-QTEVLIHGVSYNAMCKILDFIYTSELELSLDNVQETLTA 100
                        90
                ....*....|...
gi 13957745 159 ACMLQLDGLIQQC 171
Cdd:cd18251 101 ACQLQIPEVIGFC 113
BTB_POZ_ZBTB44 cd18228
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-179 2.78e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 44 (ZBTB44); ZBTB44, also called BTB/POZ domain-containing protein 15 (BTBD15) or zinc finger protein 851 (ZNF851), may be involved in transcriptional regulation. Single-nucleotide polymorphisms of ZBTB44 showed a suggestive association with disease progression of Crohn's disease. ZBTB44 has also preferentially been recognized by sera of patients with peripheral T-cell lymphoma (PTCL). It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349537 [Multi-domain]  Cd Length: 126  Bit Score: 37.92  E-value: 2.78e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKEsnmmEINLEIPDQN--IDTEALQVV-FGSL----YRDDVLIKPSR 151
Cdd:cd18228  21 DVTIRVQDKIFRAHKVVLaACSDFFRSKLVGQASP----RLVLVSPAGKcvLDLHHVTVTgFAPLleyaYTSTLSINTEN 96
                        90       100
                ....*....|....*....|....*...
gi 13957745 152 VISVLAGACMLQLDGLIQQCGETMKENI 179
Cdd:cd18228  97 IIDVLAAASYMQMFNVANTCSEFMKSSI 124
BTB_POZ_NS1BP cd18306
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
75-187 3.42e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Influenza virus NS1A-binding protein (NS1-BP); NS1-BP is also called NS1-binding protein, aryl hydrocarbon receptor-associated protein 3 (ARA3), or IVNS1ABP. It is a novel protein that interacts with the influenza A virus nonstructural NS1 protein, which is relocalized in the nuclei of infected cells. It plays a role in cell division and in the dynamic organization of the actin skeleton as a stabilizer of actin filaments by association with F-actin through its kelch repeats. It also interacts with alpha-enolase/MBP-1 and is involved in c-Myc gene transcriptional control. NS1-BP contains BTB and BACK domains at the N-terminal region and kelch repeats at the C-terminal region. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349615 [Multi-domain]  Cd Length: 124  Bit Score: 37.24  E-value: 3.42e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  75 NGENSDIRIRALGQEWNLHKVYL-CQSGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVLIKPSRVI 153
Cdd:cd18306  15 NRQFCDVILQVGGHEIPAHRAVLaCASPYLFELFSSDSDGESILTVKLD----GLDPDAVEVLVNYAYTSRLEVPADLVK 90
                        90       100       110
                ....*....|....*....|....*....|....
gi 13957745 154 SVLAGACMLQLDGLIQQCGETMKENISAKTVCGY 187
Cdd:cd18306  91 SVYSAAKKLKMDRVKKACGDFLLEKLTPQNCIGI 124
BTB_POZ_KLHL29_KBTBD9 cd18258
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
77-186 3.54e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 29 (KLHL29); KLHL29 is also called Kelch repeat and BTB domain-containing protein 9 (KBTBD9). A novel fusion transcript NR5A2-KLHL29FT, resulting from transchromosomal insertion, may influence the origin or progression of colon cancer. KLHL29 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349567 [Multi-domain]  Cd Length: 125  Bit Score: 37.26  E-value: 3.54e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  77 ENSDIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEiNLEIPDQNIDTEALQVVFGSLYRDDVLIKPSRVISV 155
Cdd:cd18258  16 EFTDLKIIVEGKEFEVHQNVLAScSLYFKDLIKRSSRDSGGGE-KLELTMSNINADVLELLLEFVYTGSLIIDSANAKTL 94
                        90       100       110
                ....*....|....*....|....*....|.
gi 13957745 156 LAGACMLQLDGLIQQCGETMKENISAKTVCG 186
Cdd:cd18258  95 LEAANKFQFHTFCKVCVSFLEKQLTASNCLG 125
BTB_POZ_KLHL40_KBTBD5 cd18340
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-171 5.06e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 40 (KLHL40); KLHL40, also called Kelch repeat and BTB domain-containing protein 5 (KBTBD5) or sarcosynapsin, is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a key regulator of skeletal muscle development. Mutations in KLHL40 may cause severe autosomal-recessive nemaline myopathy. KLHL40 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349649 [Multi-domain]  Cd Length: 134  Bit Score: 37.12  E-value: 5.06e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  80 DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:cd18340  29 DCVLKIKEKEFPCHRLVLAAcSPYFRAMFLSDLEESKKREIVLE----DVDPDVMGKILHYIYTSEIEITEQNVQDIFAA 104
                        90
                ....*....|...
gi 13957745 159 ACMLQLDGLIQQC 171
Cdd:cd18340 105 ANMFQIPSIFTVC 117
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH