NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|9022433|gb|AAF82382|]
View 

putative copper chaperone Cox17 [Chlamydomonas reinhardtii]

Protein Classification

COX17 domain-containing protein (domain architecture ID 10523686)

COX17 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
COX17 pfam05051
Cytochrome C oxidase copper chaperone (COX17); Cox17 is essential for the assembly of ...
34-80 3.17e-19

Cytochrome C oxidase copper chaperone (COX17); Cox17 is essential for the assembly of functional cytochrome c oxidase (CCO) and for delivery of copper ions to the mitochondrion for insertion into the enzyme in yeast. The structure of Cox17 shows the protein to have an unstructured N-terminal region followed by two helices and several unstructured C-terminal residues. The Cu(I) binding site has been modelled as two-coordinate with ligation by conserved residues Cys23 and Cys26.


:

Pssm-ID: 309964  Cd Length: 47  Bit Score: 72.60  E-value: 3.17e-19
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
gi 9022433    34 KPKKICCSCPDTKKLRDTCIAERGEEHAYCQALIEAHKACLRVEGFK 80
Cdd:pfam05051  1 KKPKPCCACPETKKARDECILFNGEEDEKCKDLIEAHKACMRGYGFK 47
 
Name Accession Description Interval E-value
COX17 pfam05051
Cytochrome C oxidase copper chaperone (COX17); Cox17 is essential for the assembly of ...
34-80 3.17e-19

Cytochrome C oxidase copper chaperone (COX17); Cox17 is essential for the assembly of functional cytochrome c oxidase (CCO) and for delivery of copper ions to the mitochondrion for insertion into the enzyme in yeast. The structure of Cox17 shows the protein to have an unstructured N-terminal region followed by two helices and several unstructured C-terminal residues. The Cu(I) binding site has been modelled as two-coordinate with ligation by conserved residues Cys23 and Cys26.


Pssm-ID: 309964  Cd Length: 47  Bit Score: 72.60  E-value: 3.17e-19
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
gi 9022433    34 KPKKICCSCPDTKKLRDTCIAERGEEHAYCQALIEAHKACLRVEGFK 80
Cdd:pfam05051  1 KKPKPCCACPETKKARDECILFNGEEDEKCKDLIEAHKACMRGYGFK 47
 
Name Accession Description Interval E-value
COX17 pfam05051
Cytochrome C oxidase copper chaperone (COX17); Cox17 is essential for the assembly of ...
34-80 3.17e-19

Cytochrome C oxidase copper chaperone (COX17); Cox17 is essential for the assembly of functional cytochrome c oxidase (CCO) and for delivery of copper ions to the mitochondrion for insertion into the enzyme in yeast. The structure of Cox17 shows the protein to have an unstructured N-terminal region followed by two helices and several unstructured C-terminal residues. The Cu(I) binding site has been modelled as two-coordinate with ligation by conserved residues Cys23 and Cys26.


Pssm-ID: 309964  Cd Length: 47  Bit Score: 72.60  E-value: 3.17e-19
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
gi 9022433    34 KPKKICCSCPDTKKLRDTCIAERGEEHAYCQALIEAHKACLRVEGFK 80
Cdd:pfam05051  1 KKPKPCCACPETKKARDECILFNGEEDEKCKDLIEAHKACMRGYGFK 47
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH