NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|19031022|gb|AAK13058|]
View 

bZIP protein [Oryza sativa]

Protein Classification

DUF630 and DUF632 domain-containing protein (domain architecture ID 10521515)

DUF630 and DUF632 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DUF632 pfam04782
Protein of unknown function (DUF632); This plant protein may be a leucine zipper, but there is ...
325-631 2.63e-132

Protein of unknown function (DUF632); This plant protein may be a leucine zipper, but there is no experimental evidence for this.


:

Pssm-ID: 335894  Cd Length: 305  Bit Score: 394.26  E-value: 2.63e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   325 AEIVAAIEEYFVKAAEAGNGVSELLEASRAQLDRNFRQLKKTVYHSNSLLSSLSSTWTSKPPLAVrykldtNALEMESME 404
Cdd:pfam04782   1 LEVVKEIEDQFLKASESGKEVSKMLEAGKLHYHSSFAELKKSVYHSAKVLKVITWSRSSSSLSSS------DSSDEFCME 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   405 GKSHGSTLERLLAWEKKLYQEVKARESVKIEHEKKLSTLQSLEYRGRDSTKLDKTKASINKLQSLIIVTSQAATTTSSAI 484
Cdd:pfam04782  75 SGSHSSTLDKLYAWEKKLYDEVKAEEKIRIEYEKKCKLLRKQDARGAESSKIDKTRAAVKDLHTRIIVAIQSVDSISSRI 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   485 VRVRDNELAPQLVELCFALLSMWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVSAWHSNFNRLIKY 564
Cdd:pfam04782 155 EKLRDEELQPQLVELIQGLMRMWKTMLECHQKQLQIISEAKSLDSSTSAKPTSESHRQATLQLEAELRNWHSSFSKWIKA 234
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   565 QRDYIRALYGWLKLTLFQVDSN---IPQEAYTSLISRELTTFCDEWKQALDRLPDASASEAIKSFVNVVH 631
Cdd:pfam04782 235 QRSYVEALNGWLKLCLIPPEESskeKPSSTPVSFPAPPIFVLCNEWSQALDRLPEKEVSEAIKSFAAVVH 304
DUF630 pfam04783
Protein of unknown function (DUF630); This region is sometimes found at the N-terminus of ...
1-59 1.14e-25

Protein of unknown function (DUF630); This region is sometimes found at the N-terminus of putative plant bZIP proteins. Its function is not known. Structural modelling suggests this domain may bind nucleic acids.


:

Pssm-ID: 335895  Cd Length: 59  Bit Score: 99.85  E-value: 1.14e-25
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 19031022     1 MGCTASKVEQEDTVRRCKERRRHMKEAVASRQQLASAHADYLRSLRLTAAALSRFAQGH 59
Cdd:pfam04783   1 MGCSASKVDDEEAVALCRERKRLIKQAVDSRYALAAAHAAYIQSLRNVGAALRQFAEGE 59
 
Name Accession Description Interval E-value
DUF632 pfam04782
Protein of unknown function (DUF632); This plant protein may be a leucine zipper, but there is ...
325-631 2.63e-132

Protein of unknown function (DUF632); This plant protein may be a leucine zipper, but there is no experimental evidence for this.


Pssm-ID: 335894  Cd Length: 305  Bit Score: 394.26  E-value: 2.63e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   325 AEIVAAIEEYFVKAAEAGNGVSELLEASRAQLDRNFRQLKKTVYHSNSLLSSLSSTWTSKPPLAVrykldtNALEMESME 404
Cdd:pfam04782   1 LEVVKEIEDQFLKASESGKEVSKMLEAGKLHYHSSFAELKKSVYHSAKVLKVITWSRSSSSLSSS------DSSDEFCME 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   405 GKSHGSTLERLLAWEKKLYQEVKARESVKIEHEKKLSTLQSLEYRGRDSTKLDKTKASINKLQSLIIVTSQAATTTSSAI 484
Cdd:pfam04782  75 SGSHSSTLDKLYAWEKKLYDEVKAEEKIRIEYEKKCKLLRKQDARGAESSKIDKTRAAVKDLHTRIIVAIQSVDSISSRI 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   485 VRVRDNELAPQLVELCFALLSMWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVSAWHSNFNRLIKY 564
Cdd:pfam04782 155 EKLRDEELQPQLVELIQGLMRMWKTMLECHQKQLQIISEAKSLDSSTSAKPTSESHRQATLQLEAELRNWHSSFSKWIKA 234
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   565 QRDYIRALYGWLKLTLFQVDSN---IPQEAYTSLISRELTTFCDEWKQALDRLPDASASEAIKSFVNVVH 631
Cdd:pfam04782 235 QRSYVEALNGWLKLCLIPPEESskeKPSSTPVSFPAPPIFVLCNEWSQALDRLPEKEVSEAIKSFAAVVH 304
DUF630 pfam04783
Protein of unknown function (DUF630); This region is sometimes found at the N-terminus of ...
1-59 1.14e-25

Protein of unknown function (DUF630); This region is sometimes found at the N-terminus of putative plant bZIP proteins. Its function is not known. Structural modelling suggests this domain may bind nucleic acids.


Pssm-ID: 335895  Cd Length: 59  Bit Score: 99.85  E-value: 1.14e-25
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 19031022     1 MGCTASKVEQEDTVRRCKERRRHMKEAVASRQQLASAHADYLRSLRLTAAALSRFAQGH 59
Cdd:pfam04783   1 MGCSASKVDDEEAVALCRERKRLIKQAVDSRYALAAAHAAYIQSLRNVGAALRQFAEGE 59
 
Name Accession Description Interval E-value
DUF632 pfam04782
Protein of unknown function (DUF632); This plant protein may be a leucine zipper, but there is ...
325-631 2.63e-132

Protein of unknown function (DUF632); This plant protein may be a leucine zipper, but there is no experimental evidence for this.


Pssm-ID: 335894  Cd Length: 305  Bit Score: 394.26  E-value: 2.63e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   325 AEIVAAIEEYFVKAAEAGNGVSELLEASRAQLDRNFRQLKKTVYHSNSLLSSLSSTWTSKPPLAVrykldtNALEMESME 404
Cdd:pfam04782   1 LEVVKEIEDQFLKASESGKEVSKMLEAGKLHYHSSFAELKKSVYHSAKVLKVITWSRSSSSLSSS------DSSDEFCME 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   405 GKSHGSTLERLLAWEKKLYQEVKARESVKIEHEKKLSTLQSLEYRGRDSTKLDKTKASINKLQSLIIVTSQAATTTSSAI 484
Cdd:pfam04782  75 SGSHSSTLDKLYAWEKKLYDEVKAEEKIRIEYEKKCKLLRKQDARGAESSKIDKTRAAVKDLHTRIIVAIQSVDSISSRI 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   485 VRVRDNELAPQLVELCFALLSMWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVSAWHSNFNRLIKY 564
Cdd:pfam04782 155 EKLRDEELQPQLVELIQGLMRMWKTMLECHQKQLQIISEAKSLDSSTSAKPTSESHRQATLQLEAELRNWHSSFSKWIKA 234
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19031022   565 QRDYIRALYGWLKLTLFQVDSN---IPQEAYTSLISRELTTFCDEWKQALDRLPDASASEAIKSFVNVVH 631
Cdd:pfam04782 235 QRSYVEALNGWLKLCLIPPEESskeKPSSTPVSFPAPPIFVLCNEWSQALDRLPEKEVSEAIKSFAAVVH 304
DUF630 pfam04783
Protein of unknown function (DUF630); This region is sometimes found at the N-terminus of ...
1-59 1.14e-25

Protein of unknown function (DUF630); This region is sometimes found at the N-terminus of putative plant bZIP proteins. Its function is not known. Structural modelling suggests this domain may bind nucleic acids.


Pssm-ID: 335895  Cd Length: 59  Bit Score: 99.85  E-value: 1.14e-25
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 19031022     1 MGCTASKVEQEDTVRRCKERRRHMKEAVASRQQLASAHADYLRSLRLTAAALSRFAQGH 59
Cdd:pfam04783   1 MGCSASKVDDEEAVALCRERKRLIKQAVDSRYALAAAHAAYIQSLRNVGAALRQFAEGE 59
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH