NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|26454862|gb|AAH40945|]
View 

PCMTD2 protein [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PCMT super family cl30237
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);
11-193 2.21e-24

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);


The actual alignment was detected with superfamily member pfam01135:

Pssm-ID: 250389  Cd Length: 205  Bit Score: 98.21  E-value: 2.21e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    11 NDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHG-NIHLSAPCIYSEVMEALDLQPGLSFLNLGS 89
Cdd:pfam01135   3 NEALIENLKNYGVIKSDKVAEAMLAVDREEFVPESFKSYAYEDIPLSIGyGQTISAPHMHAMMLELLELKPGMRVLEIGS 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    90 GTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLdffiRTSDSFDKfdfcepSFVTGNCLEISPDCSQYDRVYCGAGV 169
Cdd:pfam01135  83 GSGYLTACFARMVGEVGRVVSIEHIPELVEIARRNL----EKLGLENV------IVVVGDGRQGWPEFAPYDAIHVGAAA 152
                         170       180
                  ....*....|....*....|....
gi 26454862   170 QKEHEEYMkNLLKVGGILVMPLEE 193
Cdd:pfam01135 153 PEIPEALI-DQLKEGGRLVIPVGP 175
 
Name Accession Description Interval E-value
PCMT pfam01135
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);
11-193 2.21e-24

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);


Pssm-ID: 250389  Cd Length: 205  Bit Score: 98.21  E-value: 2.21e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    11 NDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHG-NIHLSAPCIYSEVMEALDLQPGLSFLNLGS 89
Cdd:pfam01135   3 NEALIENLKNYGVIKSDKVAEAMLAVDREEFVPESFKSYAYEDIPLSIGyGQTISAPHMHAMMLELLELKPGMRVLEIGS 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    90 GTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLdffiRTSDSFDKfdfcepSFVTGNCLEISPDCSQYDRVYCGAGV 169
Cdd:pfam01135  83 GSGYLTACFARMVGEVGRVVSIEHIPELVEIARRNL----EKLGLENV------IVVVGDGRQGWPEFAPYDAIHVGAAA 152
                         170       180
                  ....*....|....*....|....
gi 26454862   170 QKEHEEYMkNLLKVGGILVMPLEE 193
Cdd:pfam01135 153 PEIPEALI-DQLKEGGRLVIPVGP 175
pimt TIGR00080
protein-L-isoaspartate(D-aspartate) O-methyltransferase; This is an all-kingdom (but not all ...
6-193 9.11e-19

protein-L-isoaspartate(D-aspartate) O-methyltransferase; This is an all-kingdom (but not all species) full-length ortholog enzyme for repairing aging proteins. Among the prokaryotes, the gene name is pcm. Among eukaryotes, pimt. [Protein fate, Protein modification and repair]


Pssm-ID: 272896  Cd Length: 215  Bit Score: 83.34  E-value: 9.11e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862     6 SAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHG-NIHLSAPCIYSEVMEALDLQPGLSF 84
Cdd:TIGR00080   2 DLESQKKALIDKLINEGYIKSKRVIDALLSVPREEFVPEHFKEYAYVDTPLEIGyGQTISAPHMVAMMTELLELKPGMKV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    85 LNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLdffiRTSDsfdkfdfcepsfvTGNCLEISPDCSQ----- 159
Cdd:TIGR00080  82 LEIGTGSGYQAAVLAEIVGRDGLVVSIERIPELAEKAERRL----RKLG-------------LDNVIVIVGDGTQgwepl 144
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 26454862   160 --YDRVYCGAGVQKEHEEYMKNLlKVGGILVMPLEE 193
Cdd:TIGR00080 145 apYDRIYVTAAGPKIPEALIDQL-KEGGILVMPVGE 179
Pcm COG2518
Protein-L-isoaspartate O-methyltransferase [Posttranslational modification, protein turnover, ...
24-195 7.15e-14

Protein-L-isoaspartate O-methyltransferase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 225316  Cd Length: 209  Bit Score: 69.20  E-value: 7.15e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862  24 IRTELVEQAFRAIDRADYYLEEFKENAYKDLA-WKHGNIHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGY----LSSMV 98
Cdd:COG2518  15 ITDERVLKAFLAVPRELFVPAAYKHLAYEDRAlPIGCGQTISAPHMVARMLQLLELKPGDRVLEIGTGSGYqaavLARLV 94
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862  99 GLIlgpfgvnHGVELHSDVIEYAKQKLdffirtsdsfDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVqKEHEEYMK 178
Cdd:COG2518  95 GRV-------VSIERIEELAEQARRNL----------ETLGYENVTVRHGDGSKGWPEEAPYDRIIVTAAA-PEVPEALL 156
                       170
                ....*....|....*..
gi 26454862 179 NLLKVGGILVMPLEEKP 195
Cdd:COG2518 157 DQLKPGGRLVIPVGSGP 173
PRK13942 PRK13942
protein-L-isoaspartate O-methyltransferase; Provisional
9-190 1.49e-13

protein-L-isoaspartate O-methyltransferase; Provisional


Pssm-ID: 184409  Cd Length: 212  Bit Score: 68.50  E-value: 1.49e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    9 EDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKD--LAWKHGNIhLSAPCIYSEVMEALDLQPGLSFLN 86
Cdd:PRK13942   4 EEKRRVIEELIREGYIKSKKVIDALLKVPRHLFVPEYLEEYAYVDtpLEIGYGQT-ISAIHMVAIMCELLDLKEGMKVLE 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862   87 LGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLdffirtsdsfDKFDFCEPSFVTGNCLEISPDCSQYDRVYCG 166
Cdd:PRK13942  83 IGTGSGYHAAVVAEIVGKSGKVVTIERIPELAEKAKKTL----------KKLGYDNVEVIVGDGTLGYEENAPYDRIYVT 152
                        170       180
                 ....*....|....*....|....
gi 26454862  167 AGVQKEHEEYMKNlLKVGGILVMP 190
Cdd:PRK13942 153 AAGPDIPKPLIEQ-LKDGGIMVIP 175
AdoMet_MTases cd02440
S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; ...
84-193 1.52e-04

S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).


Pssm-ID: 100107 [Multi-domain]  Cd Length: 107  Bit Score: 40.49  E-value: 1.52e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862  84 FLNLGSGTGYLSSmvGLILGPFGVNHGVELHSDVIEYAKQKLDFFirtsdsfdKFDFCEpsFVTGNCLEISPD-CSQYDR 162
Cdd:cd02440   2 VLDLGCGTGALAL--ALASGPGARVTGVDISPVALELARKAAAAL--------LADNVE--VLKGDAEELPPEaDESFDV 69
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 26454862 163 VYCGAGVQKEHEEY------MKNLLKVGGILVMPLEE 193
Cdd:cd02440  70 IISDPPLHHLVEDLarfleeARRLLKPGGVLVLTLVL 106
 
Name Accession Description Interval E-value
PCMT pfam01135
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);
11-193 2.21e-24

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);


Pssm-ID: 250389  Cd Length: 205  Bit Score: 98.21  E-value: 2.21e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    11 NDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHG-NIHLSAPCIYSEVMEALDLQPGLSFLNLGS 89
Cdd:pfam01135   3 NEALIENLKNYGVIKSDKVAEAMLAVDREEFVPESFKSYAYEDIPLSIGyGQTISAPHMHAMMLELLELKPGMRVLEIGS 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    90 GTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLdffiRTSDSFDKfdfcepSFVTGNCLEISPDCSQYDRVYCGAGV 169
Cdd:pfam01135  83 GSGYLTACFARMVGEVGRVVSIEHIPELVEIARRNL----EKLGLENV------IVVVGDGRQGWPEFAPYDAIHVGAAA 152
                         170       180
                  ....*....|....*....|....
gi 26454862   170 QKEHEEYMkNLLKVGGILVMPLEE 193
Cdd:pfam01135 153 PEIPEALI-DQLKEGGRLVIPVGP 175
pimt TIGR00080
protein-L-isoaspartate(D-aspartate) O-methyltransferase; This is an all-kingdom (but not all ...
6-193 9.11e-19

protein-L-isoaspartate(D-aspartate) O-methyltransferase; This is an all-kingdom (but not all species) full-length ortholog enzyme for repairing aging proteins. Among the prokaryotes, the gene name is pcm. Among eukaryotes, pimt. [Protein fate, Protein modification and repair]


Pssm-ID: 272896  Cd Length: 215  Bit Score: 83.34  E-value: 9.11e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862     6 SAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHG-NIHLSAPCIYSEVMEALDLQPGLSF 84
Cdd:TIGR00080   2 DLESQKKALIDKLINEGYIKSKRVIDALLSVPREEFVPEHFKEYAYVDTPLEIGyGQTISAPHMVAMMTELLELKPGMKV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    85 LNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLdffiRTSDsfdkfdfcepsfvTGNCLEISPDCSQ----- 159
Cdd:TIGR00080  82 LEIGTGSGYQAAVLAEIVGRDGLVVSIERIPELAEKAERRL----RKLG-------------LDNVIVIVGDGTQgwepl 144
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 26454862   160 --YDRVYCGAGVQKEHEEYMKNLlKVGGILVMPLEE 193
Cdd:TIGR00080 145 apYDRIYVTAAGPKIPEALIDQL-KEGGILVMPVGE 179
Pcm COG2518
Protein-L-isoaspartate O-methyltransferase [Posttranslational modification, protein turnover, ...
24-195 7.15e-14

Protein-L-isoaspartate O-methyltransferase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 225316  Cd Length: 209  Bit Score: 69.20  E-value: 7.15e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862  24 IRTELVEQAFRAIDRADYYLEEFKENAYKDLA-WKHGNIHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGY----LSSMV 98
Cdd:COG2518  15 ITDERVLKAFLAVPRELFVPAAYKHLAYEDRAlPIGCGQTISAPHMVARMLQLLELKPGDRVLEIGTGSGYqaavLARLV 94
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862  99 GLIlgpfgvnHGVELHSDVIEYAKQKLdffirtsdsfDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVqKEHEEYMK 178
Cdd:COG2518  95 GRV-------VSIERIEELAEQARRNL----------ETLGYENVTVRHGDGSKGWPEEAPYDRIIVTAAA-PEVPEALL 156
                       170
                ....*....|....*..
gi 26454862 179 NLLKVGGILVMPLEEKP 195
Cdd:COG2518 157 DQLKPGGRLVIPVGSGP 173
PRK13942 PRK13942
protein-L-isoaspartate O-methyltransferase; Provisional
9-190 1.49e-13

protein-L-isoaspartate O-methyltransferase; Provisional


Pssm-ID: 184409  Cd Length: 212  Bit Score: 68.50  E-value: 1.49e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    9 EDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKD--LAWKHGNIhLSAPCIYSEVMEALDLQPGLSFLN 86
Cdd:PRK13942   4 EEKRRVIEELIREGYIKSKKVIDALLKVPRHLFVPEYLEEYAYVDtpLEIGYGQT-ISAIHMVAIMCELLDLKEGMKVLE 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862   87 LGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLdffirtsdsfDKFDFCEPSFVTGNCLEISPDCSQYDRVYCG 166
Cdd:PRK13942  83 IGTGSGYHAAVVAEIVGKSGKVVTIERIPELAEKAKKTL----------KKLGYDNVEVIVGDGTLGYEENAPYDRIYVT 152
                        170       180
                 ....*....|....*....|....
gi 26454862  167 AGVQKEHEEYMKNlLKVGGILVMP 190
Cdd:PRK13942 153 AAGPDIPKPLIEQ-LKDGGIMVIP 175
methyltran_FxLD TIGR04364
methyltransferase, FxLD system; Members of this family resemble occur regularly in the ...
7-126 1.08e-11

methyltransferase, FxLD system; Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.


Pssm-ID: 275158  Cd Length: 394  Bit Score: 65.08  E-value: 1.08e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862     7 AGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAY---KDLAWK---HGNI--HLSAPCIYSEVMEALDL 78
Cdd:TIGR04364   1 AARLRAALVDELREDGVIRSPRVEAAFRTVPRHLFAPGAPLEKAYaanRAVVTKrdeDGRAlsSVSAPHIQAMMLEQAGV 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 26454862    79 QPGLSFLNLGSGtGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLD 126
Cdd:TIGR04364  81 EPGMRVLEIGSG-GYNAALLAELVGPSGEVTTVDIDEDVTDRARACLA 127
PRK13944 PRK13944
protein-L-isoaspartate O-methyltransferase; Provisional
14-126 4.75e-07

protein-L-isoaspartate O-methyltransferase; Provisional


Pssm-ID: 140001  Cd Length: 205  Bit Score: 49.43  E-value: 4.75e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862   14 LIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKD--LAWKHGNIhLSAPCIYSEVMEALDLQPGLSFLNLGSGT 91
Cdd:PRK13944   5 LVEELVREGIIKSERVKKAMLSVPREEFVMPEYRMMAYEDrpLPLFAGAT-ISAPHMVAMMCELIEPRPGMKILEVGTGS 83
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 26454862   92 GYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLD 126
Cdd:PRK13944  84 GYQAAVCAEAIERRGKVYTVEIVKELAIYAAQNIE 118
pcm PRK00312
protein-L-isoaspartate O-methyltransferase; Reviewed
14-193 8.41e-07

protein-L-isoaspartate O-methyltransferase; Reviewed


Pssm-ID: 178974  Cd Length: 212  Bit Score: 48.66  E-value: 8.41e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862   14 LIDNLKeAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLA-------WkhgnihLSAPCIYSEVMEALDLQPGLSFLN 86
Cdd:PRK00312  12 LVLRLR-AEGILDERVLEAIEATPRELFVPEAFKHKAYENRAlpigcgqT------ISQPYMVARMTELLELKPGDRVLE 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862   87 LGSGTGY----LSSMVGLILgpfgvnhGVELHSDVIEYAKQKL------DFFIRTSDSFDKFdfcePSFVTgncleispd 156
Cdd:PRK00312  85 IGTGSGYqaavLAHLVRRVF-------SVERIKTLQWEAKRRLkqlglhNVSVRHGDGWKGW----PAYAP--------- 144
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 26454862  157 csqYDRVYCGAGVQKEHEEYMkNLLKVGGILVMPLEE 193
Cdd:PRK00312 145 ---FDRILVTAAAPEIPRALL-EQLKEGGILVAPVGG 177
PRK13943 PRK13943
protein-L-isoaspartate O-methyltransferase; Provisional
64-194 1.35e-05

protein-L-isoaspartate O-methyltransferase; Provisional


Pssm-ID: 237568  Cd Length: 322  Bit Score: 45.99  E-value: 1.35e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862   64 SAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLdffirtsdsfDKFDFCEP 143
Cdd:PRK13943  64 SQPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNV----------RRLGIENV 133
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 26454862  144 SFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNlLKVGGILVMPLEEK 194
Cdd:PRK13943 134 IFVCGDGYYGVPEFAPYDVIFVTVGVDEVPETWFTQ-LKEGGRVIVPINLK 183
AdoMet_MTases cd02440
S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; ...
84-193 1.52e-04

S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).


Pssm-ID: 100107 [Multi-domain]  Cd Length: 107  Bit Score: 40.49  E-value: 1.52e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862  84 FLNLGSGTGYLSSmvGLILGPFGVNHGVELHSDVIEYAKQKLDFFirtsdsfdKFDFCEpsFVTGNCLEISPD-CSQYDR 162
Cdd:cd02440   2 VLDLGCGTGALAL--ALASGPGARVTGVDISPVALELARKAAAAL--------LADNVE--VLKGDAEELPPEaDESFDV 69
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 26454862 163 VYCGAGVQKEHEEY------MKNLLKVGGILVMPLEE 193
Cdd:cd02440  70 IISDPPLHHLVEDLarfleeARRLLKPGGVLVLTLVL 106
Methyltransf_25 pfam13649
Methyltransferase domain; This family appears to be a methyltransferase domain.
85-185 3.56e-03

Methyltransferase domain; This family appears to be a methyltransferase domain.


Pssm-ID: 338872 [Multi-domain]  Cd Length: 97  Bit Score: 36.02  E-value: 3.56e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    85 LNLGSGTGYLSSMVGLILGPFGVnHGVELHSDVIEYAKQKLdffirtsdsfdKFDFCEPSFVTGNCLEISPDCSQYDRVY 164
Cdd:pfam13649   2 LDLGCGTGRLALALARRGPNARV-TGVDLSPEMLERARERA-----------AEAGLNVEFVVGDAEDLPFPDGSFDLVV 69
                          90       100
                  ....*....|....*....|....*...
gi 26454862   165 CGAGVQ----KEHEEYMKNL---LKVGG 185
Cdd:pfam13649  70 SSGVLHhlpdPDLEAALREIarvLKPGG 97
Methyltransf_31 pfam13847
Methyltransferase domain; This family appears to have methyltransferase activity.
78-189 7.24e-03

Methyltransferase domain; This family appears to have methyltransferase activity.


Pssm-ID: 316372 [Multi-domain]  Cd Length: 150  Bit Score: 36.25  E-value: 7.24e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26454862    78 LQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQkldffIRTSDSFDKFDFCE------PSFVTGNCL 151
Cdd:pfam13847   1 LKKGLRVLDLGCGTGYLTFELAEELGPNAEVVGIDISEEAIEKARE-----NAQKLGFDNVEFEQgdieelPELLEDDSF 75
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 26454862   152 EISPDCSQYDRVYCGAGVQKEheeyMKNLLKVGGILVM 189
Cdd:pfam13847  76 DVIISNCVLNLIADPDKVLEE----ILRVLKPGGRLLI 109
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH