NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|8100500|gb|AAF72330|]
View 

Ca2+-ATPase [Toxoplasma gondii]

Protein Classification

cation-translocating P-type ATPase (domain architecture ID 11550580)

cation-translocating P-type ATPase catalyzes the hydrolysis of ATP coupled with the translocation of cation, such as calcium or magnesium, from the cytosol out of the cell or into organelles

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
P-type_ATPase_Ca_PMCA-like cd02081
animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related ...
123-1097 0e+00

animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related Ca2(+)-ATPases including Saccharomyces cerevisiae vacuolar PMC1; Animal PMCAs function to export Ca(2+) from cells and play a role in regulating Ca(2+) signals following stimulus induction and in preventing calcium toxicity. Many PMCA pump variants exist due to alternative splicing of transcripts. PMCAs are regulated by the binding of calmodulin or by kinase-mediated phosphorylation. Saccharomyces cerevisiae vacuolar transporter Pmc1p facilitates the accumulation of Ca2+ into vacuoles. Pmc1p is not regulated by direct calmodulin binding but responds to the calmodulin/calcineurin-signaling pathway and is controlled by the transcription factor complex Tcn1p/Crz1p. Similarly, the expression of the gene for Dictyostelium discoideum Ca(2+)-ATPase PAT1, patA, is under the control of a calcineurin-dependent transcription factor. Plant vacuolar Ca(2+)-ATPases, are regulated by direct-calmodulin binding. Plant Ca(2+)-ATPases are present at various cellular locations including the plasma membrane, endoplasmic reticulum, chloroplast and vacuole. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


:

Pssm-ID: 319776 [Multi-domain]  Cd Length: 721  Bit Score: 1030.23  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   123 VQTQQRRFGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLALLF---SKEPEVEILEGIAIWVAVLVVVVVTA 199
Cdd:cd02081    1 LEHRREVYGKNEIPPKPPKSFLQLVWEALQDPTLIILLIAAIVSLGLGFYTpfgEGEGKTGWIEGVAILVAVILVVLVTA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   200 GNDWMKEQQFAKLSVVKDDKKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRK 279
Cdd:cd02081   81 GNDYQKEKQFRKLNSKKEDQKVTVIRDGEVIQISVFDIVVGDIVQLKYGDLIPADGLLIEGNDLKIDESSLTGESDPIKK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   280 APFQQclnealsretafssaldsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcttssacadtlkseggvctqlel 359
Cdd:cd02081  161 TPDNQ--------------------------------------------------------------------------- 165
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   360 arhheVASPVLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKLAYDAE-PTPLQRKLNALAEDIGTFGLISAVVAFFVLLL 438
Cdd:cd02081  166 -----IPDPFLLSGTKVLEGSGKMLVTAVGVNSQTGKIMTLLRAENEeKTPLQEKLTKLAVQIGKVGLIVAALTFIVLII 240
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   439 EFWVMYFLQDpsKRESAVDVVHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEI 518
Cdd:cd02081  241 RFIIDGFVND--GKSFSAEDLQEFVNFFIIAVTIIVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAI 318
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   519 CSDKTGTLTKNQMTVTQFWdgektfcipssrgeqtpgadplstgaegedvgddmslhaqdasrrgyiplsahstaassas 598
Cdd:cd02081  319 CSDKTGTLTQNRMTVVQGY------------------------------------------------------------- 337
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   599 phfaksscggaavseglaelqeknfkwevlmqaialnstafleteevvvaqgtgeetrftqvkhVGSPTECALLAFQDER 678
Cdd:cd02081  338 ----------------------------------------------------------------IGNKTECALLGFVLEL 353
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   679 cGGDYASTRRlylgEDEVELIAREDFSSDRKMMTSVVRILKnsgdstgatspaspGLLRVFVKGAGERVLAQCSSVLVAD 758
Cdd:cd02081  354 -GGDYRYREK----RPEEKVLKVYPFNSARKRMSTVVRLKD--------------GGYRLYVKGASEIVLKKCSYILNSD 414
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   759 QVIPLTPERKAEVEKTVVDAMAAEALRTICLAYRDIDPEREPDWRErcaaPHQMFMKGETQLTCLGIAGIEDPVRDEVPG 838
Cdd:cd02081  415 GEVVFLTSEKKEEIKRVIEPMASDSLRTIGLAYRDFSPDEEPTAER----DWDDEEDIESDLTFIGIVGIKDPLRPEVPE 490
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   839 AVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFHEESGGLAMLGPDFTRAIGGVVCQTCQTEvcacatdaktaeeqnkpl 918
Cdd:cd02081  491 AVAKCQRAGITVRMVTGDNINTARAIARECGILTEGEDGLVLEGKEFRELIDEEVGEVCQEK------------------ 552
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   919 rvdvvrdldaFDKIWTRLEVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIV 998
Cdd:cd02081  553 ----------FDKIWPKLRVLARSSPEDKYTLVKGLKDSGEVVAVTGDGTNDAPALKKADVGFAMGIAGTEVAKEASDII 622
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   999 MLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPTD 1078
Cdd:cd02081  623 LLDDNFSSIVKAVMWGRNVYDSIRKFLQFQLTVNVVAVILAFIGAVVTKDSPLTAVQMLWVNLIMDTLAALALATEPPTE 702
                        970
                 ....*....|....*....
gi 8100500  1079 DLLNRKPQGRDSYLISRSM 1097
Cdd:cd02081  703 DLLKRKPYGRDKPLISRTM 721
Cation_ATPase_C pfam00689
Cation transporting ATPase, C-terminus; Members of this families are involved in Na+/K+, H+/K+, ...
1048-1265 5.89e-28

Cation transporting ATPase, C-terminus; Members of this families are involved in Na+/K+, H+/K+, Ca++ and Mg++ transport. This family represents 5 transmembrane helices.


:

Pssm-ID: 307026 [Multi-domain]  Cd Length: 175  Bit Score: 111.56  E-value: 5.89e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    1048 EAPLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKPQGRDSYLISRSMLTSIVAASIYQLTVMIGLIFFGerflpetk 1127
Cdd:pfam00689    1 PLPLTPIQILWINLVTDGLPALALAFEPPEPDLMKRPPRKPDEPLFSRKLLRRILLQGLLIAIVTLLVFFLG-------- 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    1128 wtflsdedrrnlgfcefsdcdfgmytgtrmlsgrryklfsteddyklEWLREVGPSRHG-TFVFNTFVFMQIFNTINARd 1206
Cdd:pfam00689   73 -----------------------------------------------LLGYGISESQNAqTMAFNTLVLSQLFNALNAR- 104
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 8100500    1207 vddtqiekSTSLSAAILGMVRNPLGLGIWVLIVLGQVLMTEC--GGRLLGCHqeGLNREQW 1265
Cdd:pfam00689  105 --------SLRRSLFPIGLFSNKLLLLAVLLSLLLQLLIIYVpgLQAVFGTT--PLSLEQW 155
 
Name Accession Description Interval E-value
P-type_ATPase_Ca_PMCA-like cd02081
animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related ...
123-1097 0e+00

animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related Ca2(+)-ATPases including Saccharomyces cerevisiae vacuolar PMC1; Animal PMCAs function to export Ca(2+) from cells and play a role in regulating Ca(2+) signals following stimulus induction and in preventing calcium toxicity. Many PMCA pump variants exist due to alternative splicing of transcripts. PMCAs are regulated by the binding of calmodulin or by kinase-mediated phosphorylation. Saccharomyces cerevisiae vacuolar transporter Pmc1p facilitates the accumulation of Ca2+ into vacuoles. Pmc1p is not regulated by direct calmodulin binding but responds to the calmodulin/calcineurin-signaling pathway and is controlled by the transcription factor complex Tcn1p/Crz1p. Similarly, the expression of the gene for Dictyostelium discoideum Ca(2+)-ATPase PAT1, patA, is under the control of a calcineurin-dependent transcription factor. Plant vacuolar Ca(2+)-ATPases, are regulated by direct-calmodulin binding. Plant Ca(2+)-ATPases are present at various cellular locations including the plasma membrane, endoplasmic reticulum, chloroplast and vacuole. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319776 [Multi-domain]  Cd Length: 721  Bit Score: 1030.23  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   123 VQTQQRRFGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLALLF---SKEPEVEILEGIAIWVAVLVVVVVTA 199
Cdd:cd02081    1 LEHRREVYGKNEIPPKPPKSFLQLVWEALQDPTLIILLIAAIVSLGLGFYTpfgEGEGKTGWIEGVAILVAVILVVLVTA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   200 GNDWMKEQQFAKLSVVKDDKKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRK 279
Cdd:cd02081   81 GNDYQKEKQFRKLNSKKEDQKVTVIRDGEVIQISVFDIVVGDIVQLKYGDLIPADGLLIEGNDLKIDESSLTGESDPIKK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   280 APFQQclnealsretafssaldsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcttssacadtlkseggvctqlel 359
Cdd:cd02081  161 TPDNQ--------------------------------------------------------------------------- 165
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   360 arhheVASPVLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKLAYDAE-PTPLQRKLNALAEDIGTFGLISAVVAFFVLLL 438
Cdd:cd02081  166 -----IPDPFLLSGTKVLEGSGKMLVTAVGVNSQTGKIMTLLRAENEeKTPLQEKLTKLAVQIGKVGLIVAALTFIVLII 240
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   439 EFWVMYFLQDpsKRESAVDVVHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEI 518
Cdd:cd02081  241 RFIIDGFVND--GKSFSAEDLQEFVNFFIIAVTIIVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAI 318
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   519 CSDKTGTLTKNQMTVTQFWdgektfcipssrgeqtpgadplstgaegedvgddmslhaqdasrrgyiplsahstaassas 598
Cdd:cd02081  319 CSDKTGTLTQNRMTVVQGY------------------------------------------------------------- 337
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   599 phfaksscggaavseglaelqeknfkwevlmqaialnstafleteevvvaqgtgeetrftqvkhVGSPTECALLAFQDER 678
Cdd:cd02081  338 ----------------------------------------------------------------IGNKTECALLGFVLEL 353
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   679 cGGDYASTRRlylgEDEVELIAREDFSSDRKMMTSVVRILKnsgdstgatspaspGLLRVFVKGAGERVLAQCSSVLVAD 758
Cdd:cd02081  354 -GGDYRYREK----RPEEKVLKVYPFNSARKRMSTVVRLKD--------------GGYRLYVKGASEIVLKKCSYILNSD 414
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   759 QVIPLTPERKAEVEKTVVDAMAAEALRTICLAYRDIDPEREPDWRErcaaPHQMFMKGETQLTCLGIAGIEDPVRDEVPG 838
Cdd:cd02081  415 GEVVFLTSEKKEEIKRVIEPMASDSLRTIGLAYRDFSPDEEPTAER----DWDDEEDIESDLTFIGIVGIKDPLRPEVPE 490
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   839 AVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFHEESGGLAMLGPDFTRAIGGVVCQTCQTEvcacatdaktaeeqnkpl 918
Cdd:cd02081  491 AVAKCQRAGITVRMVTGDNINTARAIARECGILTEGEDGLVLEGKEFRELIDEEVGEVCQEK------------------ 552
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   919 rvdvvrdldaFDKIWTRLEVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIV 998
Cdd:cd02081  553 ----------FDKIWPKLRVLARSSPEDKYTLVKGLKDSGEVVAVTGDGTNDAPALKKADVGFAMGIAGTEVAKEASDII 622
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   999 MLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPTD 1078
Cdd:cd02081  623 LLDDNFSSIVKAVMWGRNVYDSIRKFLQFQLTVNVVAVILAFIGAVVTKDSPLTAVQMLWVNLIMDTLAALALATEPPTE 702
                        970
                 ....*....|....*....
gi 8100500  1079 DLLNRKPQGRDSYLISRSM 1097
Cdd:cd02081  703 DLLKRKPYGRDKPLISRTM 721
ATPase-IIB_Ca TIGR01517
plasma-membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
125-1266 0e+00

plasma-membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes, out of the cell. In some organisms, this type of pump may also be found in vacuolar membranes. In humans and mice, at least, there are multiple isoforms of the PMCA pump with overlapping but not redundant functions. Accordingly, there are no human diseases linked to PMCA defects, although alterations of PMCA function do elicit physiological effects. The calcium P-type ATPases have been characterized as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump. A separate analysis divides Type IIA into sub-types (SERCA and PMR1) which are represented by two corresponding models (TIGR01116 and TIGR01522). This model is well separated from those.


Pssm-ID: 273668 [Multi-domain]  Cd Length: 956  Bit Score: 764.32  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     125 TQQRR---FGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLALLF------SKEPEVEILEGIAIWVAVLVVV 195
Cdd:TIGR01517   66 TLERRekvYGKNELPEKPPKSFLQIVWAALSDQTLILLSVAAVVSLVLGLYVpsvgedKADTETGWIEGVAILVSVILVV 145
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     196 VVTAGNDWMKEQQFAKLSVVKDDKKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESD 275
Cdd:TIGR01517  146 LVTAVNDYKKELQFRQLNREKSAQKIAVIRGGQEQQISIHDIVVGDIVSLSTGDVVPADGVFISGLSLEIDESSITGESD 225
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     276 MIRKAPFQqclnealsretafssaldsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcttssacadtlkseggvct 355
Cdd:TIGR01517  226 PIKKGPVQ------------------------------------------------------------------------ 233
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     356 qlelarhhevaSPVLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKLAYDAEP-TPLQRKLNALAEDIGTFGLISAVVAFF 434
Cdd:TIGR01517  234 -----------DPFLLSGTVVNEGSGRMLVTAVGVNSFGGKLMMELRQAGEEeTPLQEKLSELAGLIGKFGMGSAVLLFL 302
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     435 VLLLEFWVMYFLQDPSKRESAVDVVHdHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGG 514
Cdd:TIGR01517  303 VLSLRYVFRIIRGDGRFEDTEEDAQT-FLDHFIIAVTIVVVAVPEGLPLAVTIALAYSMKKMMKDNNLVRHLAACETMGS 381
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     515 ANEICSDKTGTLTKNQMTVTQFWDGEKTFCIpssrgeqtpgadplstgaEGEDVGDDMSLHAQDasrrgyiplsahstaa 594
Cdd:TIGR01517  382 ATAICSDKTGTLTQNVMSVVQGYIGEQRFNV------------------RDEIVLRNLPAAVRN---------------- 427
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     595 ssasphfaksscggaavseglaelqeknfkweVLMQAIALNSTAfletEEVVVAQGtgeetrftQVKHVGSPTECALLAF 674
Cdd:TIGR01517  428 --------------------------------ILVEGISLNSSS----EEVVDRGG--------KRAFIGSKTECALLDF 463
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     675 QDeRCGGDYASTRRLYLGEDEVELIAredFSSDRKMMTSVVrilKNSGdstgatspaspGLLRVFVKGAGERVLAQCSSV 754
Cdd:TIGR01517  464 GL-LLLLQSRDVQEVRAEEKVVKIYP---FNSERKFMSVVV---KHSG-----------GKYREFRKGASEIVLKPCRKR 525
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     755 L-VADQVIPLTPERKAEVEkTVVDAMAAEALRTICLAYRDIDPEREPDWRercaaphqmfmKGETQLTCLGIAGIEDPVR 833
Cdd:TIGR01517  526 LdSNGEATPISEDDKDRCA-DVIEPLASDALRTICLAYRDFAPEEFPRKD-----------YPNKGLTLIGVVGIKDPLR 593
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     834 DEVPGAVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFHEesGGLAMLGPDFTRAIggvvcqtcqtevcacatdaktaee 913
Cdd:TIGR01517  594 PGVREAVQECQRAGITVRMVTGDNIDTAKAIARNCGILTF--GGLAMEGKEFRSLV------------------------ 647
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     914 QNKplrvdvvrdldaFDKIWTRLEVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQ 993
Cdd:TIGR01517  648 YEE------------MDPILPKLRVLARSSPLDKQLLVLMLKDMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAKE 715
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     994 AADIVMLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVV--CTAVQREAPLSAVQMLWVNLIMDSFASLAL 1071
Cdd:TIGR01517  716 ASDIILLDDNFASIVRAVKWGRNVYDNIRKFLQFQLTVNVVAVILTFVgsCISSSHTSPLTAVQLLWVNLIMDTLAALAL 795
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    1072 ATESPTDDLLNRKPQGRDSYLISRSMLTSIVAASIYQLTVMIGLIFFGErflpetKWTFLSDEDRRNLGfcefsdcdfgm 1151
Cdd:TIGR01517  796 ATEPPTEALLDRKPIGRNAPLISRSMWKNILGQAGYQLVVTFILLFAGG------SIFDVSGPDEITSH----------- 858
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    1152 ytgtrmlsgrryklfsteddyklewlrevGPSRHGTFVFNTFVFMQIFNTINARdvddtQIEKSTSLsaaILGMVRNPLG 1231
Cdd:TIGR01517  859 -----------------------------QQGELNTIVFNTFVLLQLFNEINAR-----KLYEGMNV---FEGLFKNRIF 901
                         1130      1140      1150
                   ....*....|....*....|....*....|....*
gi 8100500    1232 LGIWVLIVLGQVLMTECGGRLLGCHQegLNREQWM 1266
Cdd:TIGR01517  902 VTIMGFTFGFQVIIVEFGGSFFSTVS--LSIEQWI 934
MgtA COG0474
Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];
123-1246 5.26e-175

Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];


Pssm-ID: 223550 [Multi-domain]  Cd Length: 917  Bit Score: 545.39  E-value: 5.26e-175
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   123 VQTQQRRFGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLALLFSKEPEVeilegIAIWVAVLVVVVVTAGND 202
Cdd:COG0474   50 VKRRLKKYGPNELPEEKKRSLLKKFLRQFKDPFIILLLVAALLSAFVGDWVDAGVDA-----IVILLVVVINALLGFVQE 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   203 WMKEQ---QFAKLSvvkdDKKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRK 279
Cdd:COG0474  125 YRAEKaleALKKMS----SPKAKVLRDGKFVEIPASELVPGDIVLLEAGDVVPADLRLLESSDLEVDESALTGESLPVEK 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   280 apfqqclnealsretafssaldsaenlpapgssvdhrrrsrgsfgapssgaplQAQTCTTSSAcadtlkseggvctQLEL 359
Cdd:COG0474  201 -----------------------------------------------------QALPLTKSDA-------------PLGL 214
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   360 ARHHevaspVLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKLAY-DAEPTPLQRKLNALAEDIGTFGLISAVVAFFVLLl 438
Cdd:COG0474  215 DRDN-----MLFSGTTVVSGRAKGIVVATGFETEFGKIARLLPTkKEVKTPLQRKLNKLGKFLLVLALVLGALVFVVGL- 288
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   439 efwvmyFLQDPSKRESavdvvhdhvefFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEI 518
Cdd:COG0474  289 ------FRGGNGLLES-----------FLTALALAVAAVPEGLPAVVTIALALGAQRMAKDNAIVRSLNAIETLGSVDVI 351
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   519 CSDKTGTLTKNQMTVTQFWDGEKTFCIpssrgeqtpgadplstgaegedvgDDMSLHAQDASRRgyiplsahstaassas 598
Cdd:COG0474  352 CSDKTGTLTQNKMTVKKIYINGGGKDI------------------------DDKDLKDSPALLR---------------- 391
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   599 phfaksscggaavseglaelqeknfkwevLMQAIALNSTAFLETEEVVVAqgtgeetrftqvkhvGSPTECALLAFQDEr 678
Cdd:COG0474  392 -----------------------------FLLAAALCNSVTPEKNGWYQA---------------GDPTEGALVEFAEK- 426
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   679 cgGDYASTRRLYlgEDEVELIAREDFSSDRKMMTSVVRilknsgdstgatspASPGLLRVFVKGAGERVLAQCSSVlvaD 758
Cdd:COG0474  427 --LGFSLDLSGL--EVEYPILAEIPFDSERKRMSVIVK--------------TDEGKYILFVKGAPEVILERCKSI---G 485
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   759 QVIPLTPERKAEVEKtVVDAMAAEALRTICLAYRDIDPEREPDWRErcaaphqmfmKGETQLTCLGIAGIEDPVRDEVPG 838
Cdd:COG0474  486 ELEPLTEEGLRTLEE-AVKELASEGLRVLAVAYKKLDRAEKDDEVD----------EIESDLVFLGLTGIEDPPREDVKE 554
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   839 AVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFHEESGGLAMLGPDFTRAIGgvvcqtcqtevcacatdaktaeeqnkpl 918
Cdd:COG0474  555 AIEELREAGIKVWMITGDHVETAIAIAKECGIEAEAESALVIDGAELDALSD---------------------------- 606
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   919 rvdvvrdlDAFDKIWTRLEVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIV 998
Cdd:COG0474  607 --------EELAELVEELSVFARVSPEQKARIVEALQKSGHVVAMTGDGVNDAPALKAADVGIAMGGEGTDAAKEAADIV 678
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   999 MLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQRE-APLSAVQMLWVNLIMDSFASLALATESPT 1077
Cdd:COG0474  679 LLDDNFATIVLAVVEGRRVYVNIKKFILYLLSKNVGEVLTLLIYSLFNLFfLPLTPLQLLWINLLTDSLPALALGVEDPE 758
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500  1078 DDLLNRKPQGRDSYLISRSMLTSIVAASIYQLTVMIGLIFFGERFlpetkwtflsdedrrnlgfcefsdcdfgmytgtrm 1157
Cdd:COG0474  759 SDVMKRPPRGPEEGLFNRKIFWRFILIIGLLSAILFILTFLLYLL----------------------------------- 803
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500  1158 lsgrryklfstEDDYKLEWLREVGPSRHgTFVFNTFVFMQIFNTINARDVddtqiekstSLSAAILGMVRNPlglGIWVL 1237
Cdd:COG0474  804 -----------GFIANTLGLDLFQALLQ-TTAFTVLVLIQLLLTLAVRSR---------GRPFLSSLLFSNK---YLWLA 859

                 ....*....
gi 8100500  1238 IVLGQVLMT 1246
Cdd:COG0474  860 LLVIIILQL 868
PRK10517 PRK10517
magnesium-transporting ATPase MgtA; Provisional
222-1098 6.09e-43

magnesium-transporting ATPase MgtA; Provisional


Pssm-ID: 236705 [Multi-domain]  Cd Length: 902  Bit Score: 170.25  E-value: 6.09e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    222 TVVRSG------HKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRKApfqqclneALSRETA 295
Cdd:PRK10517  162 TVLRVIndkgenGWLEIPIDQLVPGDIIKLAAGDMIPADLRILQARDLFVAQASLTGESLPVEKF--------ATTRQPE 233
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    296 FSSALDsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcttssacADTLkseggvctqlelarhhevaspvLLSGTT 375
Cdd:PRK10517  234 HSNPLE------------------------------------------CDTL----------------------CFMGTN 249
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    376 VSTGSGTALVVAVGRYSQVGQMFQKL-AYDAEPTPLQRKLNALAEDIGTFGLisaVVAFFVLLLEFWvmyflqdpSKres 454
Cdd:PRK10517  250 VVSGTAQAVVIATGANTWFGQLAGRVsEQDSEPNAFQQGISRVSWLLIRFML---VMAPVVLLINGY--------TK--- 315
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    455 avdvvHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVT 534
Cdd:PRK10517  316 -----GDWWEAALFALSVAVGLTPEMLPMIVTSTLARGAVKLSKQKVIVKRLDAIQNFGAMDILCTDKTGTLTQDKIVLE 390
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    535 QfwdgektfcipssrgeqtpgadplSTGAEGEDvgddmslhaqdasrrgyiplsahstaassasphfaksscggaavSEg 614
Cdd:PRK10517  391 N------------------------HTDISGKT--------------------------------------------SE- 401
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    615 laelqeknfkwEVLMQAIaLNS---TAFLETEEVVVAQGTGEETRFtqvkhvgsptecallafqdeRCGGDYastRRLyl 691
Cdd:PRK10517  402 -----------RVLHSAW-LNShyqTGLKNLLDTAVLEGVDEESAR--------------------SLASRW---QKI-- 444
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    692 geDEVELiareDFssDRKMMTSVVRilknsgdstgatSPASPGLLrvFVKGAGERVLAQCSSVLVADQVIPLTPERKAEV 771
Cdd:PRK10517  445 --DEIPF----DF--ERRRMSVVVA------------ENTEHHQL--ICKGALEEILNVCSQVRHNGEIVPLDDIMLRRI 502
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    772 EKtVVDAMAAEALRTICLAYRDIdPEREPDWRercaaphqmfMKGETQLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVR 851
Cdd:PRK10517  503 KR-VTDTLNRQGLRVVAVATKYL-PAREGDYQ----------RADESDLILEGYIAFLDPPKETTAPALKALKASGVTVK 570
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    852 MVTGDNIITAkaiAKRCeifHEesgglamLGPDFTRAIGGVVCQTCQTEVCACATDAKTaeeqnkplrvdvvrdldafdk 931
Cdd:PRK10517  571 ILTGDSELVA---AKVC---HE-------VGLDAGEVLIGSDIETLSDDELANLAERTT--------------------- 616
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    932 iwtrleVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGlSGKEVAKQAADIVMLDDNFTCIVKAV 1011
Cdd:PRK10517  617 ------LFARLTPMHKERIVTLLKREGHVVGFMGDGINDAPALRAADIGISVD-GAVDIAREAADIILLEKSLMVLEEGV 689
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   1012 KWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDsFASLALATESPTDDLLnRKPQGRDSY 1091
Cdd:PRK10517  690 IEGRRTFANMLKYIKMTASSNFGNVFSVLVASAFLPFLPMLPLHLLIQNLLYD-VSQVAIPFDNVDDEQI-QKPQRWNPA 767

                  ....*..
gi 8100500   1092 LISRSML 1098
Cdd:PRK10517  768 DLGRFMV 774
E1-E2_ATPase pfam00122
E1-E2 ATPase;
220-498 2.08e-28

E1-E2 ATPase;


Pssm-ID: 333857 [Multi-domain]  Cd Length: 178  Bit Score: 113.04  E-value: 2.08e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     220 KCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLtVDESSLTGESDMIRKapfqqclnealsretafssa 299
Cdd:pfam00122    3 TATVLRDGTEEEIPADELVPGDIVLLKPGERVPADGRIVEGSAS-VDESALTGESLPVEK-------------------- 61
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     300 ldsaenlpapgssvdhrrrSRGSFgapssgaplqaqtcttssacadtlkseggvctqlelarhhevaspvLLSGTTVSTG 379
Cdd:pfam00122   62 -------------------EKGDM----------------------------------------------VFSGTVVVSG 76
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     380 SGTALVVAVGRYSQVGQMFQKLAY-DAEPTPLQRKLNALAEDIGTFGLISAVVAFFVLLLefwvmyflqdpskresavdV 458
Cdd:pfam00122   77 SAKAVVTATGEDTELGKIARLVEEaKSKKTPLQRLLDKLAKYFTPVVLLLALAVFLLWLF-------------------V 137
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|
gi 8100500     459 VHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLR 498
Cdd:pfam00122  138 GGPPLEALLRALALLVAACPCALPLATPLALALGARRLAK 177
Cation_ATPase_C pfam00689
Cation transporting ATPase, C-terminus; Members of this families are involved in Na+/K+, H+/K+, ...
1048-1265 5.89e-28

Cation transporting ATPase, C-terminus; Members of this families are involved in Na+/K+, H+/K+, Ca++ and Mg++ transport. This family represents 5 transmembrane helices.


Pssm-ID: 307026 [Multi-domain]  Cd Length: 175  Bit Score: 111.56  E-value: 5.89e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    1048 EAPLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKPQGRDSYLISRSMLTSIVAASIYQLTVMIGLIFFGerflpetk 1127
Cdd:pfam00689    1 PLPLTPIQILWINLVTDGLPALALAFEPPEPDLMKRPPRKPDEPLFSRKLLRRILLQGLLIAIVTLLVFFLG-------- 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    1128 wtflsdedrrnlgfcefsdcdfgmytgtrmlsgrryklfsteddyklEWLREVGPSRHG-TFVFNTFVFMQIFNTINARd 1206
Cdd:pfam00689   73 -----------------------------------------------LLGYGISESQNAqTMAFNTLVLSQLFNALNAR- 104
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 8100500    1207 vddtqiekSTSLSAAILGMVRNPLGLGIWVLIVLGQVLMTEC--GGRLLGCHqeGLNREQW 1265
Cdd:pfam00689  105 --------SLRRSLFPIGLFSNKLLLLAVLLSLLLQLLIIYVpgLQAVFGTT--PLSLEQW 155
 
Name Accession Description Interval E-value
P-type_ATPase_Ca_PMCA-like cd02081
animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related ...
123-1097 0e+00

animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related Ca2(+)-ATPases including Saccharomyces cerevisiae vacuolar PMC1; Animal PMCAs function to export Ca(2+) from cells and play a role in regulating Ca(2+) signals following stimulus induction and in preventing calcium toxicity. Many PMCA pump variants exist due to alternative splicing of transcripts. PMCAs are regulated by the binding of calmodulin or by kinase-mediated phosphorylation. Saccharomyces cerevisiae vacuolar transporter Pmc1p facilitates the accumulation of Ca2+ into vacuoles. Pmc1p is not regulated by direct calmodulin binding but responds to the calmodulin/calcineurin-signaling pathway and is controlled by the transcription factor complex Tcn1p/Crz1p. Similarly, the expression of the gene for Dictyostelium discoideum Ca(2+)-ATPase PAT1, patA, is under the control of a calcineurin-dependent transcription factor. Plant vacuolar Ca(2+)-ATPases, are regulated by direct-calmodulin binding. Plant Ca(2+)-ATPases are present at various cellular locations including the plasma membrane, endoplasmic reticulum, chloroplast and vacuole. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319776 [Multi-domain]  Cd Length: 721  Bit Score: 1030.23  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   123 VQTQQRRFGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLALLF---SKEPEVEILEGIAIWVAVLVVVVVTA 199
Cdd:cd02081    1 LEHRREVYGKNEIPPKPPKSFLQLVWEALQDPTLIILLIAAIVSLGLGFYTpfgEGEGKTGWIEGVAILVAVILVVLVTA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   200 GNDWMKEQQFAKLSVVKDDKKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRK 279
Cdd:cd02081   81 GNDYQKEKQFRKLNSKKEDQKVTVIRDGEVIQISVFDIVVGDIVQLKYGDLIPADGLLIEGNDLKIDESSLTGESDPIKK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   280 APFQQclnealsretafssaldsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcttssacadtlkseggvctqlel 359
Cdd:cd02081  161 TPDNQ--------------------------------------------------------------------------- 165
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   360 arhheVASPVLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKLAYDAE-PTPLQRKLNALAEDIGTFGLISAVVAFFVLLL 438
Cdd:cd02081  166 -----IPDPFLLSGTKVLEGSGKMLVTAVGVNSQTGKIMTLLRAENEeKTPLQEKLTKLAVQIGKVGLIVAALTFIVLII 240
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   439 EFWVMYFLQDpsKRESAVDVVHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEI 518
Cdd:cd02081  241 RFIIDGFVND--GKSFSAEDLQEFVNFFIIAVTIIVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAI 318
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   519 CSDKTGTLTKNQMTVTQFWdgektfcipssrgeqtpgadplstgaegedvgddmslhaqdasrrgyiplsahstaassas 598
Cdd:cd02081  319 CSDKTGTLTQNRMTVVQGY------------------------------------------------------------- 337
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   599 phfaksscggaavseglaelqeknfkwevlmqaialnstafleteevvvaqgtgeetrftqvkhVGSPTECALLAFQDER 678
Cdd:cd02081  338 ----------------------------------------------------------------IGNKTECALLGFVLEL 353
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   679 cGGDYASTRRlylgEDEVELIAREDFSSDRKMMTSVVRILKnsgdstgatspaspGLLRVFVKGAGERVLAQCSSVLVAD 758
Cdd:cd02081  354 -GGDYRYREK----RPEEKVLKVYPFNSARKRMSTVVRLKD--------------GGYRLYVKGASEIVLKKCSYILNSD 414
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   759 QVIPLTPERKAEVEKTVVDAMAAEALRTICLAYRDIDPEREPDWRErcaaPHQMFMKGETQLTCLGIAGIEDPVRDEVPG 838
Cdd:cd02081  415 GEVVFLTSEKKEEIKRVIEPMASDSLRTIGLAYRDFSPDEEPTAER----DWDDEEDIESDLTFIGIVGIKDPLRPEVPE 490
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   839 AVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFHEESGGLAMLGPDFTRAIGGVVCQTCQTEvcacatdaktaeeqnkpl 918
Cdd:cd02081  491 AVAKCQRAGITVRMVTGDNINTARAIARECGILTEGEDGLVLEGKEFRELIDEEVGEVCQEK------------------ 552
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   919 rvdvvrdldaFDKIWTRLEVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIV 998
Cdd:cd02081  553 ----------FDKIWPKLRVLARSSPEDKYTLVKGLKDSGEVVAVTGDGTNDAPALKKADVGFAMGIAGTEVAKEASDII 622
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   999 MLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPTD 1078
Cdd:cd02081  623 LLDDNFSSIVKAVMWGRNVYDSIRKFLQFQLTVNVVAVILAFIGAVVTKDSPLTAVQMLWVNLIMDTLAALALATEPPTE 702
                        970
                 ....*....|....*....
gi 8100500  1079 DLLNRKPQGRDSYLISRSM 1097
Cdd:cd02081  703 DLLKRKPYGRDKPLISRTM 721
ATPase-IIB_Ca TIGR01517
plasma-membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
125-1266 0e+00

plasma-membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes, out of the cell. In some organisms, this type of pump may also be found in vacuolar membranes. In humans and mice, at least, there are multiple isoforms of the PMCA pump with overlapping but not redundant functions. Accordingly, there are no human diseases linked to PMCA defects, although alterations of PMCA function do elicit physiological effects. The calcium P-type ATPases have been characterized as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump. A separate analysis divides Type IIA into sub-types (SERCA and PMR1) which are represented by two corresponding models (TIGR01116 and TIGR01522). This model is well separated from those.


Pssm-ID: 273668 [Multi-domain]  Cd Length: 956  Bit Score: 764.32  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     125 TQQRR---FGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLALLF------SKEPEVEILEGIAIWVAVLVVV 195
Cdd:TIGR01517   66 TLERRekvYGKNELPEKPPKSFLQIVWAALSDQTLILLSVAAVVSLVLGLYVpsvgedKADTETGWIEGVAILVSVILVV 145
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     196 VVTAGNDWMKEQQFAKLSVVKDDKKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESD 275
Cdd:TIGR01517  146 LVTAVNDYKKELQFRQLNREKSAQKIAVIRGGQEQQISIHDIVVGDIVSLSTGDVVPADGVFISGLSLEIDESSITGESD 225
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     276 MIRKAPFQqclnealsretafssaldsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcttssacadtlkseggvct 355
Cdd:TIGR01517  226 PIKKGPVQ------------------------------------------------------------------------ 233
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     356 qlelarhhevaSPVLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKLAYDAEP-TPLQRKLNALAEDIGTFGLISAVVAFF 434
Cdd:TIGR01517  234 -----------DPFLLSGTVVNEGSGRMLVTAVGVNSFGGKLMMELRQAGEEeTPLQEKLSELAGLIGKFGMGSAVLLFL 302
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     435 VLLLEFWVMYFLQDPSKRESAVDVVHdHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGG 514
Cdd:TIGR01517  303 VLSLRYVFRIIRGDGRFEDTEEDAQT-FLDHFIIAVTIVVVAVPEGLPLAVTIALAYSMKKMMKDNNLVRHLAACETMGS 381
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     515 ANEICSDKTGTLTKNQMTVTQFWDGEKTFCIpssrgeqtpgadplstgaEGEDVGDDMSLHAQDasrrgyiplsahstaa 594
Cdd:TIGR01517  382 ATAICSDKTGTLTQNVMSVVQGYIGEQRFNV------------------RDEIVLRNLPAAVRN---------------- 427
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     595 ssasphfaksscggaavseglaelqeknfkweVLMQAIALNSTAfletEEVVVAQGtgeetrftQVKHVGSPTECALLAF 674
Cdd:TIGR01517  428 --------------------------------ILVEGISLNSSS----EEVVDRGG--------KRAFIGSKTECALLDF 463
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     675 QDeRCGGDYASTRRLYLGEDEVELIAredFSSDRKMMTSVVrilKNSGdstgatspaspGLLRVFVKGAGERVLAQCSSV 754
Cdd:TIGR01517  464 GL-LLLLQSRDVQEVRAEEKVVKIYP---FNSERKFMSVVV---KHSG-----------GKYREFRKGASEIVLKPCRKR 525
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     755 L-VADQVIPLTPERKAEVEkTVVDAMAAEALRTICLAYRDIDPEREPDWRercaaphqmfmKGETQLTCLGIAGIEDPVR 833
Cdd:TIGR01517  526 LdSNGEATPISEDDKDRCA-DVIEPLASDALRTICLAYRDFAPEEFPRKD-----------YPNKGLTLIGVVGIKDPLR 593
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     834 DEVPGAVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFHEesGGLAMLGPDFTRAIggvvcqtcqtevcacatdaktaee 913
Cdd:TIGR01517  594 PGVREAVQECQRAGITVRMVTGDNIDTAKAIARNCGILTF--GGLAMEGKEFRSLV------------------------ 647
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     914 QNKplrvdvvrdldaFDKIWTRLEVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQ 993
Cdd:TIGR01517  648 YEE------------MDPILPKLRVLARSSPLDKQLLVLMLKDMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAKE 715
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     994 AADIVMLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVV--CTAVQREAPLSAVQMLWVNLIMDSFASLAL 1071
Cdd:TIGR01517  716 ASDIILLDDNFASIVRAVKWGRNVYDNIRKFLQFQLTVNVVAVILTFVgsCISSSHTSPLTAVQLLWVNLIMDTLAALAL 795
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    1072 ATESPTDDLLNRKPQGRDSYLISRSMLTSIVAASIYQLTVMIGLIFFGErflpetKWTFLSDEDRRNLGfcefsdcdfgm 1151
Cdd:TIGR01517  796 ATEPPTEALLDRKPIGRNAPLISRSMWKNILGQAGYQLVVTFILLFAGG------SIFDVSGPDEITSH----------- 858
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    1152 ytgtrmlsgrryklfsteddyklewlrevGPSRHGTFVFNTFVFMQIFNTINARdvddtQIEKSTSLsaaILGMVRNPLG 1231
Cdd:TIGR01517  859 -----------------------------QQGELNTIVFNTFVLLQLFNEINAR-----KLYEGMNV---FEGLFKNRIF 901
                         1130      1140      1150
                   ....*....|....*....|....*....|....*
gi 8100500    1232 LGIWVLIVLGQVLMTECGGRLLGCHQegLNREQWM 1266
Cdd:TIGR01517  902 VTIMGFTFGFQVIIVEFGGSFFSTVS--LSIEQWI 934
MgtA COG0474
Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];
123-1246 5.26e-175

Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];


Pssm-ID: 223550 [Multi-domain]  Cd Length: 917  Bit Score: 545.39  E-value: 5.26e-175
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   123 VQTQQRRFGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLALLFSKEPEVeilegIAIWVAVLVVVVVTAGND 202
Cdd:COG0474   50 VKRRLKKYGPNELPEEKKRSLLKKFLRQFKDPFIILLLVAALLSAFVGDWVDAGVDA-----IVILLVVVINALLGFVQE 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   203 WMKEQ---QFAKLSvvkdDKKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRK 279
Cdd:COG0474  125 YRAEKaleALKKMS----SPKAKVLRDGKFVEIPASELVPGDIVLLEAGDVVPADLRLLESSDLEVDESALTGESLPVEK 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   280 apfqqclnealsretafssaldsaenlpapgssvdhrrrsrgsfgapssgaplQAQTCTTSSAcadtlkseggvctQLEL 359
Cdd:COG0474  201 -----------------------------------------------------QALPLTKSDA-------------PLGL 214
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   360 ARHHevaspVLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKLAY-DAEPTPLQRKLNALAEDIGTFGLISAVVAFFVLLl 438
Cdd:COG0474  215 DRDN-----MLFSGTTVVSGRAKGIVVATGFETEFGKIARLLPTkKEVKTPLQRKLNKLGKFLLVLALVLGALVFVVGL- 288
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   439 efwvmyFLQDPSKRESavdvvhdhvefFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEI 518
Cdd:COG0474  289 ------FRGGNGLLES-----------FLTALALAVAAVPEGLPAVVTIALALGAQRMAKDNAIVRSLNAIETLGSVDVI 351
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   519 CSDKTGTLTKNQMTVTQFWDGEKTFCIpssrgeqtpgadplstgaegedvgDDMSLHAQDASRRgyiplsahstaassas 598
Cdd:COG0474  352 CSDKTGTLTQNKMTVKKIYINGGGKDI------------------------DDKDLKDSPALLR---------------- 391
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   599 phfaksscggaavseglaelqeknfkwevLMQAIALNSTAFLETEEVVVAqgtgeetrftqvkhvGSPTECALLAFQDEr 678
Cdd:COG0474  392 -----------------------------FLLAAALCNSVTPEKNGWYQA---------------GDPTEGALVEFAEK- 426
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   679 cgGDYASTRRLYlgEDEVELIAREDFSSDRKMMTSVVRilknsgdstgatspASPGLLRVFVKGAGERVLAQCSSVlvaD 758
Cdd:COG0474  427 --LGFSLDLSGL--EVEYPILAEIPFDSERKRMSVIVK--------------TDEGKYILFVKGAPEVILERCKSI---G 485
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   759 QVIPLTPERKAEVEKtVVDAMAAEALRTICLAYRDIDPEREPDWRErcaaphqmfmKGETQLTCLGIAGIEDPVRDEVPG 838
Cdd:COG0474  486 ELEPLTEEGLRTLEE-AVKELASEGLRVLAVAYKKLDRAEKDDEVD----------EIESDLVFLGLTGIEDPPREDVKE 554
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   839 AVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFHEESGGLAMLGPDFTRAIGgvvcqtcqtevcacatdaktaeeqnkpl 918
Cdd:COG0474  555 AIEELREAGIKVWMITGDHVETAIAIAKECGIEAEAESALVIDGAELDALSD---------------------------- 606
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   919 rvdvvrdlDAFDKIWTRLEVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIV 998
Cdd:COG0474  607 --------EELAELVEELSVFARVSPEQKARIVEALQKSGHVVAMTGDGVNDAPALKAADVGIAMGGEGTDAAKEAADIV 678
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   999 MLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQRE-APLSAVQMLWVNLIMDSFASLALATESPT 1077
Cdd:COG0474  679 LLDDNFATIVLAVVEGRRVYVNIKKFILYLLSKNVGEVLTLLIYSLFNLFfLPLTPLQLLWINLLTDSLPALALGVEDPE 758
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500  1078 DDLLNRKPQGRDSYLISRSMLTSIVAASIYQLTVMIGLIFFGERFlpetkwtflsdedrrnlgfcefsdcdfgmytgtrm 1157
Cdd:COG0474  759 SDVMKRPPRGPEEGLFNRKIFWRFILIIGLLSAILFILTFLLYLL----------------------------------- 803
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500  1158 lsgrryklfstEDDYKLEWLREVGPSRHgTFVFNTFVFMQIFNTINARDVddtqiekstSLSAAILGMVRNPlglGIWVL 1237
Cdd:COG0474  804 -----------GFIANTLGLDLFQALLQ-TTAFTVLVLIQLLLTLAVRSR---------GRPFLSSLLFSNK---YLWLA 859

                 ....*....
gi 8100500  1238 IVLGQVLMT 1246
Cdd:COG0474  860 LLVIIILQL 868
P-type_ATPase_Ca_prok cd02089
prokaryotic P-type Ca(2+)-ATPase similar to Synechococcus elongatus sp. strain PCC 7942 PacL ...
123-1085 2.33e-146

prokaryotic P-type Ca(2+)-ATPase similar to Synechococcus elongatus sp. strain PCC 7942 PacL and Listeria monocytogenes LMCA1; Ca(2+) transport ATPase is a plasma membrane protein which pumps Ca(2+) ion out of the cytoplasm. This prokaryotic subfamily includes the Ca(2+)-ATPase Synechococcus elongatus PacL, Listeria monocytogenes Ca(2+)-ATPase 1 (LMCA1) which has a low Ca(2+) affinity and a high pH optimum (pH about 9) and may remove Ca(2+) from the microorganism in environmental conditions when e.g. stressed by high Ca(2+) and alkaline pH, and the Bacillus subtilis putative P-type Ca(2+)-transport ATPase encoded by the yloB gene, which is expressed during sporulation. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319781 [Multi-domain]  Cd Length: 674  Bit Score: 461.31  E-value: 2.33e-146
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   123 VQTQQRRFGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLAllfskepevEILEGIAIWVAVLVVVVVTAGND 202
Cdd:cd02089    7 AERRLAKYGPNELVEKKKRSPWKKFLEQFKDFMVIVLLAAAVISGVLG---------EYVDAIVIIAIVILNAVLGFVQE 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   203 WMKEQQFA---KLSVVKddkkCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRK 279
Cdd:cd02089   78 YKAEKALAalkKMSAPT----AKVLRDGKKQEIPARELVPGDIVLLEAGDYVPADGRLIESASLRVEESSLTGESEPVEK 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   280 APFQQclnealsretafssaldsaenlpapgssvdhrrrsrgsfgaPSSGAPLQAQTCttssacadtlkseggvctqlel 359
Cdd:cd02089  154 DADTL-----------------------------------------LEEDVPLGDRKN---------------------- 170
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   360 arhhevaspVLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKL-AYDAEPTPLQRKLNALAEDIGTFGLISAVVAFFVLLL 438
Cdd:cd02089  171 ---------MVFSGTLVTYGRGRAVVTATGMNTEMGKIATLLeETEEEKTPLQKRLDQLGKRLAIAALIICALVFALGLL 241
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   439 EfwvmyflqdpskresavdvVHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEI 518
Cdd:cd02089  242 R-------------------GEDLLDMLLTAVSLAVAAIPEGLPAIVTIVLALGVQRMAKRNAIIRKLPAVETLGSVSVI 302
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   519 CSDKTGTLTKNQMTVTQFWdgektfcipssrgeqtpgadplstgaegedvgddmslhaqdasrrgyiplsahstaassas 598
Cdd:cd02089  303 CSDKTGTLTQNKMTVEKIY------------------------------------------------------------- 321
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   599 phfaksscggaavseglaelqeknfkwevlmqaialnstafleteevvvaqgtgeetrftqvkHVGSPTECALLAFQdER 678
Cdd:cd02089  322 ---------------------------------------------------------------TIGDPTETALIRAA-RK 337
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   679 CGGDYASTRRLYlgedevELIAREDFSSDRKMMTSVVRIlknsgdstgatspasPGLLRVFVKGAGERVLAQCSSVLVAD 758
Cdd:cd02089  338 AGLDKEELEKKY------PRIAEIPFDSERKLMTTVHKD---------------AGKYIVFTKGAPDVLLPRCTYIYING 396
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   759 QVIPLTPERKAEVEKtVVDAMAAEALRTICLAYRDIDPEREPDWRERcaaphqmfmkgETQLTCLGIAGIEDPVRDEVPG 838
Cdd:cd02089  397 QVRPLTEEDRAKILA-VNEEFSEEALRVLAVAYKPLDEDPTESSEDL-----------ENDLIFLGLVGMIDPPRPEVKD 464
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   839 AVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFheESGGLAMLGPDFtraiggvvcqtcqtevcacatDAKTAEEQNKpl 918
Cdd:cd02089  465 AVAECKKAGIKTVMITGDHKLTARAIAKELGIL--EDGDKALTGEEL---------------------DKMSDEELEK-- 519
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   919 RVDVVRdldafdkiwtrleVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIV 998
Cdd:cd02089  520 KVEQIS-------------VYARVSPEHKLRIVKALQRKGKIVAMTGDGVNDAPALKAADIGVAMGITGTDVAKEAADMI 586
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   999 MLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPTD 1078
Cdd:cd02089  587 LTDDNFATIVAAVEEGRTIYDNIRKFIRYLLSGNVGEILTMLLAPLLGWPVPLLPIQLLWINLLTDGLPALALGVEPAEP 666

                 ....*..
gi 8100500  1079 DLLNRKP 1085
Cdd:cd02089  667 DIMDRKP 673
P-type_ATPase_cation cd02080
P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, ...
220-1246 9.84e-124

P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase; This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319775 [Multi-domain]  Cd Length: 819  Bit Score: 405.11  E-value: 9.84e-124
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   220 KCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRKApfqqclNEALSRETafssa 299
Cdd:cd02080   94 EATVLRDGKKLTIDAEELVPGDIVLLEAGDKVPADLRLIEARNLQIDESALTGESVPVEKQ------EGPLEEDT----- 162
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   300 ldsaenlpapgssvdhrrrsrgsfgapssgaPLQAQTCttssacadtlkseggvctqlelarhhevaspVLLSGTTVSTG 379
Cdd:cd02080  163 -------------------------------PLGDRKN-------------------------------MAYSGTLVTAG 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   380 SGTALVVAVGRYSQVGQMFQKLAyDAEP--TPLQRKLNALAEdigTFGLISAVVAFFVLLLEFWVmyflqdpskRESAVd 457
Cdd:cd02080  181 SATGVVVATGADTEIGRINQLLA-EVEQlaTPLTRQIAKFSK---ALLIVILVLAALTFVFGLLR---------GDYSL- 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   458 vvhdhVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQFW 537
Cdd:cd02080  247 -----VELFMAVVALAVAAIPEGLPAVITITLAIGVQRMAKRNAIIRRLPAVETLGSVTVICSDKTGTLTRNEMTVQAIV 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   538 dgekTFCipssrgeqtpgadplstgaegedvgddmslhaQDAsrrgyiplsahstaassasphfaksscggaavseglaE 617
Cdd:cd02080  322 ----TLC--------------------------------NDA-------------------------------------Q 328
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   618 LQEKNFKWEVlmqaialnstafleteevvvaqgtgeetrftqvkhVGSPTECALLAFQDeRCGGDYASTRRLYLGEDEVE 697
Cdd:cd02080  329 LHQEDGHWKI-----------------------------------TGDPTEGALLVLAA-KAGLDPDRLASSYPRVDKIP 372
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   698 liaredFSSDRKMMtsvvrilknsgdstgATSPASPGLLRVFVKGAGERVLAQCSSVLVADQVIPLtpeRKAEVEKTVvD 777
Cdd:cd02080  373 ------FDSAYRYM---------------ATLHRDDGQRVIYVKGAPERLLDMCDQELLDGGVSPL---DRAYWEAEA-E 427
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   778 AMAAEALRTICLAYRDIDPErepdwrercaapHQMFMKGETQ--LTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTG 855
Cdd:cd02080  428 DLAKQGLRVLAFAYREVDSE------------VEEIDHADLEggLTFLGLQGMIDPPRPEAIAAVAECQSAGIRVKMITG 495
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   856 DNIITAKAIAKRCEIFHEESgglAMLGPDFTRAiggvvcqtcqtevcacaTDAKTAEeqnkplrvdVVRDLDAFdkiwtr 935
Cdd:cd02080  496 DHAETARAIGAQLGLGDGKK---VLTGAELDAL-----------------DDEELAE---------AVDEVDVF------ 540
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   936 levlARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIVMLDDNFTCIVKAVKWGR 1015
Cdd:cd02080  541 ----ARTSPEHKLRLVRALQARGEVVAMTGDGVNDAPALKQADIGIAMGIKGTEVAKEAADMVLADDNFATIAAAVEEGR 616
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500  1016 NVYDNIRRFLQFQLTVNvVAVALTV-VCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKPQGRDSYLIS 1094
Cdd:cd02080  617 RVYDNLKKFILFTLPTN-LGEGLVIiVAILFGVTLPLTPVQILWINMVTAITLGLALAFEPAEPGIMKRPPRDPSEPLLS 695
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500  1095 RSMLTSIVAASIYqltvMIGLIFfgerflpetkWTFLSDEDRrnlgfcefsdcdfgmytgtrmlsgrryklfstedDYKL 1174
Cdd:cd02080  696 RELIWRILLVSLL----MLGGAF----------GLFLWALDR----------------------------------GYSL 727
                        970       980       990      1000      1010      1020      1030
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 8100500  1175 EWLRevgpsrhgTFVFNTFVFMQIFNTINARDVDDtqieksTSLSAAILGmvrNPLGLGIWVLIVLGQVLMT 1246
Cdd:cd02080  728 ETAR--------TMAVNTIVVAQIFYLFNCRSLHR------SILKLGVFS---NKILFLGIGALILLQLAFT 782
P-type_ATPase_SERCA cd02083
sarco/endoplasmic reticulum Ca(2+)-ATPase (SERCA), similar to mammalian ATP2A1-3/SERCA1-3; ...
123-1094 2.94e-113

sarco/endoplasmic reticulum Ca(2+)-ATPase (SERCA), similar to mammalian ATP2A1-3/SERCA1-3; SERCA is a transmembrane (Ca2+)-ATPase and a major regulator of Ca(2+) homeostasis and contractility in cardiac and skeletal muscle. It re-sequesters cytoplasmic Ca(2+) to the sarco/endoplasmic reticulum store, thereby also terminating Ca(2+)-induced signaling such as in muscle contraction. Three genes (ATP2A1-3/SERCA1-3) encode SERCA pumps in mammals, further isoforms exist due to alternative splicing of transcripts. The activity of SERCA is regulated by two small membrane proteins called phospholamban and sarcolipin. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319778 [Multi-domain]  Cd Length: 979  Bit Score: 380.48  E-value: 2.94e-113
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   123 VQTQQRRFGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLALL---------FSkEPEVEILEGIA-----IW 188
Cdd:cd02083   25 VKRRREKYGPNELPAEEGKSLWELVLEQFDDLLVRILLLAAIISFVLALFeegeegvtaFV-EPFVILLILIAnavvgVW 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   189 VAVLVVVVVTAgndwMKEQQFAKLSVVKDDKKCTVVRSghKEqisvfqLVVGDILHLEAGDEVPADALVVQGRDLT--VD 266
Cdd:cd02083  104 QERNAEKAIEA----LKEYEPEMAKVLRNGKGVQRIRA--RE------LVPGDIVEVAVGDKVPADIRIIEIKSTTlrVD 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   267 ESSLTGESdmirkapfqqclnealsretafSSALDSAENLPAPGssvdhrrrsrgsfgapssgAPLQAQTCttssacadt 346
Cdd:cd02083  172 QSILTGES----------------------VSVIKHTDVVPDPR-------------------AVNQDKKN--------- 201
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   347 lkseggvctqlelarhhevaspVLLSGTTVSTGSGTALVVAVGRYSQVG----QMFQKlayDAEPTPLQRKLNalaedig 422
Cdd:cd02083  202 ----------------------MLFSGTNVAAGKARGVVVGTGLNTEIGkirdEMAET---EEEKTPLQQKLD------- 249
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   423 TFG-LISAVVAFFVLLLefWVM---YFlQDPSKRESAVD-VVHdhveFFVTAITMLVVAVPEGLPLAVTISLAYSIGQML 497
Cdd:cd02083  250 EFGeQLSKVISVICVAV--WAInigHF-NDPAHGGSWIKgAIY----YFKIAVALAVAAIPEGLPAVITTCLALGTRRMA 322
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   498 RDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQFwdgektfCIPssrgeqtpgadplstgaegEDVGDDMSLHAQ 577
Cdd:cd02083  323 KKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRM-------FIL-------------------DKVEDDSSLNEF 376
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   578 DASRRGYIPLSAHstaassasphFAKSSCGGAAVSEGLAELQeknfkwevlMQAIALNSTAfleteeVVVAQGTGeetrf 657
Cdd:cd02083  377 EVTGSTYAPEGEV----------FKNGKKVKAGQYDGLVELA---------TICALCNDSS------LDYNESKG----- 426
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   658 tQVKHVGSPTECALL-------AFQDERCGGDyASTRRLYLGEDEVELIARE---DFSSDRKMMTSVVRILKNSGDStga 727
Cdd:cd02083  427 -VYEKVGEATETALTvlvekmnVFNTDKSGLS-KRERANACNDVIEQLWKKEftlEFSRDRKSMSVYCSPTKASGGN--- 501
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   728 tspaspgllRVFVKGAGERVLAQCSSVLVADQVIPLTPERKAEVEKTVVDAMAAEALRTICLAYRDIDPEREPDWRERCA 807
Cdd:cd02083  502 ---------KLFVKGAPEGVLERCTHVRVGGGKVVPLTAAIKILILKKVWGYGTDTLRCLALATKDTPPKPEDMDLEDST 572
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   808 AphqmFMKGETQLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFHEES--GGLAMLGPDF 885
Cdd:cd02083  573 K----FYKYETDLTFVGVVGMLDPPRPEVRDSIEKCRDAGIRVIVITGDNKGTAEAICRRIGIFGEDEdtTGKSYTGREF 648
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   886 traiggvvcqtcqtevcacatDAKTAEEQNKPLRvdvvrdldafdkiwtRLEVLARSQPSDKYALVTALKQKGRVVAVTG 965
Cdd:cd02083  649 ---------------------DDLSPEEQREACR---------------RARLFSRVEPSHKSKIVELLQSQGEITAMTG 692
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   966 DGTNDAPALKKADVGFAMGlSGKEVAKQAADIVMLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVN---VVAVALTVvc 1042
Cdd:cd02083  693 DGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNigeVVSIFLTA-- 769
                        970       980       990      1000      1010
                 ....*....|....*....|....*....|....*....|....*....|..
gi 8100500  1043 tAVQREAPLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKPQGRDSYLIS 1094
Cdd:cd02083  770 -ALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMKKPPRKPDEPLIS 820
ATPase-IIA1_Ca TIGR01116
sarco/endoplasmic reticulum calcium-translocating P-type ATPase; This model describes the ...
147-1094 3.58e-103

sarco/endoplasmic reticulum calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the endoplasmic reticulum membrane of eukaryotes, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. These pumps transfer Ca2+ from the cytoplasm to the lumen of the endoplasmic reticulum. In humans and mice, at least, there are multiple isoforms of the SERCA pump with overlapping but not redundant functions. Defects in SERCA isoforms are associated with diseases in humans. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the latter of which is modelled by TIGR01522. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273452 [Multi-domain]  Cd Length: 917  Bit Score: 351.01  E-value: 3.58e-103
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     147 LIEAASDATLRVLMLCGLLSVVLALLFSKEPEVE----------IL---EGIAIWVAVLVVVVVTAgndwMKEQQfakls 213
Cdd:TIGR01116    1 VLEQFEDLLVRILLLAACVSFVLAWFEEGEETVTafvepfvillILvanAIVGVWQERNAEKAIEA----LKEYE----- 71
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     214 vvkdDKKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESdmirkapfqqclnealsre 293
Cdd:TIGR01116   72 ----SEHAKVLRDGRWSVIKAKDLVPGDIVELAVGDKVPADIRVLSLKTLRVDQSILTGES------------------- 128
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     294 tafSSALDSAENLPAPGssvdhrrrsrgsfgapssgAPLQAQTCttssacadtlkseggvctqlelarhhevaspVLLSG 373
Cdd:TIGR01116  129 ---VSVNKHTESVPDER-------------------AVNQDKKN-------------------------------MLFSG 155
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     374 TTVSTGSGTALVVAVGRYSQVGQMFQKLAYDA-EPTPLQRKLNALAEdigtfgLISAVVAFFVLLLefWVM---YFLqDP 449
Cdd:TIGR01116  156 TLVVAGKARGVVVRTGMSTEIGKIRDEMRAAEqEDTPLQKKLDEFGE------LLSKVIGLICILV--WVInigHFN-DP 226
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     450 SKRESAVdvvHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKN 529
Cdd:TIGR01116  227 ALGGGWI---QGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRKMAKKNAIVRKLPSVETLGCTTVICSDKTGTLTTN 303
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     530 QMTVTqfwdgeKTFCIPSSrgeqtpgadplstgaegedvgdDMSLHAQDASRRGYIPLsahstaassasphfaksscgGA 609
Cdd:TIGR01116  304 QMSVC------KVVALDPS----------------------SSSLNEFCVTGTTYAPE--------------------GG 335
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     610 AVSEGLAELQEKNFKWEVLMQAIALNSTAfleteEVVVAQGTGEetrftqVKHVGSPTECALLAF------QDERCGGDY 683
Cdd:TIGR01116  336 VIKDDGPVAGGQDAGLEELATIAALCNDS-----SLDFNERKGV------YEKVGEATEAALKVLvekmglPATKNGVSS 404
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     684 ASTRRL---YLGEDEVELIAREDFSSDRKMMTSVVrilknsgdsTGATSPAspgllrVFVKGAGERVLAQCSSVLVADQV 760
Cdd:TIGR01116  405 KRRPALgcnSVWNDKFKKLATLEFSRDRKSMSVLC---------KPSTGNK------LFVKGAPEGVLERCTHILNGDGR 469
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     761 I-PLTPERKAEVeKTVVDAMAA-EALRTICLAYRDIDPEREPDWRERCAAphqmFMKGETQLTCLGIAGIEDPVRDEVPG 838
Cdd:TIGR01116  470 AvPLTDKMKNTI-LSVIKEMGTtKALRCLALAFKDIPDPREEDLLSDPAN----FEAIESDLTFIGVVGMLDPPRPEVAD 544
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     839 AVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFH--EESGGLAMLGPDFtraiggvvcqtcqtevcacatDAKTAEEQNK 916
Cdd:TIGR01116  545 AIEKCRTAGIRVIMITGDNKETAEAICRRIGIFSpdEDVTFKSFTGREF---------------------DEMGPAKQRA 603
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     917 PLRvdvvrdldafdkiwtRLEVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGlSGKEVAKQAAD 996
Cdd:TIGR01116  604 ACR---------------SAVLFSRVEPSHKSELVELLQEQGEIVAMTGDGVNDAPALKKADIGIAMG-SGTEVAKEASD 667
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     997 IVMLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESP 1076
Cdd:TIGR01116  668 MVLADDNFATIVAAVEEGRAIYNNMKQFIRYMISSNIGEVVCIFLTAALGIPEGLIPVQLLWVNLVTDGLPATALGFNPP 747
                          970
                   ....*....|....*...
gi 8100500    1077 TDDLLNRKPQGRDSYLIS 1094
Cdd:TIGR01116  748 DKDIMWKPPRRPDEPLIT 765
P-type_ATPase_Na_ENA cd02086
fungal-type Na(+)-ATPase, similar to the plasma membrane sodium transporters Saccharomyces ...
221-1103 1.24e-101

fungal-type Na(+)-ATPase, similar to the plasma membrane sodium transporters Saccharomyces cerevisiae Ena1p, Ena2p and Ustilago maydis Ena1, and the endoplasmic reticulum sodium transporter Ustilago maydis Ena2; Fungal-type Na(+)-ATPase (also called ENA ATPases). This subfamily includes the Saccharomyces cerevisiae plasma membrane transporters: Na(+)/Li(+)-exporting ATPase Ena1p which may also extrudes K(+), and Na(+)-exporting P-type ATPase Ena2p. It also includes Ustilago maydis plasma membrane Ena1, an K(+)/Na(+)-ATPase whose chief role is to pump Na(+) and K(+) out of the cytoplasm, especially at high pH values, and endoplasmic reticulum Ena2 ATPase which mediates Na(+) or K(+) fluxes in the ER or in other endomembranes. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319780 [Multi-domain]  Cd Length: 920  Bit Score: 346.75  E-value: 1.24e-101
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   221 CTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRKapfqqcLNEALSRETAFSSAL 300
Cdd:cd02086   95 AHVIRSGKTETISSKDVVPGDIVLLKVGDTVPADLRLIETKNFETDEALLTGESLPVIK------DAELVFGKEEDVSVG 168
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   301 DSAeNLPAPGSSVDhRRRSRGSFGAPSSGaplqaqtcTTSSACADTLKSEGGvctqleLARHHEVASPVLLSGTTVSTGS 380
Cdd:cd02086  169 DRL-NLAYSSSTVT-KGRAKGIVVATGMN--------TEIGKIAKALRGKGG------LISRDRVKSWLYGTLIVTWDAV 232
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   381 GTALVVAVGrysqvgqmfqklaydaepTPLQRKLNALAedigtfglisaVVAFFV-LLLEFWVMyflqdpskresAVDVV 459
Cdd:cd02086  233 GRFLGTNVG------------------TPLQRKLSKLA-----------YLLFFIaVILAIIVF-----------AVNKF 272
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   460 HDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQFWdg 539
Cdd:cd02086  273 DVDNEVIIYAIALAISMIPESLVAVLTITMAVGAKRMVKRNVIVRKLDALEALGAVTDICSDKTGTLTQGKMVVRQVW-- 350
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   540 ektfcipssrgeqtpgadplstgaegedvgddmslhaqdasrrgyiplsahstaassasphFAKSSCGGAAVSEglaelQ 619
Cdd:cd02086  351 -------------------------------------------------------------IPAALCNIATVFK-----D 364
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   620 EKNFKWEVlmqaialnstafleteevvvaqgtgeetrftqvkhVGSPTECALLAFQDERcggDYASTRRLYLGEDEVELI 699
Cdd:cd02086  365 EETDCWKA-----------------------------------HGDPTEIALQVFATKF---DMGKNALTKGGSAQFQHV 406
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   700 AREDFSSDRKMMTSVVRIlKNSGDSTgatspaspgllrVFVKGAGERVLAQCSSVLVADQVIPLTPERKAEVEKTVvDAM 779
Cdd:cd02086  407 AEFPFDSTVKRMSVVYYN-NQAGDYY------------AYMKGAVERVLECCSSMYGKDGIIPLDDEFRKTIIKNV-ESL 472
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   780 AAEALRTICLAYRDID------PEREPDWRERCAAphqmfmkgETQLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMV 853
Cdd:cd02086  473 ASQGLRVLAFASRSFTkaqfndDQLKNITLSRADA--------ESDLTFLGLVGIYDPPRNESAGAVEKCHQAGITVHML 544
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   854 TGDNIITAKAIAKrceifheESGGLAMLGPDFTRAIGGVVCQTcqtevcACATDAKTAEEqnkplrVDVVRDLDAfdkiw 933
Cdd:cd02086  545 TGDHPGTAKAIAR-------EVGILPPNSYHYSQEIMDSMVMT------ASQFDGLSDEE------VDALPVLPL----- 600
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   934 trleVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIVMLDDNFTCIVKAVKW 1013
Cdd:cd02086  601 ----VIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMADVGIAMGLNGSDVAKDASDIVLTDDNFASIVNAIEE 676
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500  1014 GRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREA-----PLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKPQGR 1088
Cdd:cd02086  677 GRRMFDNIQKFVLHLLAENVAQVILLLIGLAFKDEDglsvfPLSPVEILWINMVTSSFPAMGLGLEKASPDVMQRPPHDL 756
                        890
                 ....*....|....*
gi 8100500  1089 DSYLISRSMLTSIVA 1103
Cdd:cd02086  757 KVGIFTRELIIDTFV 771
ATPase_P-type TIGR01494
ATPase, P-type (transporting), HAD superfamily, subfamily IC; The P-type ATPases are a large ...
219-1071 3.46e-101

ATPase, P-type (transporting), HAD superfamily, subfamily IC; The P-type ATPases are a large family of trans-membrane transporters acting on charged substances. The distinguishing feature of the family is the formation of a phosphorylated intermediate (aspartyl-phosphate) during the course of the reaction. Another common name for these enzymes is the E1-E2 ATPases based on the two isolable conformations: E1 (unphosphorylated) and E2 (phosphorylated). Generally, P-type ATPases consist of only a single subunit encompassing the ATPase and ion translocation pathway, however, in the case of the potassium (TIGR01497) and sodium/potassium (TIGR01106) varieties, these functions are split between two subunits. Additional small regulatory or stabilizing subunits may also exist in some forms. P-type ATPases are nearly ubiquitous in life and are found in numerous copies in higher organisms (at least 45 in Arabidopsis thaliana, for instance). Phylogenetic analyses have revealed that the P-type ATPase subfamily is divided up into groups based on substrate specificities and this is represented in the various subfamily and equivalog models that have been made: IA (K+) TIGR01497, IB (heavy metals) TIGR01525, IIA1 (SERCA-type Ca++) TIGR01116, IIA2 (PMR1-type Ca++) TIGR01522, IIB (PMCA-type Ca++) TIGR01517, IIC (Na+/K+, H+/K+ antiporters) TIGR01106, IID (fungal-type Na+ and K+) TIGR01523, IIIA (H+) TIGR01647, IIIB (Mg++) TIGR01524, IV (phospholipid, flippase) TIGR01652 and V (unknown specificity) TIGR01657. The crystal structure of one calcium-pumping ATPase and an analysis of the fold of the catalytic domain of the P-type ATPases have been published. These reveal that the catalytic core of these enzymes is a haloacid dehalogenase(HAD)-type aspartate-nucleophile hydrolase. The location of the ATP-binding loop in between the first and second HAD conserved catalytic motifs defines these enzymes as members of subfamily I of the HAD superfamily (see also TIGR01493, TIGR01509, TIGR01549, TIGR01544 and TIGR01545). Based on these classifications, the P-type ATPase _superfamily_ corresponds to the IC subfamily of the HAD superfamily.


Pssm-ID: 273656 [Multi-domain]  Cd Length: 545  Bit Score: 334.29  E-value: 3.46e-101
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     219 KKCTVVRSGhKEQISVFQLVVGDILHLEAGDEVPADALVVQGrDLTVDESSLTGESDMIRKAPFQQClnealsretafss 298
Cdd:TIGR01494   35 ATVLVLRNG-WKEISSKDLVPGDVVLVKSGDTVPADGVLLSG-SAFVDESSLTGESLPVLKTALPDG------------- 99
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     299 aldsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcttssacadtlkseggvctqlelarhhevasPVLLSGTTVST 378
Cdd:TIGR01494  100 ---------------------------------------------------------------------DAVFAGTINFG 110
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     379 GSGTALVVAVGRYSQVGQmFQKLAYDAEPT--PLQRKLNALAEDIGT-FGLISAVVAFFVLLLEFWVMYFLqdpskresa 455
Cdd:TIGR01494  111 GTLIVKVTATGILTTVGK-IAVVVYTGFSTktPLQSKADKFENFIFIlFLLLLALAVFLLLPIGGWDGNSI--------- 180
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     456 vdvvhdhVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQ 535
Cdd:TIGR01494  181 -------YKAILRALAVLVIAIPCALPLAVSVALAVGDARMAKKGILVKNLNALEELGKVDVICFDKTGTLTTNKMTLQK 253
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     536 FWDGEKtfcipssrgeqtpgadplstgaegeDVGDDMSLHAQDASRRgyiplsahstaassasphfaksscggaavsegl 615
Cdd:TIGR01494  254 VIIIGG-------------------------VEEASLALALLAASLE--------------------------------- 275
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     616 aelqeknfkwevlmqaialnstafleteevvvaqgtgeetrftqvKHVGSPTECALLAFQDERCGGDYastrrlylGEDE 695
Cdd:TIGR01494  276 ---------------------------------------------YLSGHPLERAIVKSAEGVIKSDE--------INVE 302
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     696 VELIAREDFSSDRKMMTSVVRILKnsgdstgatspaspGLLRVFVKGAGERVLAQCSSVLVADQVIpltperkaevektv 775
Cdd:TIGR01494  303 YKILDVFPFSSVLKRMGVIVEGAN--------------GSDLLFVKGAPEFVLERCNNENDYDEKV-------------- 354
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     776 vDAMAAEALRTICLAYRDIDPErepdwrercaaphqmfmkgetqLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTG 855
Cdd:TIGR01494  355 -DEYARQGLRVLAFASKKLPDD----------------------LEFLGLLTFEDPLRPDAKETIEALRKAGIKVVMLTG 411
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     856 DNIITAKAIAKRCEIFheesgglamlgpdftraiggvvcqtcqtevcacatdaktaeeqnkplrvdvvrdldafdkiwtr 935
Cdd:TIGR01494  412 DNVLTAKAIAKELGID---------------------------------------------------------------- 427
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     936 leVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGlsGKEVAKQAADIVMLDDNFTCIVKAVKWGR 1015
Cdd:TIGR01494  428 --VFARVKPEEKAAIVEALQEKGRTVAMTGDGVNDAPALKKADVGIAMG--SGDVAKAAADIVLLDDDLSTIVEAVKEGR 503
                          810       820       830       840       850
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 8100500    1016 NVYDNIRRFLQFQLTVNVVAVALTVVCTAvqreaplsavqmlwVNLIMDSFASLAL 1071
Cdd:TIGR01494  504 KTFSNIKKNIFWAIAYNLILIPLALLLIV--------------IILLPPLLAALAL 545
ATPase-IIA2_Ca TIGR01522
golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
221-1120 5.34e-100

golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the former of which is modelled by TIGR01116.


Pssm-ID: 130585 [Multi-domain]  Cd Length: 884  Bit Score: 341.04  E-value: 5.34e-100
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     221 CTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGEsdmirkapfqqclNEALSRETAfssal 300
Cdd:TIGR01522  119 CHLIREGKLEHVLASTLVPGDLVCLSVGDRVPADLRIVEAVDLSIDESNLTGE-------------TTPVSKVTA----- 180
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     301 dsaenlPAPGSSvdhrrrsrgsfgapssGAPLQAQTCTTssacadtlkseggvctqlelarhhevaspvlLSGTTVSTGS 380
Cdd:TIGR01522  181 ------PIPAAT----------------NGDLAERSNIA-------------------------------FMGTLVRCGH 207
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     381 GTALVVAVGRYSQVGQMFQKLAYDAEP-TPLQRKLNALAEDIG--TFGLISAVVAFFVLLLEFWVmyflqdpskresavd 457
Cdd:TIGR01522  208 GKGIVVGTGSNTEFGAVFKMMQAIEKPkTPLQKSMDLLGKQLSlvSFGVIGVICLVGWFQGKDWL--------------- 272
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     458 vvhdhvEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQFW 537
Cdd:TIGR01522  273 ------EMFTISVSLAVAAIPEGLPIIVTVTLALGVLRMSKKRAIVRKLPSVETLGSVNVICSDKTGTLTKNHMTVTKIW 346
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     538 dgektfCIPSSRGEQTpgADPLSTGAEGEDVGDDMSLHAQDASRRGYIplsahstaassasphfAKSSCGGAAVSEGLAE 617
Cdd:TIGR01522  347 ------TSDGLHTMLN--AVSLNQFGEVIVDGDVLHGFYTVAVSRILE----------------AGNLCNNAKFRNEADT 402
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     618 LqeknfkwevlmqaialnstafleteevvvaqgtgeetrftqvkhVGSPTECALLAfQDERCGGDyaSTRRLYLGEDEVE 697
Cdd:TIGR01522  403 L--------------------------------------------LGNPTDVALIE-LLMKFGLD--DLRETYIRVAEVP 435
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     698 liaredFSSDRKMMTsvVRILKNSGDSTgatspaspgllRVFVKGAGERVLAQCSSVLVAD-QVIPLTPERKAEVEKtVV 776
Cdd:TIGR01522  436 ------FSSERKWMA--VKCVHRQDRSE-----------MCFMKGAYEQVLKYCTYYQKKDgKTLTLTQQQRDVIQE-EA 495
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     777 DAMAAEALRTICLAYRdidperepdwrercaaphqmfmKGETQLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTGD 856
Cdd:TIGR01522  496 AEMASAGLRVIAFASG----------------------PEKGQLTFLGLVGINDPPRPGVKEAVTTLITGGVRIIMITGD 553
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     857 NIITAKAIAKRceifheesggLAMLGPDFTRAIGgvvcqtcqtevcacatdAKTAEeqnkplrvdvvRDLDAFDKIWTRL 936
Cdd:TIGR01522  554 SQETAVSIARR----------LGMPSKTSQSVSG-----------------EKLDA-----------MDDQQLSQIVPKV 595
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     937 EVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIVMLDDNFTCIVKAVKWGRN 1016
Cdd:TIGR01522  596 AVFARASPEHKMKIVKALQKRGDVVAMTGDGVNDAPALKLADIGVAMGQTGTDVAKEAADMILTDDDFATILSAIEEGKG 675
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    1017 VYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKPQGRDSYLISRS 1096
Cdd:TIGR01522  676 IFNNIKNFITFQLSTSVAALSLIALATLMGFPNPLNAMQILWINILMDGPPAQSLGVEPVDKDVMRKPPRPRNDKILTKD 755
                          890       900
                   ....*....|....*....|....
gi 8100500    1097 MLTSIVAASIYQLTVMIgLIFFGE 1120
Cdd:TIGR01522  756 LIKKILVSAIIIVVGTL-FVFVRE 778
P-type_ATPase_SPCA cd02085
golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory ...
220-1129 2.13e-97

golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory pathway Ca(2+) transporting 1/hSPCA1 and Saccharomyces cerevisiae Ca(2+)/Mn(2+)-transporting P-type ATPase, Pmr1p; SPCAs are Ca(2+) pumps important for the golgi-associated secretion pathway, in addition some function as Mn(2+) pumps in Mn(2+) detoxification. Saccharomyces cerevisiae Pmr1p is a high affinity Ca(2+)/Mn(2+) ATPase which transports Ca(2+) and Mn(2+) from the cytoplasm into the Golgi. Pmr1p also contributes to Cd(2+) detoxification. This subfamily includes human SPCA1 and SPCA2, encoded by the ATP2C1 and ATP2C2 genes; autosomal dominant Hailey-Hailey disease is caused by mutations in the human ATP2C1 gene. It also includes Strongylocentrotus purpuratus testis secretory pathway calcium transporting ATPase SPCA which plays an important role in fertilization. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319779 [Multi-domain]  Cd Length: 804  Bit Score: 331.67  E-value: 2.13e-97
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   220 KCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRKapfqqclnealsretafssa 299
Cdd:cd02085   85 ECHCLRDGKLEHFLARELVPGDLVCLSIGDRIPADLRLFEATDLSIDESSLTGETEPCSK-------------------- 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   300 ldsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcTTSSACADTLKSeggvCTQLelarhhevaSPVLLSGTTVSTG 379
Cdd:cd02085  145 --------------------------------------TTEVIPKASNGD----LTTR---------SNIAFMGTLVRCG 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   380 SGTALVVAVGRYSQVGQMFQKL-AYDAEPTPLQRKLNALAEDIGTFGLIsaVVAFFVLLlefwvmYFLQDpskresavdv 458
Cdd:cd02085  174 HGKGIVIGTGENSEFGEVFKMMqAEEAPKTPLQKSMDKLGKQLSLYSFI--IIGVIMLI------GWLQG---------- 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   459 vHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQFWD 538
Cdd:cd02085  236 -KNLLEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRRAIVKKLPIVETLGCVNVICSDKTGTLTKNEMTVTKIVT 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   539 GektfCIpssrgeqtpgadplstgaegedvgddmslhAQDASRRGYIPLsahstaassasphfaksscggaavseglael 618
Cdd:cd02085  315 G----CV------------------------------CNNAVIRNNTLM------------------------------- 329
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   619 qeknfkwevlmqaialnstafleteevvvaqgtgeetrftqvkhvGSPTECALLAFqdercggdyASTRRLYLGEDEVEL 698
Cdd:cd02085  330 ---------------------------------------------GQPTEGALIAL---------AMKMGLSDIRETYIR 355
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   699 IAREDFSSDRKMMTsvVRILKNSGDSTGATspaspgllrVFVKGAGERVLAQCSSVLVADQV-IPLTPERKAEVeKTVVD 777
Cdd:cd02085  356 KQEIPFSSEQKWMA--VKCIPKYNSDNEEI---------YFMKGALEQVLDYCTTYNSSDGSaLPLTQQQRSEI-NEEEK 423
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   778 AMAAEALRTICLAyrdidperepdwrercaaphqmfmKGET--QLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTG 855
Cdd:cd02085  424 EMGSKGLRVLALA------------------------SGPElgDLTFLGLVGINDPPRPGVREAIQILLESGVRVKMITG 479
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   856 DNIITAKAIAKRceifheesggLAMLGPDFTraiggvvcqtcqtevcacatdAKTAEEqnkplrVDVVrDLDAFDKIWTR 935
Cdd:cd02085  480 DAQETAIAIGSS----------LGLYSPSLQ---------------------ALSGEE------VDQM-SDSQLASVVRK 521
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   936 LEVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIVMLDDNFTCIVKAVKWGR 1015
Cdd:cd02085  522 VTVFYRASPRHKLKIVKALQKSGAVVAMTGDGVNDAVALKSADIGIAMGRTGTDVCKEAADMILVDDDFSTILAAIEEGK 601
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500  1016 NVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKPQGRDSYLISR 1095
Cdd:cd02085  602 GIFYNIKNFVRFQLSTSIAALSLIALSTLFNLPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDPILTR 681
                        890       900       910
                 ....*....|....*....|....*....|....
gi 8100500  1096 SMLTSIVAASIYQLTVMIgLIFFGErfLPETKWT 1129
Cdd:cd02085  682 SLILNVLLSAAIIVSGTL-WVFWKE--MSDDNVT 712
P-type_ATPases cd01431
ATP-dependent membrane-bound cation and aminophospholipid transporters; The P-type ATPases, ...
699-1071 1.66e-86

ATP-dependent membrane-bound cation and aminophospholipid transporters; The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd(2+), and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319764 [Multi-domain]  Cd Length: 319  Bit Score: 284.73  E-value: 1.66e-86
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   699 IAREDFSSDRKMMTSVVRilknsgdstgatspaSPGLLRVFVKGAGERVLAQCSSvlvadqviPLTPERKAEVEKtVVDA 778
Cdd:cd01431   22 IEEIPFNSTRKRMSVVVR---------------LPGRYRAIVKGAPETILSRCSH--------ALTEEDRNKIEK-AQEE 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   779 MAAEALRTICLAYRDIDPErepdwrercaaphQMFMKGETQLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTGDNI 858
Cdd:cd01431   78 SAREGLRVLALAYREFDPE-------------TSKEAVELNLVFLGLIGLQDPPRPEVKEAIAKCRTAGIKVVMITGDNP 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   859 ITAKAIAKRCEIFHEESGglamlgpdftraiggvvcqtcqtEVCACATDAKTAEEQnkplrvdvvrdldafDKIWTRLEV 938
Cdd:cd01431  145 LTAIAIAREIGIDTKASG-----------------------VILGEEADEMSEEEL---------------LDLIAKVAV 186
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   939 LARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIVMLDDNFTCIVKAVKWGRNVY 1018
Cdd:cd01431  187 FARVTPEQKLRIVKALQARGEVVAMTGDGVNDAPALKQADVGIAMGSTGTDVAKEAADIVLLDDNFATIVEAVEEGRAIY 266
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 8100500  1019 DNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLAL 1071
Cdd:cd01431  267 DNIKKNITYLLANNVAEVFAIALALFLGGPLPLLAFQILWINLVTDLIPALAL 319
ATPase-IID_K-Na TIGR01523
potassium and/or sodium efflux P-type ATPase, fungal-type; Initially described as a calcium ...
223-1107 3.21e-78

potassium and/or sodium efflux P-type ATPase, fungal-type; Initially described as a calcium efflux ATPase, more recent work has shown that the S. pombe CTA3 gene is in fact a potassium ion efflux pump. This model describes the clade of fungal P-type ATPases responsible for potassium and sodium efflux. The degree to which these pumps show preference for sodium or potassium varies. This group of ATPases has been classified by phylogentic analysis as type IID. The Leishmania sequence (GP|3192903), which falls between trusted and noise in this model, may very well turn out to be an active potassium pump.


Pssm-ID: 130586 [Multi-domain]  Cd Length: 1053  Bit Score: 281.13  E-value: 3.21e-78
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     223 VVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRK---APFQQclNEalsrETAFSSA 299
Cdd:TIGR01523  122 VIRNGKSDAIDSHDLVPGDICLLKTGDTIPADLRLIETKNFDTDEALLTGESLPVIKdahATFGK--EE----DTPIGDR 195
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     300 LdsaeNLpAPGSSVDHRRRSRGSFGAPSsgapLQAQTcttsSACADTLKSEGGVCTQLELA--RHHEVASPVLLSGTTVS 377
Cdd:TIGR01523  196 I----NL-AFSSSAVTKGRAKGICIATA----LNSEI----GAIAAGLQGDGGLFQRPEKDdpNKRRKLNKWILKVTKKV 262
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     378 TGSGTALVVAvgrysqvgqmfqklaydaepTPLQRKLNALAedigtfglisavvaffVLLleFWVMYFLqdpskresAVD 457
Cdd:TIGR01523  263 TGAFLGLNVG--------------------TPLHRKLSKLA----------------VIL--FCIAIIF--------AII 296
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     458 VVHDHvEFFVT------AITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQM 531
Cdd:TIGR01523  297 VMAAH-KFDVDkevaiyAICLAISIIPESLIAVLSITMAMGAANMSKRNVIVRKLDALEALGAVNDICSDKTGTITQGKM 375
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     532 TVTQFWdgektfcIPSsrgeqtpgadplsTGAEGEDVGDDmslhaqdasrrGYIPLSAHSTAASSASPHFAKSSCGG--A 609
Cdd:TIGR01523  376 IARQIW-------IPR-------------FGTISIDNSDD-----------AFNPNEGNVSGIPRFSPYEYSHNEAAdqD 424
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     610 AVSEGLAELQEKNFKWEVLM-QAIALNSTAFLETEEVVVAQgtgEETRFTQVKhvGSPTECALLAF-------------- 674
Cdd:TIGR01523  425 ILKEFKDELKEIDLPEDIDMdLFIKLLETAALANIATVFKD---DATDCWKAH--GDPTEIAIHVFakkfdlphnaltge 499
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     675 ----QDERCGGDYASTRRLYLGEDEVELIAREDFSSDRKMMTSVVRilknsgDSTGATspaspglLRVFVKGAGERVLAQ 750
Cdd:TIGR01523  500 edllKSNENDQSSLSQHNEKPGSAQFEFIAEFPFDSEIKRMASIYE------DNHGET-------YNIYAKGAFERIIEC 566
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     751 CSSVLVADQViPLTPERKAEVEKTV--VDAMAAEALRTICLAYRDIDpeREPDWRERCAAPHQMFMKGETQLTCLGIAGI 828
Cdd:TIGR01523  567 CSSSNGKDGV-KISPLEDCDRELIIanMESLAAEGLRVLAFASKSFD--KADNNDDQLKNETLNRATAESDLEFLGLIGI 643
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     829 EDPVRDEVPGAVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIF--------HEESGGLAMLGPDFtraiggvvcqtcqte 900
Cdd:TIGR01523  644 YDPPRNESAGAVEKCHQAGINVHMLTGDFPETAKAIAQEVGIIppnfihdrDEIMDSMVMTGSQF--------------- 708
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     901 vcacatDAKTAEEqnkplrvdvVRDLDAFDKiwtrleVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVG 980
Cdd:TIGR01523  709 ------DALSDEE---------VDDLKALCL------VIARCAPQTKVKMIEALHRRKAFCAMTGDGVNDSPSLKMANVG 767
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     981 FAMGLSGKEVAKQAADIVMLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREA-----PLSAVQ 1055
Cdd:TIGR01523  768 IAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRMFDNIMKFVLHLLAENVAEAILLIIGLAFRDENgksvfPLSPVE 847
                          890       900       910       920       930
                   ....*....|....*....|....*....|....*....|....*....|..
gi 8100500    1056 MLWVNLIMDSFASLALATESPTDDLLNRKPQGRDSYLISRSMLTSIVAASIY 1107
Cdd:TIGR01523  848 ILWCIMITSCFPAMGLGLEKAAPDLMDRLPHDNEVGIFQKELIIDMFAYGFF 899
P-type_ATPase cd07539
uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase ...
223-1074 3.17e-77

uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase transporters of unknown function. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd2+, and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319840 [Multi-domain]  Cd Length: 634  Bit Score: 269.29  E-value: 3.17e-77
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   223 VVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESdmirkapfqqclnealsretafssalds 302
Cdd:cd07539  100 RAPAGRTQTVPAESLVPGDVIELRAGEVVPADARLLEADDLEVDESALTGES---------------------------- 151
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   303 aenLPapgssVDHRRrsrgsfgAPSSGAPLQAQTCttssacadtlkseggvctqlelarhhevaspVLLSGTTVSTGSGT 382
Cdd:cd07539  152 ---LP-----VDKQV-------APTPGAPLADRAC-------------------------------MLYEGTTVVSGQGR 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   383 ALVVAVGRYSQVGQMFQKLAYDAEPTPLQRKLNALAEDIG--TFGLISAVVAFFVLllefwvmyflqdpsKRESAVDVVH 460
Cdd:cd07539  186 AVVVATGPHTEAGRAQSLVAPVETATGVQAQLRELTSQLLplSLGGGAAVTGLGLL--------------RGAPLRQAVA 251
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   461 DhveffvtAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQFwdge 540
Cdd:cd07539  252 D-------GVSLAVAAVPEGLPLVATLAQLAAARRLSRRGVLVRSPRTVEALGRVDTICFDKTGTLTENRLRVVQV---- 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   541 ktfcipssrgeqtpgADPLstgaegedvgddmslhaqdasrrgyiplsahstaassasphfaksscggaavseglaelqe 620
Cdd:cd07539  321 ---------------RPPL------------------------------------------------------------- 324
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   621 knfkwevlmqaialnstafletEEVVvaqgtgeetrftqvkhvgsptecallafqdercggdyastrrlylgedevelia 700
Cdd:cd07539  325 ----------------------AELP------------------------------------------------------ 328
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   701 redFSSDRKMMTSVVRIlknsgdstgatspaSPGLLRVFVKGAGERVLAQCSSVLVADQVIPLTPERKAEVEKtVVDAMA 780
Cdd:cd07539  329 ---FESSRGYAAAIGRT--------------GGGIPLLAVKGAPEVVLPRCDRRMTGGQVVPLTEADRQAIEE-VNELLA 390
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   781 AEALRTICLAYRDIDpEREPDWRERCaaphqmfmkgETQLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTGDNIIT 860
Cdd:cd07539  391 GQGLRVLAVAYRTLD-AGTTHAVEAV----------VDDLELLGLLGLADTARPGAAALIAALHDAGIDVVMITGDHPIT 459
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   861 AKAIAKRCEIfheesgglamlgPDFTRAIGGvvcqtcqTEVCACATDAKTAEeqnkplrvdvVRDLDAFdkiwtrlevlA 940
Cdd:cd07539  460 ARAIAKELGL------------PRDAEVVTG-------AELDALDEEALTGL----------VADIDVF----------A 500
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   941 RSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIVMLDDNFTCIVKAVKWGRNVYDN 1020
Cdd:cd07539  501 RVSPEQKLQIVQALQAAGRVVAMTGDGANDAAAIRAADVGIGVGARGSDAAREAADLVLTDDDLETLLDAVVEGRTMWQN 580
                        810       820       830       840       850
                 ....*....|....*....|....*....|....*....|....*....|....
gi 8100500  1021 IRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATE 1074
Cdd:cd07539  581 VRDAVHVLLGGNLGEVMFTLIGTAIGGGAPLNTRQLLLVNLLTDMFPALALAVE 634
P-type_ATPase_Na-K_like cd02608
alpha-subunit of Na(+)/K(+)-ATPases and of gastric H(+)/K(+)-ATPase, similar to the human Na(+) ...
222-1085 9.73e-76

alpha-subunit of Na(+)/K(+)-ATPases and of gastric H(+)/K(+)-ATPase, similar to the human Na(+)/K(+)-ATPase alpha subunits 1-4; This subfamily includes the alpha subunit of Na(+)/K(+)-ATPase a heteromeric transmembrane protein composed of an alpha- and beta-subunit and an optional third subunit belonging to the FXYD proteins which are more tissue specific regulatory subunits of the enzyme. The alpha-subunit is the catalytic subunit responsible for transport activities of the enzyme. This subfamily includes all four isotopes of the human alpha subunit: (alpha1-alpha4, encoded by the ATP1A1- ATP1A4 genes). Na(+)/K(+)-ATPase functions chiefly as an ion pump, hydrolyzing one molecule of ATP to pump three Na(+) out of the cell in exchange for two K(+)entering the cell per pump cycle. In addition Na(+)/K(+)-ATPase acts as a signal transducer. This subfamily also includes Oreochromis mossambicus (tilapia) Na(+)/K(+)-ATPase alpha 1 and alpha 3 subunits, and gastric H(+)/K(+)-ATPase which exchanges hydronium ion with potassium and is responsible for gastric acid secretion. Gastric H(+)/K(+)-ATPase is an alpha,beta-heterodimeric enzyme. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319794 [Multi-domain]  Cd Length: 905  Bit Score: 271.15  E-value: 9.73e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   222 TVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESdmirkapfqqclnEALSRETAFSSald 301
Cdd:cd02608  109 LVIRDGEKMQINAEELVVGDLVEVKGGDRIPADIRIISAHGCKVDNSSLTGES-------------EPQTRSPEFTH--- 172
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   302 saENlpapgssvdhrrrsrgsfgapssgaPLQAQTCTTSSacadtlkseggvctqlelarhhevaspvllsgTTVSTGSG 381
Cdd:cd02608  173 --EN-------------------------PLETKNIAFFS--------------------------------TNCVEGTA 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   382 TALVVAVGRYSQVGQMfQKLA--YDAEPTPLqrklnalAEDIGTFGLISAVVAFFvLLLEFWVMYFLQDPSKRESAVdvv 459
Cdd:cd02608  194 RGIVINTGDRTVMGRI-ATLAsgLEVGKTPI-------AREIEHFIHIITGVAVF-LGVSFFILSLILGYTWLEAVI--- 261
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   460 hdhveFFvtaITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQFWdg 539
Cdd:cd02608  262 -----FL---IGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMW-- 331
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   540 ektFcipssrgeqtpgadplstgaegedvgdDMSLHAQDASRrgyiplsahstaaSSASPHFAKSSCGgaavseglaelq 619
Cdd:cd02608  332 ---F---------------------------DNQIHEADTTE-------------DQSGASFDKSSAT------------ 356
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   620 eknfkWEVLMQAIALNSTAFLETEEvvvaqgtgEETRFTQVKHVGSPTECALLAFQdERCGGDYASTRRLYlgedevELI 699
Cdd:cd02608  357 -----WLALSRIAGLCNRAEFKAGQ--------ENVPILKRDVNGDASESALLKCI-ELSCGSVMEMRERN------PKV 416
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   700 AREDFSSDRKMMTSvvrILKNSgdstgatSPASPGLLRVfVKGAGERVLAQCSSVLVADQVIPLTPERKAEVEKTVVDaM 779
Cdd:cd02608  417 AEIPFNSTNKYQLS---IHENE-------DPGDPRYLLV-MKGAPERILDRCSTILINGKEQPLDEEMKEAFQNAYLE-L 484
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   780 AAEALRTicLAYRDidperepdwrerCAAPHQMFMKG-----------ETQLTCLGIAGIEDPVRDEVPGAVAQCQRAGI 848
Cdd:cd02608  485 GGLGERV--LGFCH------------LYLPDDKFPEGfkfdtdevnfpTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGI 550
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   849 KVRMVTGDNIITAKAIAKRCEIFheesgglamlgpdftraiggvvcqtcqtevcacatdaktaeeqnkplrvdvvrdlda 928
Cdd:cd02608  551 KVIMVTGDHPITAKAIAKGVGII--------------------------------------------------------- 573
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   929 fdkiwtrleVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIVMLDDNFTCIV 1008
Cdd:cd02608  574 ---------VFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIV 644
                        810       820       830       840       850       860       870
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 8100500  1009 KAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKP 1085
Cdd:cd02608  645 TGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTITILCIDLGTDMVPAISLAYEKAESDIMKRQP 721
P-type_ATPase cd07538
uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase ...
123-1108 1.42e-75

uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase transporters of unknown function. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd2+, and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319839 [Multi-domain]  Cd Length: 653  Bit Score: 264.69  E-value: 1.42e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   123 VQTQQRRFGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLAllfskepevEILEGIAIWVAVLVVVVVTAGND 202
Cdd:cd07538    7 ARRRLESGGKNELPQPKKRTLLASILDVLREPMFLLLLAAALIYFVLG---------DPREGLILLIFVVVIIAIEVVQE 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   203 WMKEQQFAKLSVVKDdKKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRKAPf 282
Cdd:cd07538   78 WRTERALEALKNLSS-PRATVIRDGRERRIPSRELVPGDLLILGEGERIPADGRLLENDDLGVDESTLTGESVPVWKRI- 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   283 qqclnealsretafssalDSAENLPAPGSSvdhrrrsrgsfgapssgaplqaqtcttssacadtlkseggvctqlelarh 362
Cdd:cd07538  156 ------------------DGKAMSAPGGWD-------------------------------------------------- 167
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   363 hevaSPVLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKLA-YDAEPTPLQRKLNALAEdigtfglISAVVAFFVLLLEFW 441
Cdd:cd07538  168 ----KNFCYAGTLVVRGRGVAKVEATGSRTELGKIGKSLAeMDDEPTPLQKQTGRLVK-------LCALAALVFCALIVA 236
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   442 VMYFLQDpskresavdvvhDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSD 521
Cdd:cd07538  237 VYGVTRG------------DWIQAILAGITLAMAMIPEEFPVILTVFMAMGAWRLAKKNVLVRRAAAVETLGSITVLCVD 304
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   522 KTGTLTKNQMTVTQFWdgektfcipssrgeqtpgadplstgaegedvgddmslhaqdasrrgyiplsahstaassasphf 601
Cdd:cd07538  305 KTGTLTKNQMEVVELT---------------------------------------------------------------- 320
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   602 aksscggaavseglaelqeknfkwevlmqaialnstafleteevvvaqgtgeetrftqvkhvgsptecallafqdercgg 681
Cdd:cd07538      --------------------------------------------------------------------------------
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   682 dyastrrlylgedevELIAREDFSSDRKMMTSVVRIlknsgdSTGATSPAspgllrvfvKGAGERVLAQCSsvlvadqvi 761
Cdd:cd07538  321 ---------------SLVREYPLRPELRMMGQVWKR------PEGAFAAA---------KGSPEAIIRLCR--------- 361
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   762 pLTPERKAEVEKTVvDAMAAEALRTICLAYRDIDPEREPDWRERCAaphqmfmkgetqLTCLGIAGIEDPVRDEVPGAVA 841
Cdd:cd07538  362 -LNPDEKAAIEDAV-SEMAGEGLRVLAVAACRIDESFLPDDLEDAV------------FIFVGLIGLADPLREDVPEAVR 427
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   842 QCQRAGIKVRMVTGDNIITAKAIAKRCEIFHEESgglamlgpdftrAIGGvvcqtcqtEVCACATDAKTAEeqnkplRVD 921
Cdd:cd07538  428 ICCEAGIRVVMITGDNPATAKAIAKQIGLDNTDN------------VITG--------QELDAMSDEELAE------KVR 481
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   922 VVRdldafdkiwtrleVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIVMLD 1001
Cdd:cd07538  482 DVN-------------IFARVVPEQKLRIVQAFKANGEIVAMTGDGVNDAPALKAAHIGIAMGKRGTDVAREASDIVLLD 548
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500  1002 DNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNvVAVALTVVCTAVQREAPL-SAVQMLWVNLIMDSFASLALATESPTDDL 1080
Cdd:cd07538  549 DNFSSIVSTIRLGRRIYDNLKKAITYVFAIH-VPIAGLALLPPLLGLPPLlFPVHVVLLELIIDPTCSIVFEAEPAERDI 627
                        970       980
                 ....*....|....*....|....*...
gi 8100500  1081 LNRKPQGRDSYLISrsmlTSIVAASIYQ 1108
Cdd:cd07538  628 MRRPPRPPDEPLFG----PRLVIKAILQ 651
ATPase-IIC_X-K TIGR01106
sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit; This ...
219-1086 2.99e-74

sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit; This model describes the P-type ATPases responsible for the exchange of either protons or sodium ions for potassium ions across the plasma membranes of eukaryotes. Unlike most other P-type ATPases, members of this subfamily require a beta subunit for activity. This model encompasses eukaryotes and consists of two functional types, a Na/K antiporter found widely distributed in eukaryotes and a H/K antiporter found only in vertebrates. The Na+ or H+/K+ antiporter P-type ATPases have been characterized as Type IIC based on a published phylogenetic analysis. Sequences from Blastocladiella emersonii (GP|6636502, GP|6636502 and PIR|T43025), C. elegans (GP|2315419, GP|6671808 and PIR|T31763) and Drosophila melanogaster (GP|7291424) score below trusted cutoff, apparently due to long branch length (excessive divergence from the last common ancestor) as evidenced by a phylogenetic tree. Experimental evidence is needed to determine whether these sequences represent ATPases with conserved function. Aside from fragments, other sequences between trusted and noise appear to be bacterial ATPases of unclear lineage, but most likely calcium pumps. [Energy metabolism, ATP-proton motive force interconversion]


Pssm-ID: 273445 [Multi-domain]  Cd Length: 997  Bit Score: 268.58  E-value: 2.99e-74
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     219 KKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESdmirkapfqqclnEALSRETAFSS 298
Cdd:TIGR01106  141 QQALVIRDGEKMSINAEQVVVGDLVEVKGGDRIPADLRIISAQGCKVDNSSLTGES-------------EPQTRSPEFTH 207
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     299 aldsaENlpapgssvdhrrrsrgsfgapssgaPLQAQT-CTTSSACAdtlksEGGVctqlelarhhevaspvllSGTTVS 377
Cdd:TIGR01106  208 -----EN-------------------------PLETRNiAFFSTNCV-----EGTA------------------RGIVVN 234
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     378 TGSGTALvvavGRYSQVGQmfqklAYDAEPTPLqrklnalAEDIGTFGLISAVVAFFvLLLEFWVMYFLQDPSKRESAVd 457
Cdd:TIGR01106  235 TGDRTVM----GRIASLAS-----GLENGKTPI-------AIEIEHFIHIITGVAVF-LGVSFFILSLILGYTWLEAVI- 296
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     458 vvhdhveFFvtaITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQFW 537
Cdd:TIGR01106  297 -------FL---IGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMW 366
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     538 dgektFcipssrgeqtpgadplstgaegedvgdDMSLHAQDASRrgyiplsahstaaSSASPHFAKSSCGgaavseglae 617
Cdd:TIGR01106  367 -----F---------------------------DNQIHEADTTE-------------DQSGVSFDKSSAT---------- 391
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     618 lqeknfkWEVLMQAIALNSTAfleteevvVAQGTGEETRFTQVKHVGSPTECALLAFQdERCGGDYASTRRLYlgedevE 697
Cdd:TIGR01106  392 -------WLALSRIAGLCNRA--------VFKAGQENVPILKRAVAGDASESALLKCI-ELCLGSVMEMRERN------P 449
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     698 LIAREDFSSDRKMMTSVVRIlknsgdstgaTSPASPGLLRVfVKGAGERVLAQCSSVLVADQVIPLTPERKaEVEKTVVD 777
Cdd:TIGR01106  450 KVVEIPFNSTNKYQLSIHEN----------EDPRDPRHLLV-MKGAPERILERCSSILIHGKEQPLDEELK-EAFQNAYL 517
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     778 AMAAEALRTI--CLAYRDIDpEREPDWRERCAAphqmfMKGETQLTC-LGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVT 854
Cdd:TIGR01106  518 ELGGLGERVLgfCHLYLPDE-QFPEGFQFDTDD-----VNFPTDNLCfVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVT 591
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     855 GDNIITAKAIAKRCEIFHEESGGLAmlgpDFTRAIGGVVCQTCQTEVCAC---ATDAK--TAEEqnkplrvdvvrdLDAF 929
Cdd:TIGR01106  592 GDHPITAKAIAKGVGIISEGNETVE----DIAARLNIPVSQVNPRDAKACvvhGSDLKdmTSEQ------------LDEI 655
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     930 DKIWTRLeVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIVMLDDNFTCIVK 1009
Cdd:TIGR01106  656 LKYHTEI-VFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVT 734
                          810       820       830       840       850       860       870
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 8100500    1010 AVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKPQ 1086
Cdd:TIGR01106  735 GVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTITILCIDLGTDMVPAISLAYEKAESDIMKRQPR 811
P-type_ATPase_Mg cd02077
magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella ...
123-1118 3.84e-71

magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella typhimurium MgtA; MgtA is a membrane protein which actively transports Mg(2+) into the cytosol with its electro-chemical gradient rather than against the gradient as other cation transporters do. It may act both as a transporter and as a sensor for Mg(2+). In Salmonella typhimurium and Escherichia coli, the two-component system PhoQ/PhoP regulates the transcription of the mgtA gene by sensing Mg(2+) concentrations in the periplasm. MgtA is activated by cardiolipin and it highly sensitive to free magnesium in vitro. It consists of a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319772 [Multi-domain]  Cd Length: 768  Bit Score: 254.87  E-value: 3.84e-71
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   123 VQTQQRRFGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLALLFSkePEVEILEGIAIwvaVLVVVVVTAGND 202
Cdd:cd02077    7 AEERLEKYGPNEISHEKFPSWFKLLLKAFINPFNIVLLVLALVSFFTDVLLA--PGEFDLVGALI---ILLMVLISGLLD 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   203 WMKE---QQFAK--LSVVKddKKCTVVRSGHKEQ-ISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDM 276
Cdd:cd02077   82 FIQEirsLKAAEklKKMVK--NTATVIRDGSKYMeIPIDELVPGDIVYLSAGDMIPADVRIIQSKDLFVSQSSLTGESEP 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   277 IRKapfqqclnEALSRETAFSSALDsAENLpapgssvdhrrrsrgsfgapssgaplqaqtcttssacadtlkseggvctq 356
Cdd:cd02077  160 VEK--------HATAKKTKDESILE-LENI-------------------------------------------------- 180
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   357 lelarhhevaspvLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKLAYDAEPTPLQRKLNALaedigTFGLISA--VVAFF 434
Cdd:cd02077  181 -------------CFMGTNVVSGSALAVVIATGNDTYFGSIAKSITEKRPETSFDKGINKV-----SKLLIRFmlVMVPV 242
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   435 VLLLEFWvmyflqdpSKResavdvvhDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGG 514
Cdd:cd02077  243 VFLINGL--------TKG--------DWLEALLFALAVAVGLTPEMLPMIVTSNLAKGAVRMSKRKVIVKNLNAIQNFGA 306
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   515 ANEICSDKTGTLTKNQMTVTQFWDgektfcipssrgeqtpgadplstgaegedvgddmsLHAQDASRrgyiplsahstaa 594
Cdd:cd02077  307 MDILCTDKTGTLTQDKIVLERHLD-----------------------------------VNGKESER------------- 338
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   595 ssasphfaksscggaavseglaelqeknfkwevLMQAIALNStaFLETEevvvaqgtgeetrftqvkhVGSPTECALLAF 674
Cdd:cd02077  339 ---------------------------------VLRLAYLNS--YFQTG-------------------LKNLLDKAIIDH 364
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   675 QDERcggDYASTRRLYLGEDEVELiareDFSsdRKMMtSVVrILKNSGDStgatspaspgllRVFVKGAGERVLAQCSSV 754
Cdd:cd02077  365 AEEA---NANGLIQDYTKIDEIPF----DFE--RRRM-SVV-VKDNDGKH------------LLITKGAVEEILNVCTHV 421
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   755 LVADQVIPLTPERKAEVEKtVVDAMAAEALRTICLAYRDID-PEREPDwrercaaphqmfMKGETQLTCLGIAGIEDPVR 833
Cdd:cd02077  422 EVNGEVVPLTDTLREKILA-QVEELNREGLRVLAIAYKKLPaPEGEYS------------VKDEKELILIGFLAFLDPPK 488
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   834 DEVPGAVAQCQRAGIKVRMVTGDNIITAKAIAKrceifheesgglaMLGPDFTRAIGGvvcqtcqTEVCAcATDAKTAEe 913
Cdd:cd02077  489 ESAAQAIKALKKNGVNVKILTGDNEIVTKAICK-------------QVGLDINRVLTG-------SEIEA-LSDEELAK- 546
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   914 qnkplrvdVVRDLDAFDKIwtrlevlarsQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGlSGKEVAKQ 993
Cdd:cd02077  547 --------IVEETNIFAKL----------SPLQKARIIQALKKNGHVVGFMGDGINDAPALRQADVGISVD-SAVDIAKE 607
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   994 AADIVMLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDsFASLALAT 1073
Cdd:cd02077  608 AADIILLEKDLMVLEEGVIEGRKTFGNILKYIKMTASSNFGNVFSVLVASAFLPFLPMLPIQLLLQNLLYD-FSQLAIPF 686
                        970       980       990      1000
                 ....*....|....*....|....*....|....*....|....*
gi 8100500  1074 ESPTDDLLnRKPQGRDSYLISRSMLTSIVAASIYQLTVMIGLIFF 1118
Cdd:cd02077  687 DNVDEEFL-KKPQKWDIKNIGRFMIWIGPISSIFDILTFLVMWFV 730
P-type_ATPase_H cd02076
plant and fungal plasma membrane H(+)-ATPases, and related bacterial and archaeal putative H(+) ...
123-1073 5.91e-55

plant and fungal plasma membrane H(+)-ATPases, and related bacterial and archaeal putative H(+)-ATPases; This subfamily includes eukaryotic plasma membrane H(+)-ATPase which transports H(+) from the cytosol to the extracellular space, thus energizing the plasma membrane for the uptake of ions and nutrients, and is expressed in plants and fungi. This H(+)-ATPase consists of four domains: a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. This subfamily also includes the putative P-type H(+)-ATPase, MJ1226p of the anaerobic hyperthermophilic archaea Methanococcus jannaschii. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319771 [Multi-domain]  Cd Length: 781  Bit Score: 206.31  E-value: 5.91e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   123 VQTQQRRFGVNRIP-------HRPLTSFWTL---LIEAAsdatlrVLMLCGL-----LSVVLALLFSkepeveilegiai 187
Cdd:cd02076    7 AAKRLKEYGPNELPekkenpiLKFLSFFWGPipwMLEAA------AILAAALgdwvdFAIILLLLLI------------- 67
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   188 wvavlvvvvvTAGNDWMKEQQFAK-LSVVKDD--KKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLT 264
Cdd:cd02076   68 ----------NAGIGFIEERQAGNaVAALKKSlaPKARVLRDGQWQEIDAKELVPGDIVSLKIGDIVPADARLLTGDALQ 137
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   265 VDESSLTGESDMIRKAPFQQCLnealsretafssaldsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcttssaca 344
Cdd:cd02076  138 VDQSALTGESLPVTKHPGDEAY---------------------------------------------------------- 159
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   345 dtlkseggvctqlelarhhevaspvllSGTTVSTGSGTALVVAVGRYSQVGQMFQKLAYDAEPTPLQRKLNAlaedIGTF 424
Cdd:cd02076  160 ---------------------------SGSIVKQGEMLAVVTATGSNTFFGKTAALVASAEEQGHLQKVLNK----IGNF 208
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   425 gLIsaVVAFFVLLLEFWVMYFLQDPskresavdvvhdHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVR 504
Cdd:cd02076  209 -LI--LLALILVLIIVIVALYRHDP------------FLEILQFVLVLLIASIPVAMPAVLTVTMAVGALELAKKKAIVS 273
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   505 RLAACEIMGGANEICSDKTGTLTKNQMTVTqfwdgektfcipssrgeqtpgaDPLSTGAEGEDvgdDMSLHAQDASRRgy 584
Cdd:cd02076  274 RLSAIEELAGVDILCSDKTGTLTLNKLSLD----------------------EPYSLEGDGKD---ELLLLAALASDT-- 326
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   585 iplsahstaassasphfaksscggaavsEGLaelqeknfkwEVLMQAIalnsTAFLETEEVVVAqgtgeetRFTQVKHVg 664
Cdd:cd02076  327 ----------------------------ENP----------DAIDTAI----LNALDDYKPDLA-------GYKQLKFT- 356
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   665 sPtecallafqdercggdyastrrlylgedeveliaredFSSDRKMMTSVVRilknsgDSTGATspaspglLRVfVKGAG 744
Cdd:cd02076  357 -P-------------------------------------FDPVDKRTEATVE------DPDGER-------FKV-TKGAP 384
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   745 ERVLAQCSsvlvADQVIpltpeRKAEVEKtvVDAMAAEALRTICLAYRDIDPerepdwrercaaphQMFMkgetqltcLG 824
Cdd:cd02076  385 QVILELVG----NDEAI-----RQAVEEK--IDELASRGYRSLGVARKEDGG--------------RWEL--------LG 431
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   825 IAGIEDPVRDEVPGAVAQCQRAGIKVRMVTGDNIITAKAIAKR---------CEIFHEESGGLAMLGPDftraiggvvcq 895
Cdd:cd02076  432 LLPLFDPPRPDSKATIARAKELGVRVKMITGDQLAIAKETARQlgmgtnilsAERLKLGGGGGGMPGSE----------- 500
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   896 tcqtevcacatdaktaeeqnkplRVDVVRDLDAFDKIWtrlevlarsqPSDKYALVTALKQKGRVVAVTGDGTNDAPALK 975
Cdd:cd02076  501 -----------------------LIEFIEDADGFAEVF----------PEHKYRIVEALQQRGHLVGMTGDGVNDAPALK 547
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   976 KADVGFAmgLSG-KEVAKQAADIVMLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAV 1054
Cdd:cd02076  548 KADVGIA--VSGaTDAARAAADIVLTAPGLSVIIDAIKTSRQIFQRMKSYVIYRIAETLRILVFFTLGILILNFYPLPLI 625
                        970
                 ....*....|....*....
gi 8100500  1055 QMLWVNlIMDSFASLALAT 1073
Cdd:cd02076  626 MIVLIA-ILNDGATLTIAY 643
P-type_ATPase cd02609
uncharacterized subfamily of P-type ATPase transporter, similar to uncharacterized ...
220-1077 1.42e-54

uncharacterized subfamily of P-type ATPase transporter, similar to uncharacterized Streptococcus pneumoniae exported protein 7, Exp7; This subfamily contains P-type ATPase transporters of unknown function, similar to Streptococcus pneumoniae Exp7. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd(2+), and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319795 [Multi-domain]  Cd Length: 661  Bit Score: 202.90  E-value: 1.42e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   220 KCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRKAPFQQclnealsretafssa 299
Cdd:cd02609   93 KVTVIRDGQEVKIPPEELVLDDILILKPGEQIPADGEVVEGGGLEVDESLLTGESDLIPKKAGDK--------------- 157
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   300 ldsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcttssacadtlkseggvctqlelarhhevaspvLLSGTTVSTG 379
Cdd:cd02609  158 ----------------------------------------------------------------------LLSGSFVVSG 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   380 SGTALVVAVGRYSQVGQMFQKL-AYDAEPTPLQRKLNALaedigtFGLISAVVAFFVLLLeFWVMYFLQDPSKRESAVDV 458
Cdd:cd02609  168 AAYARVTAVGAESYAAKLTLEAkKHKLINSELLNSINKI------LKFTSFIIIPLGLLL-FVEALFRRGGGWRQAVVST 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   459 VhdhveffvtaiTMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVtqfwd 538
Cdd:cd02609  241 V-----------AALLGMIPEGLVLLTSVALAVGAIRLAKKKVLVQELYSIETLARVDVLCLDKTGTITEGKMKV----- 304
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   539 gEKTFcipssrgeqtpgadPLSTGAEGEDVgddmslhaqdasrrgyiplsahstaassasphfaksscggAAVSEGLAEL 618
Cdd:cd02609  305 -ERVE--------------PLDEANEAEAA----------------------------------------AALAAFVAAS 329
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   619 QEKNfkweVLMQAIAlnstafleteevvvaqgtgeetrftqvkhvgsptecallafqdERCGGDyastrrlylgeDEVEL 698
Cdd:cd02609  330 EDNN----ATMQAIR-------------------------------------------AAFFGN-----------NRFEV 351
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   699 IAREDFSSDRKMmtsvvrilknsgdsTGATSPASpgllRVFVKGAGERVLAQCSSVLVADqvipltperkaevektvVDA 778
Cdd:cd02609  352 TSIIPFSSARKW--------------SAVEFRDG----GTWVLGAPEVLLGDLPSEVLSR-----------------VNE 396
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   779 MAAEALRTICLAY--RDIDPEREPDwrercaaphqmfmkgetQLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTGD 856
Cdd:cd02609  397 LAAQGYRVLLLARsaGALTHEQLPV-----------------GLEPLALILLTDPIRPEAKETLAYFAEQGVAVKVISGD 459
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   857 NIITAKAIAKRCEIFHEESgglamlgpdftraiggvvcqtcqtevcacATDAKTAEeqnkplrvdvvrDLDAFDKIWTRL 936
Cdd:cd02609  460 NPVTVSAIAKRAGLEGAES-----------------------------YIDASTLT------------TDEELAEAVENY 498
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   937 EVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGlSGKEVAKQAADIVMLDDNFTCIVKAVKWGRN 1016
Cdd:cd02609  499 TVFGRVTPEQKRQLVQALQALGHTVAMTGDGVNDVLALKEADCSIAMA-SGSDATRQVAQVVLLDSDFSALPDVVFEGRR 577
                        810       820       830       840       850       860
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 8100500  1017 VYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPT 1077
Cdd:cd02609  578 VVNNIERVASLFLVKTIYSVLLALICVITALPFPFLPIQITLISLFTIGIPSFFLALEPNK 638
ATPase-IIIB_Mg TIGR01524
magnesium-translocating P-type ATPase; This model describes the magnesium translocating P-type ...
109-1132 5.66e-46

magnesium-translocating P-type ATPase; This model describes the magnesium translocating P-type ATPase found in a limited number of bacterial species and best described in Salmonella typhimurium, which contains two isoforms. These transporters are active in low external Mg2+ concentrations and pump the ion into the cytoplasm. The magnesium ATPases have been classified as type IIIB by a phylogenetic analysis. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 130587 [Multi-domain]  Cd Length: 867  Bit Score: 179.68  E-value: 5.66e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     109 LLRRSIGSEQGGDLVQTQQRR--FGVNRIPHRPLTSFWTLLIEAASDATLRVLMLCGLLSVVLALLFSKEPeVEILEGIA 186
Cdd:TIGR01524   23 LLRKLGVHETGLTNVEVTERLaeFGPNQTVEEKKVPNLRLLIRAFNNPFIYILAMLMGVSYLTDDLEATVI-IALMVLAS 101
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     187 IWVAVLVVVVVTAGNDWMKeqqfaklSVVKDdkKCTVVRSGHK------EQISVFQLVVGDILHLEAGDEVPADALVVQG 260
Cdd:TIGR01524  102 GLLGFIQESRAERAAYALK-------NMVKN--TATVLRVINEngngsmDEVPIDALVPGDLIELAAGDIIPADARVISA 172
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     261 RDLTVDESSLTGESdmirkapfqqclnealsretafssaldsaenLPAPGSSVDHRrrsrgsfgaPSSGAPLQAQTctts 340
Cdd:TIGR01524  173 RDLFINQSALTGES-------------------------------LPVEKFVEDKR---------ARDPEILEREN---- 208
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     341 sacadtlkseggvctqlelarhhevaspVLLSGTTVSTGSGTALVVAVGRYSQVGQMFQKLAYDAEPTPLQRKLNALAED 420
Cdd:TIGR01524  209 ----------------------------LCFMGTNVLSGHAQAVVLATGSSTWFGSLAIAATERRGQTAFDKGVKSVSKL 260
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     421 IGTFGLISAVVAFFVLLLefwvmyflqdpSKresavdvvHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQ 500
Cdd:TIGR01524  261 LIRFMLVMVPVVLMINGL-----------MK--------GDWLEAFLFALAVAVGLTPEMLPMIVSSNLAKGAINMSKKK 321
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     501 NYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQFWD--GEktfciPSSRgeqtpgadplstgaegedvgddmslhaqd 578
Cdd:TIGR01524  322 VIVKELSAIQNFGAMDILCTDKTGTLTQDKIELEKHIDssGE-----TSER----------------------------- 367
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     579 asrrgyiplsahstaassasphfaksscggaavseglaelqeknfkweVLMQAIaLNSTAFleteevvvaqgtgeetrfT 658
Cdd:TIGR01524  368 ------------------------------------------------VLKMAW-LNSYFQ------------------T 380
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     659 QVKHVgspTECALLAFQDERCGgdyASTRRLYLGEDEVEliaredFSSDRKMMTSVVrilKNSGDSTgatspaspgllRV 738
Cdd:TIGR01524  381 GWKNV---LDHAVLAKLDESAA---RQTASRWKKVDEIP------FDFDRRRLSVVV---ENRAEVT-----------RL 434
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     739 FVKGAGERVLAQCSSVLVADQVIPLTPERKAEVeKTVVDAMAAEALRTICLAYRDIdPEREPDWRErcaaphqmfmKGET 818
Cdd:TIGR01524  435 ICKGAVEEMLTVCTHKRFGGAVVTLSESEKSEL-QDMTAEMNRQGIRVIAVATKTL-KVGEADFTK----------TDEE 502
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     819 QLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTGDNIITAKAIAkrceifHEesgglamLGPDFTRAIGGvvcqtcq 898
Cdd:TIGR01524  503 QLIIEGFLGFLDPPKESTKEAIAALFKNGINVKVLTGDNEIVTARIC------QE-------VGIDANDFLLG------- 562
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     899 TEVCACATDAKTAEEQnkplrvdvvrdldafdkiwtRLEVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKAD 978
Cdd:TIGR01524  563 ADIEELSDEELARELR--------------------KYHIFARLTPMQKSRIIGLLKKAGHTVGFLGDGINDAPALRKAD 622
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     979 VGFAMGlSGKEVAKQAADIVMLDDNFTCIVKAVKWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLW 1058
Cdd:TIGR01524  623 VGISVD-TAADIAKEASDIILLEKSLMVLEEGVIEGRNTFGNILKYLKMTASSNFGNVFSVLVASAFIPFLPMLSLHLLI 701
                          970       980       990      1000      1010      1020      1030
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 8100500    1059 VNLIMDsFASLALATESPTDDLLnRKPQGRDSYLISRSMLTSIVAASIYQLTVMIGLIFFGERFLPETKWTFLS 1132
Cdd:TIGR01524  702 QNLLYD-FSQLTLPWDKMDREFL-KKPHQWEQKGMGRFMLCIGPVSSIFDIATFLLMWFVFSANTVEEQALFQS 773
PRK10517 PRK10517
magnesium-transporting ATPase MgtA; Provisional
222-1098 6.09e-43

magnesium-transporting ATPase MgtA; Provisional


Pssm-ID: 236705 [Multi-domain]  Cd Length: 902  Bit Score: 170.25  E-value: 6.09e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    222 TVVRSG------HKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRKApfqqclneALSRETA 295
Cdd:PRK10517  162 TVLRVIndkgenGWLEIPIDQLVPGDIIKLAAGDMIPADLRILQARDLFVAQASLTGESLPVEKF--------ATTRQPE 233
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    296 FSSALDsaenlpapgssvdhrrrsrgsfgapssgaplqaqtcttssacADTLkseggvctqlelarhhevaspvLLSGTT 375
Cdd:PRK10517  234 HSNPLE------------------------------------------CDTL----------------------CFMGTN 249
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    376 VSTGSGTALVVAVGRYSQVGQMFQKL-AYDAEPTPLQRKLNALAEDIGTFGLisaVVAFFVLLLEFWvmyflqdpSKres 454
Cdd:PRK10517  250 VVSGTAQAVVIATGANTWFGQLAGRVsEQDSEPNAFQQGISRVSWLLIRFML---VMAPVVLLINGY--------TK--- 315
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    455 avdvvHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVT 534
Cdd:PRK10517  316 -----GDWWEAALFALSVAVGLTPEMLPMIVTSTLARGAVKLSKQKVIVKRLDAIQNFGAMDILCTDKTGTLTQDKIVLE 390
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    535 QfwdgektfcipssrgeqtpgadplSTGAEGEDvgddmslhaqdasrrgyiplsahstaassasphfaksscggaavSEg 614
Cdd:PRK10517  391 N------------------------HTDISGKT--------------------------------------------SE- 401
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    615 laelqeknfkwEVLMQAIaLNS---TAFLETEEVVVAQGTGEETRFtqvkhvgsptecallafqdeRCGGDYastRRLyl 691
Cdd:PRK10517  402 -----------RVLHSAW-LNShyqTGLKNLLDTAVLEGVDEESAR--------------------SLASRW---QKI-- 444
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    692 geDEVELiareDFssDRKMMTSVVRilknsgdstgatSPASPGLLrvFVKGAGERVLAQCSSVLVADQVIPLTPERKAEV 771
Cdd:PRK10517  445 --DEIPF----DF--ERRRMSVVVA------------ENTEHHQL--ICKGALEEILNVCSQVRHNGEIVPLDDIMLRRI 502
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    772 EKtVVDAMAAEALRTICLAYRDIdPEREPDWRercaaphqmfMKGETQLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVR 851
Cdd:PRK10517  503 KR-VTDTLNRQGLRVVAVATKYL-PAREGDYQ----------RADESDLILEGYIAFLDPPKETTAPALKALKASGVTVK 570
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    852 MVTGDNIITAkaiAKRCeifHEesgglamLGPDFTRAIGGVVCQTCQTEVCACATDAKTaeeqnkplrvdvvrdldafdk 931
Cdd:PRK10517  571 ILTGDSELVA---AKVC---HE-------VGLDAGEVLIGSDIETLSDDELANLAERTT--------------------- 616
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    932 iwtrleVLARSQPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGlSGKEVAKQAADIVMLDDNFTCIVKAV 1011
Cdd:PRK10517  617 ------LFARLTPMHKERIVTLLKREGHVVGFMGDGINDAPALRAADIGISVD-GAVDIAREAADIILLEKSLMVLEEGV 689
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   1012 KWGRNVYDNIRRFLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDsFASLALATESPTDDLLnRKPQGRDSY 1091
Cdd:PRK10517  690 IEGRRTFANMLKYIKMTASSNFGNVFSVLVASAFLPFLPMLPLHLLIQNLLYD-VSQVAIPFDNVDDEQI-QKPQRWNPA 767

                  ....*..
gi 8100500   1092 LISRSML 1098
Cdd:PRK10517  768 DLGRFMV 774
ATPase-IIIA_H TIGR01647
plasma-membrane proton-efflux P-type ATPase; This model describes the plasma membrane proton ...
220-1043 1.75e-42

plasma-membrane proton-efflux P-type ATPase; This model describes the plasma membrane proton efflux P-type ATPase found in plants, fungi, protozoa, slime molds and archaea. The best studied representative is from yeast.


Pssm-ID: 273731 [Multi-domain]  Cd Length: 754  Bit Score: 167.50  E-value: 1.75e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     220 KCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESdmirkapfqqclnealsretafssa 299
Cdd:TIGR01647   93 KARVLRDGKWQEIPASELVPGDVVRLKIGDIVPADCRLFEGDYIQVDQAALTGES------------------------- 147
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     300 ldsaenLPAPgssvdhrrrsrgsfgapssgaplqaqtcttssacadtlKSEGGVCtqlelarhhevaspvlLSGTTVSTG 379
Cdd:TIGR01647  148 ------LPVT--------------------------------------KKTGDIA----------------YSGSTVKQG 167
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     380 SGTALVVAVGrysqVGQMFQKLAY-----DAEPTPLQRKLNAlaedIGTFGLISAVVaffVLLLEFWVMYFLQDpskres 454
Cdd:TIGR01647  168 EAEAVVTATG----MNTFFGKAAAlvqstETGSGHLQKILSK----IGLFLIVLIGV---LVLIELVVLFFGRG------ 230
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     455 avdvvHDHVEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVT 534
Cdd:TIGR01647  231 -----ESFREGLQFALVLLVGGIPIAMPAVLSVTMAVGAAELAKKKAIVTRLTAIEELAGMDILCSDKTGTLTLNKLSID 305
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     535 qfwdgektfcipssrgEQTP---GADPlstgaegedvgDDMSLHAQDASRRgyiplsahstaassasphfAKSSCGGAAV 611
Cdd:TIGR01647  306 ----------------EILPffnGFDK-----------DDVLLYAALASRE-------------------EDQDAIDTAV 339
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     612 SEGLAELQEKNFKWEVLmQAIALNSTAfLETEEVVVAQGTGEETRFTqvkhvgsptecallafqdercggdyastrrlyl 691
Cdd:TIGR01647  340 LGSAKDLKEARDGYKVL-EFVPFDPVD-KRTEATVEDPETGKRFKVT--------------------------------- 384
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     692 gedeveliaredfssdrkmmtsvvrilknsgdstgatspaspgllrvfvKGAGERVLAQCssvlvadqvipltpERKAEV 771
Cdd:TIGR01647  385 -------------------------------------------------KGAPQVILDLC--------------DNKKEI 401
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     772 EKTV---VDAMAAEALRTICLAYRDidperepdwrercaAPHQMFMkgetqltcLGIAGIEDPVRDEVPGAVAQCQRAGI 848
Cdd:TIGR01647  402 EEKVeekVDELASRGYRALGVARTD--------------EEGRWHF--------LGLLPLFDPPRHDTKETIERARHLGV 459
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     849 KVRMVTGDNIITAKAIAKRCEIfheesgGLAMLGPDftRAIGGVVCQTCQTEVCacatdaktaeeqnkplrvDVVRDLDA 928
Cdd:TIGR01647  460 EVKMVTGDHLAIAKETARRLGL------GTNIYTAD--VLLKGDNRDDLPSGLG------------------EMVEDADG 513
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     929 FDKIWtrlevlarsqPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGlSGKEVAKQAADIVMLDDNFTCIV 1008
Cdd:TIGR01647  514 FAEVF----------PEHKYEIVEILQKRGHLVGMTGDGVNDAPALKKADVGIAVA-GATDAARSAADIVLTEPGLSVIV 582
                          810       820       830
                   ....*....|....*....|....*....|....*
gi 8100500    1009 KAVKWGRNVYDNIRRFLQFQltvnvVAVALTVVCT 1043
Cdd:TIGR01647  583 DAILESRKIFQRMKSYVIYR-----IAETIRIVFF 612
P-type_ATPase_APLT_Dnf-like cd02073
Aminophospholipid translocases (APLTs), similar to Saccharomyces cerevisiae Dnf1-3p, Drs2p, ...
219-995 1.17e-35

Aminophospholipid translocases (APLTs), similar to Saccharomyces cerevisiae Dnf1-3p, Drs2p, and human ATP8A2, -10D, -11B, -11C; Aminophospholipid translocases (APLTs), also known as type 4 P-type ATPases, act as flippases, and translocate specific phospholipids from the exoplasmic leaflet to the cytoplasmic leaflet of biological membranes. Yeast Dnf1 and Dnf2 mediate the transport of phosphatidylethanolamine, phosphatidylserine, and phosphatidylcholine from the outer to the inner leaflet of the plasma membrane. This subfamily includes mammalian flippases such as ATP11C which may selectively transports PS and PE from the outer leaflet of the plasma membrane to the inner leaflet. It also includes Arabidopsis phospholipid flippases including ALA1, and Caenorhabditis elegans flippases, including TAT-1, the latter has been shown to facilitate the inward transport of phosphatidylserine. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319770 [Multi-domain]  Cd Length: 836  Bit Score: 146.93  E-value: 1.17e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   219 KKCTVVRSGHKEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLT----VDESSLTGESDM-IRKAPfqqclnealsRE 293
Cdd:cd02073   83 RPVQVLRGGKFVKKKWKDIRVGDIVRVKNDEFVPADLLLLSSSEPDglcyVETANLDGETNLkIRQAL----------PE 152
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   294 TAfssALDSAENLPapgssvdhrrRSRGsfgapssgaplqaqTCTTSSACADTLKSEGgvctQLELARHHEVA-SP--VL 370
Cdd:cd02073  153 TA---LLLSEEDLA----------RFSG--------------EIECEQPNNDLYTFNG----TLELNGGRELPlSPdnLL 201
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   371 LSGTTV-STGSGTALVVAVGrysqvgqMFQKLAYDAEPTP-----LQRKLNALAedIGTFG------LISAVVAFFVLLL 438
Cdd:cd02073  202 LRGCTLrNTEWVYGVVVYTG-------HETKLMLNSGGTPlkrssIEKKMNRFI--IAIFCilivmcLISAIGKGIWLSK 272
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   439 EFWVMYFLQDPSKRESAVDVVHDhvefFVTAITMLVVAVPegLPLAVTISLAYSIGQML---RDQNY---VRRLAAC--- 509
Cdd:cd02073  273 HGRDLWYLLPKEERSPALEFFFD----FLTFIILYNNLIP--ISLYVTIEVVKFLQSFFinwDLDMYdeeTDTPAEArts 346
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   510 ---EIMGGANEICSDKTGTLTKNQMTvtqfwdgektfcipssrgeqtpgadplstgaegedvgddmslhaqdasrrgyip 586
Cdd:cd02073  347 nlnEELGQVEYIFSDKTGTLTENIME------------------------------------------------------ 372
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   587 lsahstaassasphFAKSSCGGaavseglaelqeknFKWEVLmQAIALNSTafleteeVVVAQgtgEETRFTQVKHVGSP 666
Cdd:cd02073  373 --------------FKKCSING--------------VDYGFF-LALALCHT-------VVPEK---DDHPGQLVYQASSP 413
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   667 TECALL----AFQDERCGGDYASTRRLYLGEDEV-ELIAREDFSSDRKMMTSVVRIlkNSGDstgatspaspglLRVFVK 741
Cdd:cd02073  414 DEAALVeaarDLGFVFLSRTPDTVTINALGEEEEyEILHILEFNSDRKRMSVIVRD--PDGR------------ILLYCK 479
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   742 GAgervlaqcssvlvaDQVI--PLTPERKAEVEKT--VVDAMAAEALRTICLAYRDIDPEREPDWRE-----------RC 806
Cdd:cd02073  480 GA--------------DSVIfeRLSPSSLELVEKTqeHLEDFASEGLRTLCLAYREISEEEYEEWNEkydeastalqnRE 545
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   807 AAPHQMFMKGETQLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTGDNIITAKAIAKRCEIFHEESGGLAML--GPD 884
Cdd:cd02073  546 ELLDEVAEEIEKDLILLGATAIEDKLQDGVPETIEALQRAGIKIWVLTGDKQETAINIGYSCRLLSEDMENLALVidGKT 625
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   885 FTRAIGGV-------VCQTCQTEVCaCatdaktaeeqnkplrvdvvrdldafdkiwtrlevlaRSQPSDKyALVTAL--K 955
Cdd:cd02073  626 LTYALDPElerlfleLALKCKAVIC-C------------------------------------RVSPLQK-ALVVKLvkK 667
                        810       820       830       840
                 ....*....|....*....|....*....|....*....|
gi 8100500   956 QKGRVVAVTGDGTNDAPALKKADVGfaMGLSGKEvAKQAA 995
Cdd:cd02073  668 SKKAVTLAIGDGANDVSMIQEAHVG--VGISGQE-GMQAA 704
ZntA COG2217
Cation transport ATPase [Inorganic ion transport and metabolism];
219-1040 1.08e-34

Cation transport ATPase [Inorganic ion transport and metabolism];


Pssm-ID: 225127 [Multi-domain]  Cd Length: 713  Bit Score: 143.12  E-value: 1.08e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   219 KKCTVVRSGHKEQ-ISVFQLVVGDILHLEAGDEVPADALVVQGRDlTVDESSLTGESDMIRKAPfqqclnealsretafs 297
Cdd:COG2217  211 KTATVVRGDGEEEeVPVEEVQVGDIVLVRPGERIPVDGVVVSGSS-SVDESMLTGESLPVEKKP---------------- 273
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   298 saldsaenlpapGSSVdhrrrsrgsfgapssgaplqaqtcttssacadtlkseggvctqlelarhhevaspvlLSGTTVS 377
Cdd:COG2217  274 ------------GDEV---------------------------------------------------------FAGTVNL 284
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   378 TGSGTALVVAVGRYSQVGQMfQKLAYDAE--PTPLQRklnaLAEDIgTFGLISAVVAFFVLLLEFWVMYFLQDPSkresa 455
Cdd:COG2217  285 DGSLTIRVTRVGADTTLARI-IRLVEEAQssKAPIQR----LADRV-ASYFVPVVLVIAALTFALWPLFGGGDWE----- 353
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   456 vdvvhdhvEFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQ 535
Cdd:COG2217  354 --------TALYRALAVLVIACPCALGLATPTAILVGIGRAARRGILIKGGEALERLAKVDTVVFDKTGTLTEGKPEVTD 425
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   536 FwdgektfcipssrgeqtpgadplstgaegedvgddmslHAQDASRRGYIPLsahstaassasphfaksscggAAVSEGL 615
Cdd:COG2217  426 V--------------------------------------VALDGDEDELLAL---------------------AAALEQH 446
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   616 AElqeknfkwEVLMQAIAlnstafleteevvvaqgtgeetrftqvkhvgsptecallafqdercggDYASTRRLYLGEDE 695
Cdd:COG2217  447 SE--------HPLAKAIV------------------------------------------------KAAAERGLPDVEDF 470
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   696 VELiaredfssdrkmmtsvvrilknsgdstgatspasPGLlRVFVKGAGERVLAqCSSVLVADQVIPLTPERKAevektv 775
Cdd:COG2217  471 EEI----------------------------------PGR-GVEAEVDGERVLV-GNARLLGEEGIDLPLLSER------ 508
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   776 VDAMAAEALRTICLAyrdIDPErepdwrercaaphqmfmkgetqltCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTG 855
Cdd:COG2217  509 IEALESEGKTVVFVA---VDGK------------------------LVGVIALADELRPDAKEAIAALKALGIKVVMLTG 561
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   856 DNIITAKAIAKRCEIfheesgglamlgpdftraiggvvcqtcqTEVCAcatdaktaeeqnkplrvdvvrdldafdkiwtr 935
Cdd:COG2217  562 DNRRTAEAIAKELGI----------------------------DEVRA-------------------------------- 581
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500   936 lEVLarsqPSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGlSGKEVAKQAADIVMLDDNFTCIVKAVKWGR 1015
Cdd:COG2217  582 -ELL----PEDKAEIVRELQAEGRKVAMVGDGINDAPALAAADVGIAMG-SGTDVAIEAADVVLMRDDLSAVPEAIDLSR 655
                        810       820
                 ....*....|....*....|....*
gi 8100500  1016 NVYDNIRRFLQFQLTVNVVAVALTV 1040
Cdd:COG2217  656 ATRRIIKQNLFWAFGYNAIAIPLAA 680
P-ATPase-V TIGR01657
P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade ...
213-1135 1.08e-32

P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined. This clade has been designated type V in.


Pssm-ID: 273738 [Multi-domain]  Cd Length: 1054  Bit Score: 137.88  E-value: 1.08e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     213 SVVKDDKKCTVVRSGHKEQISVFQLVVGDILHLEAGDE--VPADALVVQGRDLtVDESSLTGESDMIRKapfqqclneal 290
Cdd:TIGR01657  223 DMVHKPQSVIVIRNGKWVTIASDELVPGDIVSIPRPEEktMPCDSVLLSGSCI-VNESMLTGESVPVLK----------- 290
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     291 sretafssaldsaenLPAPGSSVDHRrrsrgsfgapssgaplQAQTCTTSSacadtlkseggvctqlelaRHhevaspVL 370
Cdd:TIGR01657  291 ---------------FPIPDNGDDDE----------------DLFLYETSK-------------------KH------VL 314
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     371 LSGTTV-----STGSGTALVVAV--GRYSQVGQMFQKLAYdaePTPLQRKLNalaEDIGTFGLISAVVAFFVLLleFWVM 443
Cdd:TIGR01657  315 FGGTKIlqirpYPGDTGCLAIVVrtGFSTSKGQLVRSILY---PKPRVFKFY---KDSFKFILFLAVLALIGFI--YTII 386
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     444 YFLQDP-SKRESAVDvvhdhveffvtAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDK 522
Cdd:TIGR01657  387 ELIKDGrPLGKIILR-----------SLDIITIVVPPALPAELSIGINNSLARLKKKGIFCTSPFRINFAGKIDVCCFDK 455
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     523 TGTLTKNQMtvtQFWdgektfcipssrgeqtpGADPLSTGAEgedvgddmslhaqdasrrgyiplsahstaassasphFA 602
Cdd:TIGR01657  456 TGTLTEDGL---DLR-----------------GVQGLSGNQE------------------------------------FL 479
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     603 KSSCggaavseglaelqeknfkwevlmQAIALNSTAFLEteevvvAQGTGEETRFTQVKHVGSPTECALLAFQD---ERC 679
Cdd:TIGR01657  480 KIVT-----------------------EDSSLKPSITHK------ALATCHSLTKLEGKLVGDPLDKKMFEATGwtlEED 530
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     680 GGDYASTRRL-----YLGEDEVELIAREDFSSDRKMMTSVVRILknsgdstGATSPASpgllrvFVKGAGERVLAQCSSV 754
Cdd:TIGR01657  531 DESAEPTSILavvrtDDPPQELSIIRRFQFSSALQRMSVIVSTN-------DERSPDA------FVKGAPETIQSLCSPE 597
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     755 LVadqvipltPERKAEVEKTvvdaMAAEALRTICLAYRDIdperepdwrercaaPHQMFMKG--------ETQLTCLGIA 826
Cdd:TIGR01657  598 TV--------PSDYQEVLKS----YTREGYRVLALAYKEL--------------PKLTLQKAqdlsrdavESNLTFLGFI 651
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     827 GIEDPVRDEVPGAVAQCQRAGIKVRMVTGDNIITAKAIAKRCEI-FHEESGGLAMLGPDftraiGGVVCQTCQTEVCACA 905
Cdd:TIGR01657  652 VFENPLKPDTKEVIKELKRASIRTVMITGDNPLTAVHVARECGIvNPSNTLILAEAEPP-----ESGKPNQIKFEVIDSI 726
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     906 TDAKTAEEQNKPLRVDVVRDL-----------DAF-----------DKIWTRLEVLARSQPSDKYALVTALKQKGRVVAV 963
Cdd:TIGR01657  727 PFASTQVEIPYPLGQDSVEDLlasryhlamsgKAFavlqahspellLRLLSHTTVFARMAPDQKETLVELLQKLDYTVGM 806
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500     964 TGDGTNDAPALKKADVGFAmgLSGKEvAKQAADIVMLDDNFTCIVKAVKWGRNVYDNirRFLQFQLTVNVVAVALTVVCT 1043
Cdd:TIGR01657  807 CGDGANDCGALKQADVGIS--LSEAE-ASVAAPFTSKLASISCVPNVIREGRCALVT--SFQMFKYMALYSLIQFYSVSI 881
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    1044 AVQREAPLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKPQGRdsyLISRSMLTSIVAASIYQLTVMIGLIFFGERFL 1123
Cdd:TIGR01657  882 LYLIGSNLGDGQFLTIDLLLIFPVALLMSRNKPLKKLSKERPPSN---LFSVYILTSVLIQFVLHILSQVYLVFELHAQP 958
                          970
                   ....*....|..
gi 8100500    1124 PETKWTFLSDED 1135
Cdd:TIGR01657  959 WYKPENPVDLEK 970
PRK15122 PRK15122
magnesium-transporting ATPase; Provisional
222-1110 1.27e-32

magnesium-transporting ATPase; Provisional


Pssm-ID: 237914 [Multi-domain]  Cd Length: 903  Bit Score: 137.46  E-value: 1.27e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    222 TVVRSGH------KEQISVFQLVVGDILHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRKapfqqclNEALSRETA 295
Cdd:PRK15122  151 TVLRRGHagaepvRREIPMRELVPGDIVHLSAGDMIPADVRLIESRDLFISQAVLTGEALPVEK-------YDTLGAVAG 223
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8100500    296 FSSAldsaenlpapgssvdhrrrsrgsfGAPSSGAPLqaqtcttssacadtlkseggvctqLELARhhevaspVLLSGT<