NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7304006|gb|AAF59048|]
View 

germ cell-less, isoform A [Drosophila melanogaster]

Protein Classification

germ cell-less family protein (domain architecture ID 13033696)

germ cell-less family protein similar to Drosophila melanogaster protein germ cell-less (GCL), a key regulator required for the specification of pole cells and primordial germ cell formation in embryos

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
BTB_POZ_GCL cd18305
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
51-165 1.82e-63

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; GCL proteins are nuclear envelope proteins highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in embryos. Both, human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 2 (GMCL2), also called germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L), may function in spermatogenesis. They may also be substrate-specific adaptors of E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. They contain BTB and BACK domains. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


:

Pssm-ID: 349614 [Multi-domain]  Cd Length: 115  Bit Score: 203.28  E-value: 1.82e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   51 TTQYIYKALFKEEKNSDVAVMALDKVWHLHKVYLSQSPYFYTMFNGTWREAQQNFIQITILDDRITVASLDAVFGSMYSD 130
Cdd:cd18305   1 TSKYIYQTLFLNGENSDITICALGREWKLHKIYLCQSGYFASMFSGSWKESKETVINLEIPDDNITVEALNVVFGSLYRD 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 7304006  131 EIEIESADVISVLATATLFHLDGIIDKCAEVMVDN 165
Cdd:cd18305  81 EIEIKPSRVVSILAAATLLQLDGLIQQCSEVMKET 115
BACK_GCL cd18495
BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less ...
166-245 7.63e-36

BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; The GCL protein is a nuclear envelope protein highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in Drosophila embryos. Both human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L) may function in spermatogenesis. They may also be substrate-specific adaptors of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.


:

Pssm-ID: 350570  Cd Length: 78  Bit Score: 128.52  E-value: 7.63e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006  166 ISPETAIQYYEAACQYGVVGVKKSTFQWFQINLLsiYSKQPNLLRHISIELMSALTASPDLYVMQTEFSLYTLLRTWMFL 245
Cdd:cd18495   1 ISAKTVCSYYEAACMYGLTEVKKKCLEWLLRNLM--TSQNVTLLRELSIELMEQLIASPNLFVMQVEMDVYTLLKKWLFL 78
 
Name Accession Description Interval E-value
BTB_POZ_GCL cd18305
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
51-165 1.82e-63

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; GCL proteins are nuclear envelope proteins highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in embryos. Both, human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 2 (GMCL2), also called germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L), may function in spermatogenesis. They may also be substrate-specific adaptors of E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. They contain BTB and BACK domains. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349614 [Multi-domain]  Cd Length: 115  Bit Score: 203.28  E-value: 1.82e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   51 TTQYIYKALFKEEKNSDVAVMALDKVWHLHKVYLSQSPYFYTMFNGTWREAQQNFIQITILDDRITVASLDAVFGSMYSD 130
Cdd:cd18305   1 TSKYIYQTLFLNGENSDITICALGREWKLHKIYLCQSGYFASMFSGSWKESKETVINLEIPDDNITVEALNVVFGSLYRD 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 7304006  131 EIEIESADVISVLATATLFHLDGIIDKCAEVMVDN 165
Cdd:cd18305  81 EIEIKPSRVVSILAAATLLQLDGLIQQCSEVMKET 115
BACK_GCL cd18495
BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less ...
166-245 7.63e-36

BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; The GCL protein is a nuclear envelope protein highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in Drosophila embryos. Both human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L) may function in spermatogenesis. They may also be substrate-specific adaptors of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.


Pssm-ID: 350570  Cd Length: 78  Bit Score: 128.52  E-value: 7.63e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006  166 ISPETAIQYYEAACQYGVVGVKKSTFQWFQINLLsiYSKQPNLLRHISIELMSALTASPDLYVMQTEFSLYTLLRTWMFL 245
Cdd:cd18495   1 ISAKTVCSYYEAACMYGLTEVKKKCLEWLLRNLM--TSQNVTLLRELSIELMEQLIASPNLFVMQVEMDVYTLLKKWLFL 78
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
56-165 5.59e-20

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerized PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


Pssm-ID: 334194 [Multi-domain]  Cd Length: 108  Bit Score: 85.01  E-value: 5.59e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006     56 YKALFKEEKNSDVAVMALDKVW-HLHKVYLS-QSPYFYTMFNGTwrEAQQNFIQITILDdrITVASLDAVFGSMYSDEIE 133
Cdd:pfam00651   1 LNELREQGKLCDVTLVVGDGKEfRAHKAVLAaCSPYFKALFSGQ--EEESSVSEIELDD--VSPEDFEALLEFMYTGELE 76
                          90       100       110
                  ....*....|....*....|....*....|..
gi 7304006    134 IESADVISVLATATLFHLDGIIDKCAEVMVDN 165
Cdd:pfam00651  77 ISEENVDDLLAAADKLQIPSLVDKCEEFLIQS 108
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
67-166 4.33e-14

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585 [Multi-domain]  Cd Length: 97  Bit Score: 68.10  E-value: 4.33e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006      67 DVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIqitILDDRiTVASLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:smart00225   1 DVTLVVGGKKFHAHKAVLAAhSPYFKALFSSDFKESDKSEI---YLDDV-SPEDFRALLNFLYTGKLDLPEENVEELLEL 76
                           90       100
                   ....*....|....*....|.
gi 7304006     146 ATLFHLDGIIDKCAEVMVDNI 166
Cdd:smart00225  77 ADYLQIPGLVELCEEFLLKLL 97
PHA03098 PHA03098
kelch-like protein; Provisional
57-242 4.92e-07

kelch-like protein; Provisional


Pssm-ID: 222983 [Multi-domain]  Cd Length: 534  Bit Score: 52.46  E-value: 4.92e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006    57 KALFKEEKNSDVAV--MALDKVWHLHKVYLSQSP-YFYTMFNGtwreaqqNFIQ--ITILDDritVASLDAVFGSMYSDE 131
Cdd:PHA03098   1 MYSFELQKFCDESIiiVNGGGIIKVHKIILSSSSeYFKKMFKN-------NFKEneINLNID---YDSFNEVIKYIYTGK 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   132 IEIESADVISVLATATLFHLDGIIDKCAEVMVDNISPETAIQYYEAACQYGVVGVKKSTFQWFQINLLSIYsKQPNLLrH 211
Cdd:PHA03098  71 INITSNNVKDILSIANYLIIDFLINLCINYIIKIIDDNNCIDIYRFSFFYGCKKLYSAAYNYIRNNIELIY-NDPDFI-Y 148
                        170       180       190
                 ....*....|....*....|....*....|.
gi 7304006   212 ISIELMSALTASPDLYVMQTEFSLYTLLrTW 242
Cdd:PHA03098 149 LSKNELIKILSDDKLNVSSEDVVLEIII-KW 178
 
Name Accession Description Interval E-value
BTB_POZ_GCL cd18305
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
51-165 1.82e-63

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; GCL proteins are nuclear envelope proteins highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in embryos. Both, human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 2 (GMCL2), also called germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L), may function in spermatogenesis. They may also be substrate-specific adaptors of E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. They contain BTB and BACK domains. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349614 [Multi-domain]  Cd Length: 115  Bit Score: 203.28  E-value: 1.82e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   51 TTQYIYKALFKEEKNSDVAVMALDKVWHLHKVYLSQSPYFYTMFNGTWREAQQNFIQITILDDRITVASLDAVFGSMYSD 130
Cdd:cd18305   1 TSKYIYQTLFLNGENSDITICALGREWKLHKIYLCQSGYFASMFSGSWKESKETVINLEIPDDNITVEALNVVFGSLYRD 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 7304006  131 EIEIESADVISVLATATLFHLDGIIDKCAEVMVDN 165
Cdd:cd18305  81 EIEIKPSRVVSILAAATLLQLDGLIQQCSEVMKET 115
BACK_GCL cd18495
BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less ...
166-245 7.63e-36

BACK (BTB and C-terminal Kelch) domain found in Drosophila melanogaster protein germ cell-less (GCL) and similar proteins; The GCL protein is a nuclear envelope protein highly conserved between the mammalian and Drosophila orthologs. Drosophila melanogaster GCL is a key regulator required for the specification of pole cells and primordial germ cell formation in Drosophila embryos. Both human germ cell-less protein-like 1 (GMCL1) and germ cell-less protein-like 1-like (GMCL1P1 or GMCL1L) may function in spermatogenesis. They may also be substrate-specific adaptors of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.


Pssm-ID: 350570  Cd Length: 78  Bit Score: 128.52  E-value: 7.63e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006  166 ISPETAIQYYEAACQYGVVGVKKSTFQWFQINLLsiYSKQPNLLRHISIELMSALTASPDLYVMQTEFSLYTLLRTWMFL 245
Cdd:cd18495   1 ISAKTVCSYYEAACMYGLTEVKKKCLEWLLRNLM--TSQNVTLLRELSIELMEQLIASPNLFVMQVEMDVYTLLKKWLFL 78
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
56-165 5.59e-20

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerized PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


Pssm-ID: 334194 [Multi-domain]  Cd Length: 108  Bit Score: 85.01  E-value: 5.59e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006     56 YKALFKEEKNSDVAVMALDKVW-HLHKVYLS-QSPYFYTMFNGTwrEAQQNFIQITILDdrITVASLDAVFGSMYSDEIE 133
Cdd:pfam00651   1 LNELREQGKLCDVTLVVGDGKEfRAHKAVLAaCSPYFKALFSGQ--EEESSVSEIELDD--VSPEDFEALLEFMYTGELE 76
                          90       100       110
                  ....*....|....*....|....*....|..
gi 7304006    134 IESADVISVLATATLFHLDGIIDKCAEVMVDN 165
Cdd:pfam00651  77 ISEENVDDLLAAADKLQIPSLVDKCEEFLIQS 108
BTB_POZ_BTBD16 cd18291
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
54-174 4.66e-16

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 16 (BTBD16); BTBD16 is a BTB domain-containing protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349600  Cd Length: 114  Bit Score: 74.02  E-value: 4.66e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   54 YIYKALFKEEKNSDVAVMALDKVWHLHKVYLSQSPYFYTMFNGTwreaqqnFIQITILDDRITVASLDAVFGSMYSDEIE 133
Cdd:cd18291   1 YYHSQKVARSACPDVVLECLGSFWELHSPYLCKSETLAELLKPV-------TISLNINDPLVTKEAFAVALGNLYNSEVE 73
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 7304006  134 IESADVISVLATATLFHLDGIIDKCAEVMVDNISPETAIQY 174
Cdd:cd18291  74 VNVEDAVGVLAAAALLRFPTLFQKCVKVMISSISSSTVCKF 114
BTB_POZ_ZBTB_KLHL-like cd18186
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-149 2.21e-14

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing (ZBTB) proteins, Kelch-like (KLHL) proteins, and similar proteins; This family includes a variety of BTB/POZ domain-containing proteins, such as zinc finger and BTB domain-containing (ZBTB) proteins and Kelch-like (KLHL) proteins. They have diverse functions, such as transcriptional regulation, chromatin remodeling, protein degradation and cytoskeletal regulation. Many BTB/POZ proteins contain one or two additional domains, such as kelch repeats, zinc-finger domains, FYVE (Fab1, YOTB, Vac1, and EEA1) fingers, or ankyrin repeats. These special additional domains or interaction partners provide unique characteristics and functions to BTB/POZ proteins. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349497 [Multi-domain]  Cd Length: 82  Bit Score: 68.35  E-value: 2.21e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALDKVWHLHKVYLS-QSPYFYTMFNGTWREAQQNFIQITIlddrITVASLDAVFGSMYSDEIEIESADVISVLA 144
Cdd:cd18186   2 CDVTLVVGGREFPAHRAVLAaRSPYFRAMFSSGMKESSSSEIELDD----VSPEAFEALLDYIYTGELELSEENVEELLA 77

                ....*
gi 7304006  145 TATLF 149
Cdd:cd18186  78 AADKL 82
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
67-166 4.33e-14

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585 [Multi-domain]  Cd Length: 97  Bit Score: 68.10  E-value: 4.33e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006      67 DVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIqitILDDRiTVASLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:smart00225   1 DVTLVVGGKKFHAHKAVLAAhSPYFKALFSSDFKESDKSEI---YLDDV-SPEDFRALLNFLYTGKLDLPEENVEELLEL 76
                           90       100
                   ....*....|....*....|.
gi 7304006     146 ATLFHLDGIIDKCAEVMVDNI 166
Cdd:smart00225  77 ADYLQIPGLVELCEEFLLKLL 97
BACK_BTBD16 cd18492
BACK (BTB and C-terminal Kelch) domain found in BTB/POZ domain-containing protein 16 (BTBD16); ...
166-249 4.33e-12

BACK (BTB and C-terminal Kelch) domain found in BTB/POZ domain-containing protein 16 (BTBD16); BTBD16 is a BTB-domain-containing Kelch-like protein. Its function remains unclear. BTBD16 SNPs may be bipolar disorder (BD) genetic susceptibility variants exhibiting genetic background-dependent effects.


Pssm-ID: 350567  Cd Length: 97  Bit Score: 62.31  E-value: 4.33e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006  166 ISPETAIQYYEAACQYGVVGVKKSTFQWFQINLLSIYSKQPNlLRHISIELMSALTASPDLYVMqTEFSLYTLLRTWMFL 245
Cdd:cd18492   1 IKSSTVCKFHRAACKYKQESLATACERWLELNLVPQLSSQIY-LRDLPLELLHKILKSPRLFTF-NEYSLYKTLCYWVFL 78

                ....
gi 7304006  246 RLHP 249
Cdd:cd18492  79 QLNP 82
BTB_POZ_KLHL8 cd18238
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-172 4.44e-11

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 8 (KLHL8); KLHL8 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex required for the ubiquitination and degradation of rapsyn, a postsynaptic protein required for clustering of nicotinic acetylcholine receptors (nAChRs) at the neuromuscular junction. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349547 [Multi-domain]  Cd Length: 120  Bit Score: 60.00  E-value: 4.44e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREAQQNFIQITILDdritVASLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18238  17 DVTLKVGEKSIHCHRLVLaCVSPYFRAMFTSEMAESKQDSITIKDID----EEAVELLVDFAYTGKLTLTVDNVQSLLYA 92
                        90       100
                ....*....|....*....|....*..
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISPETAI 172
Cdd:cd18238  93 ASLLQVEEVAKACCEFMKDHLHPSNCL 119
BTB_POZ_KLHL2-like cd18235
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-168 2.35e-10

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins, KLHL2 and KLHL3; The family includes Kelch-like proteins, KLHL2 and KLHL3. KLHL2 is a novel actin-binding protein predominantly expressed in brain. It plays a role in the reorganization of the actin cytoskeleton, and promotes growth of cell projections in oligodendrocyte precursors. KLHL2 and KLHL3 each functions as a component of an E3 ubiquitin ligase complex that mediates the ubiquitination of target proteins. They contain a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349544 [Multi-domain]  Cd Length: 121  Bit Score: 58.21  E-value: 2.35e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREAQQNFIQITILDDRITVASLDAVfgsmYSDEIEIESADVISVLAT 145
Cdd:cd18235  23 DVILVADGVEIPAHRVVLaSCSPYFHAMFTGDLSESRANRVTLQDVDGKALLLLIDYV----YTAEIQVTEENVQVLLPA 98
                        90       100
                ....*....|....*....|...
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18235  99 ANLLQLTDVRDACCDFLQSQLHP 121
BTB_POZ_KBTBD8 cd18274
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
57-172 4.47e-10

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 8 (KBTBD8); KBTBD8, also called T-cell activation kelch repeat protein (TA-KRP), is a BTB-kelch family protein that is located in the Golgi apparatus and translocates to the spindle apparatus during mitosis. It acts as a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a regulator of neural crest specification. The BCR(KBTBD8) complex monoubiquitylates NOLC1 and its paralog TCOF1, the mutation of which underlies the neurocristopathy Treacher Collins syndrome. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349583 [Multi-domain]  Cd Length: 129  Bit Score: 57.69  E-value: 4.47e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   57 KALFKEEKNSDVAV-MALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITilddRITVASLDAVFGSMYSDEIEI 134
Cdd:cd18274  14 KAMYDEGQLTDIVVeVDHGKTFSCHRNVLAAiSPYFRSMFTSGLTESTQKEVRIV----GVEAESMHLVLDYAYTSRVTL 89
                        90       100       110
                ....*....|....*....|....*....|....*...
gi 7304006  135 ESADVISVLATATLFHLDGIIDKCAEVMVDNISPETAI 172
Cdd:cd18274  90 TEANVQALFTAASIFQIPSLQDQCAQFMISRLDPQNSI 127
BTB_POZ_KLHL10 cd18240
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
55-169 1.61e-09

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 10 (KLHL10); KLHL10 is a substrate-specific adaptor of a CUL3-based E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins specifically in the testis during spermatogenesis. Haploinsufficiency of Klhl10 causes infertility in male mice. KLHL10 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349549 [Multi-domain]  Cd Length: 120  Bit Score: 55.80  E-value: 1.61e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   55 IYKALFKEEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRItvasLDAVFGSMYSDEIE 133
Cdd:cd18240   7 VFNELRLEGKLCDVVIRVNGVEFPAHRNILCAcSPYFRALFTNGWNETEKKVYKIPGVSPEM----MELIIEYAYTRTVP 82
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 7304006  134 IESADVISVLATATLFHLDGIIDKCAEVMVDNISPE 169
Cdd:cd18240  83 ITAENVEELLPAADQFNIMGIVKACCDFLEDQLCPE 118
BTB2_POZ_BTBD8 cd18286
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
59-156 5.12e-09

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 8 (BTBD8); BTBD8 is a BTB-domain-containing Kelch-like protein that may play a role in developmental processes. It may also act as a protein-protein adaptor in a transcription complex and thus be involved in brain development. BTBD8 contains two BTB domains. This model corresponds to the second domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349595 [Multi-domain]  Cd Length: 121  Bit Score: 54.19  E-value: 5.12e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   59 LFKEEKNSDVAVMALDKVWHLHKVYLS-QSPYFYTMFNGTWREAQQNFIQITilddRITVASLDAVFGSMYSDEIEI-ES 136
Cdd:cd18286  11 LFLNGEDSDITIKVDGKTFKAHRCILCaRSSYFAAMLSGSWAESNSSEITLT----GVSHAAVSFVLLFIYGGVLDLpDD 86
                        90       100
                ....*....|....*....|
gi 7304006  137 ADVISVLATATLFHLDGIID 156
Cdd:cd18286  87 VNLGELLSLADMYGLDGLKD 106
BTB_POZ_KLHL26 cd18255
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-170 7.22e-09

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 26 (KLHL26); KLHL26 is encoded by the klhl26 gene, which is regulated by p53 via fuzzy tandem repeats. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349564 [Multi-domain]  Cd Length: 121  Bit Score: 53.94  E-value: 7.22e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREAQQNFIQItildDRITVASLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18255  20 DVTLIADGQRFQAHKVVLaSCSDYFRAMFTGGMRESSQDEIEL----KGVSAKGLKHILDFAYTSELTLDLDCIQDVLGA 95
                        90       100
                ....*....|....*....|....*
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISPET 170
Cdd:cd18255  96 AVHLQMLPVVELCEEFLKSAMSVEN 120
BTB_POZ_KLHL35 cd18265
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-168 2.95e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 35 (KLHL35); KLHL35 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. Significant differences in DNA methylation of the KLHL35 gene in abdominal aortic aneurysm (AAA) patients compared to non-AAA controls suggest a potential role in AAA pathology. Hypermethylation of the KLHL35 gene has also been associated with the development of hepatocellular carcinoma. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349574 [Multi-domain]  Cd Length: 128  Bit Score: 52.08  E-value: 2.95e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITilddRITVASLDAVFGSMYSDEIEIESADVISVLA 144
Cdd:cd18265  24 TDVVLLVDGKDFPCHRATLSAnSAYFRAMFGGHLKESRQAVVEIQ----KVSAAAMEVLLDYMYGGGLRIQEDNVESVLE 99
                        90       100
                ....*....|....*....|....
gi 7304006  145 TATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18265 100 ASDLLQVSKLREACVRFLEGQLHP 123
BTB_POZ_KBTBD12 cd18276
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-168 4.27e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 12 (KBTBD12); KBTBD12, also called Kelch domain-containing protein 6 (KLHDC6), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349585 [Multi-domain]  Cd Length: 127  Bit Score: 51.73  E-value: 4.27e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQitiLDDrITVASLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18276  23 DVVLVAEGEKFPCHRLVLAAfSPYFKAMFTCGLMECSQREVV---LHD-ITAESVSIILNYMYSSDLHLTNSNVQGVATA 98
                        90       100
                ....*....|....*....|...
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18276  99 AFFLQMEDIFSVCQKYMMDHMDA 121
BTB_POZ_KLHL18 cd18247
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-164 5.49e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 18 (KLHL18); KLHL18 acts as a substrate-specific adaptor for a Cullin3 E3 ubiquitin-protein ligase complex that regulates mitotic entry and ubiquitylates Aurora-A. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349556 [Multi-domain]  Cd Length: 116  Bit Score: 51.13  E-value: 5.49e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLSQS-PYFYTMFNGTWREAQQNfiQITILDdrITVASLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18247  21 DVTLKVGDQKFSAHRIVLAATiPYFHAMFTHDMVESKQD--EITMQG--IEPSALEALINFAYSGRIAIDTSNVQSLLVG 96
                        90
                ....*....|....*....
gi 7304006  146 ATLFHLDGIIDKCAEVMVD 164
Cdd:cd18247  97 ASFLQLQSVKDACCEFLKE 115
BTB_POZ_KLHL2_Mayven cd18338
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-168 5.88e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 2 (KLHL2); KLHL2, also called actin-binding protein Mayven, is a novel actin-binding protein predominantly expressed in the brain. It plays a role in the reorganization of the actin cytoskeleton, and promotes growth of cell projections in oligodendrocyte precursors. KLHL2 is a component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, such as NPTXR, leading most often to their proteasomal degradation. It contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349647 [Multi-domain]  Cd Length: 121  Bit Score: 51.23  E-value: 5.88e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRITVASLDAVfgsmYSDEIEIESADVISVLAT 145
Cdd:cd18338  23 DVTIVAEDVEIAAHRVVLAAcSPYFHAMFTGEMSESRAKRVRIKEVDGWTLKMLIDYV----YTAEIQVTEENVQVLLPA 98
                        90       100
                ....*....|....*....|...
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18338  99 AGLLQLQDVKKTCCEFLESQLHP 121
BTB_POZ_KLHL17_actinfilin cd18246
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-168 1.65e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 17 (KLHL17); KLHL17, also called actinfilin, is a substrate-recognition component of some cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes. It acts as a Cullin 3 (Cul3) substrate adaptor that links GLUR6 to the E3 ubiquitin-ligase complex, and mediates the ubiquitination and subsequent degradation of GLUR6. It may play a role in actin-based neuronal function. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349555 [Multi-domain]  Cd Length: 139  Bit Score: 50.41  E-value: 1.65e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREAQQNFIQITILDDRitvaSLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18246  41 DIVLHVGTKEIKAHKVVLaSCSPYFHAMFTNEMSESRQTHVTLHDIDPQ----ALEQLVQYAYTAEIVVGEGNVQTLLPA 116
                        90       100
                ....*....|....*....|...
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18246 117 ASLLQLNGVRDACCKFLLSQLDP 139
BTB_POZ_RCBTB1_2 cd18298
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
57-149 1.70e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in RCC1 and BTB domain-containing proteins, RCBTB1 and RCBTB2; The RCC1-related guanine nucleotide exchange factor (GEF) family includes RCC1 and BTB domain-containing proteins, RCBTB1 and RCBTB2, both of which are chromosome condensation regulator-like guanine nucleotide exchange factors. They contain an RCC1 repeat, a BTB domain, and a BACK domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349607 [Multi-domain]  Cd Length: 108  Bit Score: 49.56  E-value: 1.70e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   57 KALFKEEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQItildDRITVASLDAVFGSMYSDEIEIE 135
Cdd:cd18298   4 RKAFNDPRTSDLKFRVDGKYIYVHKAILKIrCEYFRSMFQSHWNEDDKNVIEI----DQYSYPVYYAFLRYLYTDQVDLP 79
                        90
                ....*....|....
gi 7304006  136 SADVISVLATATLF 149
Cdd:cd18298  80 PEDAIGLLDLANSY 93
BTB_POZ_KLHL3 cd18339
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-168 1.98e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 3 (KLHL3); KLHL3 is a component of an E3 ubiquitin ligase complex that regulates blood pressure by targeting With-No-Lysine (WNK) kinases for degradation. It contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349648 [Multi-domain]  Cd Length: 121  Bit Score: 49.72  E-value: 1.98e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRitvaSLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18339  23 DVTIVAEDVEIEAHRVVLAAcSPYFCAMFTGDMSESKAKKIEIKDVDGQ----TLSKLIDYIYTAEIEVTEENVQVLLPA 98
                        90       100
                ....*....|....*....|...
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18339  99 ASLLQLMDVRQNCCDFLQSQLHP 121
BTB_POZ_KLHL1-like cd18234
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-168 2.11e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins KLHL1, KLHL4 and KLHL5; This family contains the Kelch-like proteins: KLHL1, KLHL4 and KLHL5, all of which share high identity and similarity with the Drosophila kelch protein, a component of ring canals. KLHL1 is a neuronal actin-binding protein that modulates voltage-gated CaV2.1 (P/Q-type) and CaV3.2 (alpha1H T-type) calcium channels. Family members contain a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349543 [Multi-domain]  Cd Length: 105  Bit Score: 49.29  E-value: 2.11e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRitvaSLDAVFGSMYSDEIEIESADVISVLA 144
Cdd:cd18234   2 CDVILIAGDRRIPAHRLVLSAvSDYFAAMFTNDVREATEEEIKLKDVDPD----ALWTLVQYCYTGRLELKEDNVESLLA 77
                        90       100
                ....*....|....*....|....
gi 7304006  145 TATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18234  78 TACLLQLSEVVEACCGFLMKQLHP 101
BTB_POZ_KLHL27_IPP cd18256
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-172 2.32e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in intracisternal A particle-promoted polypeptide (IPP); IPP, also called Kelch-like protein 27 (KLHL27) or actin-binding protein IPP, is an actin-binding protein that may play a role in organizing the actin cytoskeleton. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349565 [Multi-domain]  Cd Length: 125  Bit Score: 49.71  E-value: 2.32e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRITVASLDAVfgsmYSDEIEIESADVISVLAT 145
Cdd:cd18256  22 DVQLQVGMELFSVHRLVLAAsSPYFAALFAGGMSESSKDVVQIHGVEPDIFHILLDFI----YTGVVEVTVSNVQELLVA 97
                        90       100
                ....*....|....*....|....*..
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISPETAI 172
Cdd:cd18256  98 ADMLQLTEVVEICCEFLKGQLHPSNCI 124
BTB_POZ_KLHL28_BTBD5 cd18257
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-168 2.33e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 28 (KLHL28); KLHL28, also called BTB/POZ domain-containing protein 5 (BTBD5), contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349566 [Multi-domain]  Cd Length: 118  Bit Score: 49.46  E-value: 2.33e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDritvASLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18257  20 DVVLRVGDVKIHAHKVVLAScSPYFKAMFTGNLSEKENSEVEFQCIDE----TALQAIVEYAYTGTVFISQATVESLLPA 95
                        90       100
                ....*....|....*....|...
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18257  96 ANLLQIKLVLKECCDFLESQLDP 118
BTB_POZ_KLHL7 cd18237
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
46-169 3.85e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 7 (KLHL7); KLHL7 is a component of a Cul3-based E3 ubiquitin ligase complex and is involved in the ubiquitination of target proteins for proteasome-mediated degradation. Mutations in KLHL7 causes autosomal-dominant retinitis pigmentosa. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349546 [Multi-domain]  Cd Length: 126  Bit Score: 49.02  E-value: 3.85e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   46 KKLLTTTQYIYKALFKEEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQitiLDDrITVASLDAVF 124
Cdd:cd18237   2 AKLLADFMGVMNNMRKQKTLCDVILIVEGREIKAHRVVLAAaSHFFHLMFTSNMTESKSSEVE---LKD-AEPDIIELLV 77
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*
gi 7304006  125 GSMYSDEIEIESADVISVLATATLFHLDGIIDKCAEVMVDNISPE 169
Cdd:cd18237  78 EFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQLDAS 122
PHA03098 PHA03098
kelch-like protein; Provisional
57-242 4.92e-07

kelch-like protein; Provisional


Pssm-ID: 222983 [Multi-domain]  Cd Length: 534  Bit Score: 52.46  E-value: 4.92e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006    57 KALFKEEKNSDVAV--MALDKVWHLHKVYLSQSP-YFYTMFNGtwreaqqNFIQ--ITILDDritVASLDAVFGSMYSDE 131
Cdd:PHA03098   1 MYSFELQKFCDESIiiVNGGGIIKVHKIILSSSSeYFKKMFKN-------NFKEneINLNID---YDSFNEVIKYIYTGK 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   132 IEIESADVISVLATATLFHLDGIIDKCAEVMVDNISPETAIQYYEAACQYGVVGVKKSTFQWFQINLLSIYsKQPNLLrH 211
Cdd:PHA03098  71 INITSNNVKDILSIANYLIIDFLINLCINYIIKIIDDNNCIDIYRFSFFYGCKKLYSAAYNYIRNNIELIY-NDPDFI-Y 148
                        170       180       190
                 ....*....|....*....|....*....|.
gi 7304006   212 ISIELMSALTASPDLYVMQTEFSLYTLLrTW 242
Cdd:PHA03098 149 LSKNELIKILSDDKLNVSSEDVVLEIII-KW 178
BTB_POZ_KLHL20_KLEIP cd18249
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-168 7.72e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 20 (KLHL20); KLHL20, also called Kelch-like ECT2-interacting protein (KLEIP) or Kelch-like protein X, is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex involved in interferon response and anterograde Golgi to endosome transport. KLHL20 plays a role in actin assembly at cell-cell contact sites of Madin-Darby canine kidney cells. It also controls endothelial migration and sprouting angiogenesis. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349558 [Multi-domain]  Cd Length: 128  Bit Score: 48.22  E-value: 7.72e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRitvaSLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18249  25 DVVLVVGAKKIYAHRVILSAcSPYFRAMFTGELAESRQTEVTIRDIDER----AMELLIDFAYTSQITVEEGNVQTLLPA 100
                        90       100
                ....*....|....*....|...
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18249 101 ACLLQLAEIQEVCCEFLKRQLDP 123
BTB_POZ_KLHL4 cd18336
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
60-172 1.07e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 4 (KLHL4); KLHL4 shares high identity and similarity with the Drosophila kelch protein, a component of ring canals. It may be associated with X-linked cleft palate (CPX) and is also a candidate gene in the impairment of mullerian duct development. In addition, it has been identified as a target of insulin-like growth factor binding protein 5 (IGFBP5). KLHL4 contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349645 [Multi-domain]  Cd Length: 126  Bit Score: 47.73  E-value: 1.07e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   60 FKEEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRitvaSLDAVFGSMYSDEIEIESAD 138
Cdd:cd18336  14 LQHKQLCDVLLIAGNLKIPAHRLVLSAvSDYFAAMFTNDVREAKQEEIKMEGVDPD----ALKALVHYAYTGVLELKEDT 89
                        90       100       110
                ....*....|....*....|....*....|....
gi 7304006  139 VISVLATATLFHLDGIIDKCAEVMVDNISPETAI 172
Cdd:cd18336  90 IESLLAAACLLQLSQVIDVCCNFLMKQLHPSNCL 123
BTB_POZ_KLHL38 cd18268
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-169 1.07e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 38 (KLHL38); KLHL38 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. The KLHL38 gene is significantly up-regulated during diapause, a temporary arrest of development during early ontogeny. It may also function in preadipocyte differentiation in the chicken. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349577 [Multi-domain]  Cd Length: 129  Bit Score: 47.86  E-value: 1.07e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALDKVWHLHK-VYLSQSPYFYTMFNGTWREAQQNFIQITILDdritVASLDAVFGSMYSDEIEIESADVISVLA 144
Cdd:cd18268  24 TDVILCTGDKEIPCHRnVLASSSPYFRAMFCNNFRESSQAKVDLKGID----SDVLDQIVDYVYTGEILITRDNVLPLME 99
                        90       100
                ....*....|....*....|....*
gi 7304006  145 TATLFHLDGIIDKCAEVMVDNISPE 169
Cdd:cd18268 100 AASMLQYPKLFEACSLYLQDQLTPE 124
BTB_POZ_KLHL19_KEAP1 cd18248
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
68-166 1.08e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like ECH-associated protein 1 (KEAP1); KEAP1, also called cytosolic inhibitor of Nrf2 (INrf2) or Kelch-like protein 19 (KLHL19), is a redox-regulated substrate adaptor protein for a Cullin3-dependent ubiquitin ligase complex that targets NFE2L2/NRF2 for ubiquitination and degradation by the proteasome, thus resulting in the suppression of its transcriptional activity and the repression of antioxidant response element-mediated detoxifying enzyme gene expression. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349557 [Multi-domain]  Cd Length: 124  Bit Score: 47.76  E-value: 1.08e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   68 VAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREaqQNFIQITILDDRITVASLDAVFgsMYSDEIEIESADVISVLATA 146
Cdd:cd18248  28 VKYQDPKEEFMAHKVVLaSSSPYFKAMFTSGLRE--CGMEVVPIEGVHPCVMSRLIEF--AYTASISVGEKCVLHVLPGA 103
                        90       100
                ....*....|....*....|
gi 7304006  147 TLFHLDGIIDKCAEVMVDNI 166
Cdd:cd18248 104 VMYQMDSVVKACCDFLEQQL 123
BTB_POZ_KLHL23 cd18252
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
76-163 2.56e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 23 (KLHL23); KLHL23 overexpression is associated with increased cell proliferation and invasion in gastric cancer. Downregulation of KLHL23 is associated with invasion, metastasis, and poor prognosis of hepatocellular carcinoma and pancreatic cancer. KLHL23 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349561 [Multi-domain]  Cd Length: 127  Bit Score: 46.74  E-value: 2.56e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   76 VWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRItvasLDAVFGSMYSDEIEIESADVISVLATATLFHLDGI 154
Cdd:cd18252  33 IFHCHKAALAAcSSYFKVMFTADMKEKSNNVIKLSGIDHDI----LEALVNYVYTSQICITERNVQSLLEAADLLQFISV 108

                ....*....
gi 7304006  155 IDKCAEVMV 163
Cdd:cd18252 109 KKACEQFLV 117
BTB_POZ_KLHL15 cd18244
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
56-162 2.69e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 15 (KLHL15); KLHL15 is a substrate-specific adaptor for the Cullin3 E3 ubiquitin-protein ligase complex that targets the serine/threonine-protein phosphatase 2A (PP2A) subunit PPP2R5B for ubiquitination and subsequent proteasomal degradation, thus promoting exchange with other regulatory subunits. It also plays a key role in DNA damage response, favoring DNA double-strand repair through error-prone non-homologous end joining (NHEJ) over error-free, RBBP8-mediated homologous recombination (HR), by targeting the DNA-end resection factor RBBP8/CtIP for ubiquitination and subsequent proteasomal degradation. KLHL15 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349553 [Multi-domain]  Cd Length: 137  Bit Score: 46.87  E-value: 2.69e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   56 YKALFKEEKNSDVAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREAQQNFIQITILddriTVASLDAVFGSMYSDEIEI 134
Cdd:cd18244  21 FRALYEEGLLLDVTLVIEDHQFQAHKALLaTQSDYFRIMFTADMRERDQDKIHLKGL----TATGFSHVLQFMYYGTIEL 96
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 7304006  135 ESADVISVLATATLFHLDGII-------------DKCAEVM 162
Cdd:cd18244  97 SMLTVHEILQAAMYVQLTEVVkfccsfllakiclDNCAEIM 137
BTB_POZ_KLHL37_ENC1 cd18267
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-168 3.67e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ectoderm-neural cortex protein 1 (ENC-1); ENC-1 is also called Kelch-like protein 37 (KLHL37), nuclear matrix protein NRP/B, or p53-induced gene 10 protein. It is an actin-binding nuclear matrix protein that associates with p110(RB), and is involved in the regulation of neuronal process formation and in differentiation of neural crest cells. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349576 [Multi-domain]  Cd Length: 147  Bit Score: 46.91  E-value: 3.67e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQitiLDDRITVASLDAVFGSMYSDEIEIESADVISVLA 144
Cdd:cd18267  41 TDVLLHAGNRSFPCHRAVLAAcSRYFEAMFSGGLKESQDSEVN---FHDSIHPEVLELLLDYAYSSRVIINEENAESLLE 117
                        90       100
                ....*....|....*....|....
gi 7304006  145 TATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18267 118 AGDMLEFQDIRDACAEFLEKNLHP 141
BTB_POZ_KLHL24_KRIP6 cd18253
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-168 4.37e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 24 (KLHL24); KLHL24, also called kainate receptor-interacting protein for GluR6 (KRIP6) or protein DRE1, is necessary to maintain the balance between intermediate filament stability and degradation, a process that is essential for skin integrity. KLHL24 is a component of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that mediates ubiquitination of KRT14 and controls its levels during keratinocyte differentiation. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349562 [Multi-domain]  Cd Length: 121  Bit Score: 45.98  E-value: 4.37e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQItildDRITVASLDAVFGSMYSDEIEIESADVISVLA 144
Cdd:cd18253  19 TDVIICVEGREFPCHRAILSAcSSYFRAMFCNDHRESREMLVEI----NGILAEAMDCFLQYVYTGKVKITTENVQYLFE 94
                        90       100
                ....*....|....*....|....
gi 7304006  145 TATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18253  95 TSSLFQISPLRDACAKFLEEQLDP 118
BTB_POZ_ZBTB46 cd18230
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-158 5.48e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 46 (ZBTB46); ZBTB46 is also called BTB-ZF protein expressed in effector lymphocytes (BZEL), BTB/POZ domain-containing protein 4 (BTBD4), or zinc finger protein 340 (ZNF340). It is a conventional dendritic cell (cDC) lineage specific transcription factor that acts as a negative regulator required to prevent activation of classical dendritic cells in the steady state. It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349539 [Multi-domain]  Cd Length: 125  Bit Score: 45.82  E-value: 5.48e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHK-VYLSQSPYFYTMFNGTWREAQQNfiQITILDdRITVASLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18230  23 DVCIIVEGKIFKAHKnVLLGSSRYFKTLYCQVQKTSDQA--TVTHLD-IVTAQGFKAIIDFMYSAHLALTSKNVIEVMSA 99
                        90
                ....*....|...
gi 7304006  146 ATLFHLDGIIDKC 158
Cdd:cd18230 100 ASYLQMTDIVQAC 112
BTB_POZ_KLHL36 cd18266
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-178 6.75e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 36 (KLHL36); KLHL36 may act as a substrate-specific adaptor of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349575 [Multi-domain]  Cd Length: 135  Bit Score: 45.65  E-value: 6.75e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLS-QSPYFYTMFNGTWREAQQNFIQITilddRITVASLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18266  27 DVVLVADEQRVPAHRNLLAvCSDYFNSMFTIGMREAHQKEVELV----GASYIGLKAVIDFLYSSELPLDGGNIDYVLET 102
                        90       100       110
                ....*....|....*....|....*....|...
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISPETAIQYYEAA 178
Cdd:cd18266 103 AHLLQIWKVVDFCCEYLENEVSEENYLYLQELA 135
BTB_POZ_KLHL12_C3IP1_DKIR cd18242
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
46-168 1.27e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 12 (KLHL12); KLHL12, also called CUL3-interacting protein 1 (C3IP1) or DKIR homolog, is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a negative regulator of the Wnt signaling pathway and ER-Golgi transport. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349551 [Multi-domain]  Cd Length: 124  Bit Score: 44.74  E-value: 1.27e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   46 KKLLTTTQyiykALFKEEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRITVASLDAVf 124
Cdd:cd18242   6 KSILNTMN----SLRKSNTLCDVTLRVEGKEFPAHRIVLAAcSDYFCAMFTSEMSEKGKSEVELQGLTASTMEILLDFV- 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....
gi 7304006  125 gsmYSDEIEIESADVISVLATATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18242  81 ---YTETVHVTVENVQELLPAACLLQLKGVKQACCEFLESQLDP 121
BTB_POZ_RCBTB1_CLLD7 cd18353
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
49-162 2.10e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in RCC1 and BTB domain-containing protein 1 (RCBTB1); RCBTB1 is also called chronic lymphocytic leukemia deletion region gene 7 protein (CLLD7), CLL deletion region gene 7 protein, regulator of chromosome condensation and BTB domain-containing protein 1, or E4.5. It is a novel chromosome condensation regulator-like guanine nucleotide exchange factor that may be involved in cell cycle regulation by chromatin remodeling. It may also function as a tumor suppressor that regulates pathways of DNA damage/repair and apoptosis. RCBTB1 may also be a substrate adaptor for a cullin3 (CUL3) E3 ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Biallelic mutations in RCBTB1 may cause isolated and syndromic retinal dystrophy. It contains an RCC1 repeat, a BTB domain, and a BACK domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349662 [Multi-domain]  Cd Length: 117  Bit Score: 43.78  E-value: 2.10e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   49 LTTTQYIYKAlFKEEKNSDVAVMALDKVWHLHKVYLS-QSPYFYTMFNGTWREAQQNFIQItildDRITVASLDAVFGSM 127
Cdd:cd18353   5 LTVAESLKKE-FDSPETSDLKFRVDGKYIHVHKAVLKiRCEHFRTMFQSHWNEDMKEVIEI----DQFSYPVYRAFLEYL 79
                        90       100       110
                ....*....|....*....|....*....|....*
gi 7304006  128 YSDEIEIESADVISVLATATLFHLDGIIDKCAEVM 162
Cdd:cd18353  80 YTDSVDLPPEDAIGLLDLATSYCENRLKKLCQHII 114
BTB2_POZ_KLHL33 cd18263
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
57-172 2.57e-05

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 33 (KLHL33); KLHL33 contains BTB domains and kelch repeats, characteristics of a kelch family protein. Its function remains unclear. KLHL33 gene expression in normal and tumor tissue suggest a significant association with prostate cancer risk. KLHL33 contains two BTB domains. This model corresponds to the second BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349572 [Multi-domain]  Cd Length: 118  Bit Score: 43.65  E-value: 2.57e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   57 KALFKEEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITIlddrITVASLDAVFGSMYSDEIEIE 135
Cdd:cd18263   5 EGLWEKGVGCDVQLEADGSIFRVHRVILAAgSDYFRAMFTSGMKESTQSVVQLPT----IPAKDLRLLISFAYSGILHLS 80
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 7304006  136 SADVISVLATATLFHLDGIIDKCAEVMVDNISPETAI 172
Cdd:cd18263  81 WENLFEATCTALQLQISGALALCLDFLQREISPARCL 117
BTB_POZ_ZBTB44 cd18228
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-166 2.81e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 44 (ZBTB44); ZBTB44, also called BTB/POZ domain-containing protein 15 (BTBD15) or zinc finger protein 851 (ZNF851), may be involved in transcriptional regulation. Single-nucleotide polymorphisms of ZBTB44 showed a suggestive association with disease progression of Crohn's disease. ZBTB44 has also preferentially been recognized by sera of patients with peripheral T-cell lymphoma (PTCL). It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349537 [Multi-domain]  Cd Length: 126  Bit Score: 43.70  E-value: 2.81e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLSQ-SPYFYTMFNG--TWREAQQNFIQITILD-DRITVASLDAVFGSMYSDEIEIESADVISV 142
Cdd:cd18228  21 DVTIRVQDKIFRAHKVVLAAcSDFFRSKLVGqaSPRLVLVSPAGKCVLDlHHVTVTGFAPLLEYAYTSTLSINTENIIDV 100
                        90       100
                ....*....|....*....|....
gi 7304006  143 LATATLFHLDGIIDKCAEVMVDNI 166
Cdd:cd18228 101 LAAASYMQMFNVANTCSEFMKSSI 124
BTB_POZ_BTBD17 cd18292
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
59-162 5.26e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 17 (BTBD17); BTBD17, also called galectin-3-binding protein-like, is a BTB domain-containing protein. Its function remains unclear. It may be associated with hepatocellular carcinoma. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349601 [Multi-domain]  Cd Length: 114  Bit Score: 42.66  E-value: 5.26e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   59 LFKEEKNSDVAVMALDKVWHLHKVYLS-QSPYFYTMF-NGTWREAQQNfiQITILDDRITVASLDAVFGSMYSDEIEIES 136
Cdd:cd18292  11 LYNNEELSDIVLRVGGKVFHAHRLILAkSSDVFRVMLsNDWWSESKQS--EIELVEDPECAAVFEKFLRYLYTGQISVNL 88
                        90       100
                ....*....|....*....|....*.
gi 7304006  137 ADVISVLATATLFHLDGIIDKCAEVM 162
Cdd:cd18292  89 ETALPLLMLADKYNVTDLKQLCVDFM 114
BTB_POZ_KLHL5 cd18337
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-172 8.15e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 5 (KLHL5); KLHL5 shares high identity and similarity with the Drosophila kelch protein, a component of ring canals. It is abundantly expressed in the ovary, adrenal gland, and thymus. It contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349646 [Multi-domain]  Cd Length: 130  Bit Score: 42.36  E-value: 8.15e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRitvaSLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18337  25 DVVLVAGDRRIPAHRLVLSSvSDYFAAMFTNDVREAKQEEIKMEGVEPN----ALWALVQYAYTGRLELKEDNIECLLST 100
                        90       100
                ....*....|....*....|....*..
gi 7304006  146 ATLFHLDGIIDKCAEVMVDNISPETAI 172
Cdd:cd18337 101 ACLLQLSQVVEACCKFLMKQLHPSNCL 127
BTB_POZ_NS1BP cd18306
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-174 9.47e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Influenza virus NS1A-binding protein (NS1-BP); NS1-BP is also called NS1-binding protein, aryl hydrocarbon receptor-associated protein 3 (ARA3), or IVNS1ABP. It is a novel protein that interacts with the influenza A virus nonstructural NS1 protein, which is relocalized in the nuclei of infected cells. It plays a role in cell division and in the dynamic organization of the actin skeleton as a stabilizer of actin filaments by association with F-actin through its kelch repeats. It also interacts with alpha-enolase/MBP-1 and is involved in c-Myc gene transcriptional control. NS1-BP contains BTB and BACK domains at the N-terminal region and kelch repeats at the C-terminal region. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349615 [Multi-domain]  Cd Length: 124  Bit Score: 41.86  E-value: 9.47e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   80 HKVYLS-QSPYFYTMFNgtwREAQQNFIQITILDDrITVASLDAVFGSMYSDEIEIESADVISVLATATLFHLDGIIDKC 158
Cdd:cd18306  33 HRAVLAcASPYLFELFS---SDSDGESILTVKLDG-LDPDAVEVLVNYAYTSRLEVPADLVKSVYSAAKKLKMDRVKKAC 108
                        90
                ....*....|....*.
gi 7304006  159 AEVMVDNISPETAIQY 174
Cdd:cd18306 109 GDFLLEKLTPQNCIGI 124
BTB_POZ_BTBD1_2 cd18281
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
80-169 1.69e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing proteins, BTBD1 and BTBD2; This family includes BTB/POZ domain-containing proteins BTBD1 and BTBD2, both of which are BTB-domain-containing Kelch-like proteins that interact with DNA topoisomerase 1 (Topo1), a key enzyme of cell survival. BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349590 [Multi-domain]  Cd Length: 127  Bit Score: 41.27  E-value: 1.69e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   80 HKVYLS-QSPYFYTMFNGTWREAQQnfiQITILDdrITVASLDAVFGSMYSDEIEIESADVISVLATATLFHLDGIIDKC 158
Cdd:cd18281  41 HKFVLSiGSAVFDAMFNGGMATTSA---EIELPD--VEPAAFLALLRFLYSDEVQIGPETVMTTLYTAKKYAVPALESAC 115
                        90
                ....*....|.
gi 7304006  159 AEVMVDNISPE 169
Cdd:cd18281 116 VEFLKKNLSSD 126
BTB_POZ_BTBD9 cd18287
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
57-152 1.73e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 9 (BTBD9); BTBD9 is a risk factor for Restless Legs Syndrome (RLS) encoding a Cullin-3 substrate adaptor. The BTBD9 gene may be associated with antipsychotic-induced RLS in schizophrenia. Mutations in BTBD9 lead to reduced dopamine, increased locomotion and sleep fragmentation. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349596 [Multi-domain]  Cd Length: 119  Bit Score: 41.07  E-value: 1.73e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   57 KALFKEEKNSDVAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREAQQNfiQITILDdrITVASLDAVFGSMYSDEI--- 132
Cdd:cd18287  14 GALFLNEEYSDVTFVVEEKRFPAHRVILaARSEYFRALLYGGMRESQQS--EIELKD--TNAEAFKALLKYIYTGRLtlt 89
                        90       100
                ....*....|....*....|
gi 7304006  133 EIESADVISVLATATLFHLD 152
Cdd:cd18287  90 DLKEDVLLDVLGLAHQYGFE 109
BTB_POZ_KBTBD6_7 cd18273
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
87-162 1.90e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing proteins KBTBD6 and KBTBD7; KBTBD6 and KBTBD7 are substrate adaptors of a cullin-3 RING ubiquitin ligase complex that mediates ubiquitylation and proteasomal degradation of T-lymphoma and metastasis gene 1 (TIAM1), a RAC1-specific guanine exchange factor (GEF), by cooperating with gamma-aminobutyric acid receptor-associated proteins (GABARAP). KBTBD7 may also act as a new transcriptional activator in mitogen-activated protein kinase (MAPK) signaling. They both contain a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349582 [Multi-domain]  Cd Length: 142  Bit Score: 41.73  E-value: 1.90e-04
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7304006   87 SPYFYTMFNGTWREAQQNfiQITILDdrITVASLDAVFGSMYSDEIEIESADVISVLATATLFHLDGIIDKCAEVM 162
Cdd:cd18273  57 SPYFKSMFTGGLYESKQE--TVTIHD--VDSESMALIIDYCYTGRVTLSEANVQRLYAAANMLQLEYVREACASFL 128
BTB_POZ_KBTBD2_BKLHD1 cd18270
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
57-173 2.53e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 2 (KBTBD2); KBTBD2, also called BTB and kelch domain-containing protein 1 (BKLHD1), plays an essential role in the regulation of insulin-signaling pathway. It is a BTB-Kelch family substrate recognition subunit of the Cullin-3-based E3 ubiquitin ligase, which targets p85alpha, the regulatory subunit of the phosphoinositol-3-kinase (PI3K) heterodimer, causing p85alpha ubiquitination and proteasome-mediated degradation. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349579 [Multi-domain]  Cd Length: 133  Bit Score: 41.14  E-value: 2.53e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   57 KALFKEEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDdritVASLDAVFGSMYSDEIEIE 135
Cdd:cd18270  18 KFFYEQQLLTDIVLIVEGTEFPCHKMVLATcSSYFRAMFMSGLSESKQTHVHLRNVD----AATLQIIITYAYTGNLAIN 93
                        90       100       110
                ....*....|....*....|....*....|....*...
gi 7304006  136 SADVISVLATATLFHLDGIIDKCAEVMVDNISPETAIQ 173
Cdd:cd18270  94 DSTVEQLYETACFLQVEDVLQRCREYLIKKINAENCVR 131
BTB_POZ_trishanku-like cd18314
BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in ...
60-158 2.77e-04

BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in Dictyostelium discoideum trishanku and similar proteins; Trishanku is a novel regulator required for normal morphogenesis and cell-type stability in Dictyostelium discoideum. It contains a BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349623 [Multi-domain]  Cd Length: 96  Bit Score: 40.02  E-value: 2.77e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   60 FKEEKNSDVAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREAQQNFIQITILDDritvASLDAVFGSMYSDEIEIESAD 138
Cdd:cd18314   1 YNDSEFSDVVLCVGDRKFFAHRIVLcARSPVFRSMLTGSMIESNLKEVTLEDVEP----EIFETVLKYMYTGQVTLSEEN 76
                        90       100
                ....*....|....*....|
gi 7304006  139 VISVLATATLFHLDGIIDKC 158
Cdd:cd18314  77 VLDLLMLASKYQVPDLEKLC 96
BTB_POZ_KLHL41_KBTBD10 cd18341
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
57-168 3.69e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 41 (KLHL41); KLHL41 is also called Kel-like protein 23, Kelch repeat and BTB domain-containing protein 10 (KBTBD10), Kelch-related protein 1 (Krp1), or sarcosine. It is a novel kelch-related protein that is involved in pseudopod elongation in transformed cells. It is also involved in skeletal muscle development and differentiation. It regulates proliferation and differentiation of myoblasts and plays a role in myofibril assembly by promoting lateral fusion of adjacent thin fibrils into mature, wide myofibrils. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349650 [Multi-domain]  Cd Length: 133  Bit Score: 40.60  E-value: 3.69e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   57 KALFKEEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIqitILDDrITVASLDAVFGSMYSDEIEIE 135
Cdd:cd18341  19 KELLDENKFVDCTLKAGDKSLPCHRLILAAcSPYFREYFLSEESEEKKKEV---VLDN-VDPNIMDMILKYLYSAEIDLN 94
                        90       100       110
                ....*....|....*....|....*....|...
gi 7304006  136 SADVISVLATATLFHLDGIIDKCAEVMVDNISP 168
Cdd:cd18341  95 DGNVQDIFALASRFQIPSVFTVCVTYLQKRLSP 127
BTB_POZ_KLHL25 cd18254
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-172 4.50e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 25 (KLHL25); KLHL25, also called ectoderm-neural cortex protein 2 (ENC-2), is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that is required for translational homeostasis. The BCR(KLHL25) ubiquitin ligase complex acts by mediating ubiquitination of hypophosphorylated EIF4EBP1 (4E-BP1). Cullin3-KLHL25 ubiquitin ligase also targets ATP-citrate lyase (ACLY), a key enzyme for lipid synthesis, for degradation to inhibit lipid synthesis and tumor progression. KLHL25 contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349563 [Multi-domain]  Cd Length: 128  Bit Score: 40.38  E-value: 4.50e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQitiLDDRITVASLDAVFGSMYSDEIEIESADVISVLA 144
Cdd:cd18254  23 TDVTLWAGNRSFPCHRAVLAAcSRYFEAMFSNGLRESLDSTVN---FHDSLHPEVLELLLDFAYSSRIIINEENAESLLE 99
                        90       100
                ....*....|....*....|....*...
gi 7304006  145 TATLFHLDGIIDKCAEVMVDNISPETAI 172
Cdd:cd18254 100 AGDMLQFHDVRDAAAEFLEKNLYPSNCL 127
BTB_POZ_KLHL21 cd18250
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
58-158 8.41e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 21 (KLHL21); KLHL21 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for efficient chromosome alignment and cytokinesis. The BCR(KLHL21) E3 ubiquitin ligase complex regulates localization of the chromosomal passenger complex (CPC) from chromosomes to the spindle midzone in anaphase and mediates the ubiquitination of aurora B. KLHL21 also targets IkappaB kinase-beta to regulate nuclear factor kappa-light chain enhancer of activated B cells (NF-kappaB) signaling negatively. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349559 [Multi-domain]  Cd Length: 124  Bit Score: 39.37  E-value: 8.41e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   58 ALFKEEKNSDVAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREAQQNFIQITILDDRITVASLDavFGsmYSDEIEIES 136
Cdd:cd18250  14 ELRAERKFFDVTLCAGGREFPCHRTVLaAASSYFRAMFAGELRESRADRVVLHGVSAEILGLLLD--FS--YTGRVTVTQ 89
                        90       100
                ....*....|....*....|..
gi 7304006  137 ADVISVLATATLFHLDGIIDKC 158
Cdd:cd18250  90 DNVEALLRAADLFQFPSVKEAC 111
BTB_POZ_roadkill-like cd18345
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
58-171 8.70e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster protein roadkill and similar proteins; Drosophila melanogaster protein roadkill, also called Hh-induced MATH and BTB domain-containing protein (HIB), is a hedgehog-induced BTB protein that modulates hedgehog signaling by degrading Ci/Gli transcription factor. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349654 [Multi-domain]  Cd Length: 121  Bit Score: 39.06  E-value: 8.70e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   58 ALFKEEKNSDVAVMALDKVWHLHKVYLS-QSPYFYTMFNGTWREAQQNFIQITILDDRITVASLDAVFGSMYSDEIEIes 136
Cdd:cd18345  11 LLFERSAFSDVTLCVGGREFQAHKAILAaRSPVFNAMFEHEMEERKQNRVEITDVDHEVMREMLRFIYTGKAPNLDKM-- 88
                        90       100       110
                ....*....|....*....|....*....|....*
gi 7304006  137 ADviSVLATATLFHLDGIIDKCAEVMVDNISPETA 171
Cdd:cd18345  89 AD--DLLAAADKYALERLKVMCEEALCSNLSVENV 121
BTB_POZ_KLHL6 cd18236
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
62-169 1.25e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 6 (KLHL6); KLHL6 is a BTB-kelch protein with a lymphoid tissue-restricted expression pattern. It is involved in B-lymphocyte antigen receptor signaling and germinal center formation. It belongs to the KLHL gene family, which is composed of an N-terminal BTB-POZ domain and four to six Kelch motifs in tandem. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349545 [Multi-domain]  Cd Length: 129  Bit Score: 39.06  E-value: 1.25e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   62 EEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDRITVASLDAVfgsmYSDEIEIESADVI 140
Cdd:cd18236  21 ENSLTDVILCVDSQEFSCHRVVLAAaSNYFRAMFCNDLKEKYEEKIIIKGVDAETMQILLDYT----YTSKVLITKQNVQ 96
                        90       100
                ....*....|....*....|....*....
gi 7304006  141 SVLATATLFHLDGIIDKCAEVMVDNISPE 169
Cdd:cd18236  97 RVLEAASLFQFLRMVDACASFLTEALHPE 125
BTB_POZ_KLHL22 cd18251
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-163 1.33e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 22 (KLHL22); KLHL22 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex required for chromosome alignment and localization of polo-like kinase 1 (PLK1) at kinetochores. The BCR(KLHL22) ubiquitin ligase complex mediates mono-ubiquitination of PLK1, leading to PLK1 dissociation from phosphoreceptor proteins and subsequent removal from kinetochores, allowing silencing of the spindle assembly checkpoint (SAC) and chromosome segregation. It contains a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349560 [Multi-domain]  Cd Length: 125  Bit Score: 38.65  E-value: 1.33e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLSQS-PYFYTMFNGTWREAQQNFIQItildDRITVASLDAVFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18251  25 DVVLVVEGKPIEAHRILLAAScDYFRGMFAGGLREMQQTEVLI----HGVSYNAMCKILDFIYTSELELSLDNVQETLTA 100
                        90
                ....*....|....*...
gi 7304006  146 ATLFHLDGIIDKCAEVMV 163
Cdd:cd18251 101 ACQLQIPEVIGFCCDFLM 118
BTB_POZ_KBTBD4 cd18272
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
53-173 1.49e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch repeat and BTB domain-containing protein 4 (KBTBD4); KBTBD4, also called BTB and kelch domain-containing protein 4 (BKLHD4), is a BTB-BACK-Kelch domain protein belonging to a large family of cullin-RING ubiquitin ligase adaptors that facilitate the ubiquitination of target substrates. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349581 [Multi-domain]  Cd Length: 140  Bit Score: 39.11  E-value: 1.49e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   53 QYIYKALFKEEKNSDVAVMALDKVWHLHKVYLS-QSPYFYTMFNGTWREAQQNFIQITILDDRITVASLDAVfgsmYSDE 131
Cdd:cd18272  20 QSIMDLCLEDGLFADVTISVEGKEFQLHRLVLSaQSCFFRSMFTSNLKEARNRVIELKDVSESVFQLLVDYI----YHGT 95
                        90       100       110       120
                ....*....|....*....|....*....|....*....|..
gi 7304006  132 IEIESADVISVLATATLFHLDGIIDKCAEVMVDNISPETAIQ 173
Cdd:cd18272  96 VKLRVEELQETYEVADMYQLTALFEECSRFLARTVQVRNCLQ 137
BTB_POZ_ABTB2-like cd18297
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-158 1.51e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) and similar proteins; This family includes ABTB2, BTBD11, plant ARM repeat protein interacting with ABF2 (ARIA), and similar proteins. ABTB2, also called bood POZ containing gene type 2 (BPOZ-2), is a scaffold protein that controls the degradation of many biological proteins ranging from embryonic development to tumor progression. It may be involved in the initiation of hepatocyte growth. ABTB2 functions as an adaptor protein for the E3 ubiquitin ligase scaffold protein Cullin-3. It directly binds to eukaryotic elongation factor 1A1 (eEF1A1) to promote eEF1A1 ubiquitylation and degradation, and prevent translation. The BTBD11 gene has been recently identified as an all-trans retinoic acid (atRA)-responsive gene that lies downstream of atRA and its receptors in the regulation of neurite outgrowth and cell adhesion in neural as well as non-neural tissues. ARIA is an armadillo (ARM) repeat and BTB domain-containing protein that acts as a positive regulator of ABA response via the modulation of the transcriptional activity of ABF2. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349606 [Multi-domain]  Cd Length: 117  Bit Score: 38.41  E-value: 1.51e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREAQQNFIQITilDDRITVASLdaVFGSMYS---DEIEIESADVIS 141
Cdd:cd18297  13 SDVTFLVEGRPFYAHKIVLvTASDRFKSMLSSGSTEAQTPVIEIP--DIRYDIFQL--MMQYLYTggvESLDVAQDDALE 88
                        90
                ....*....|....*..
gi 7304006  142 VLATATLFHLDGIIDKC 158
Cdd:cd18297  89 LLRAASFFQLDGLKRHC 105
BTB_POZ_BPM_plant cd18280
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
56-152 3.08e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in plant BTB/POZ-MATH (BPM) protein family; The BPM protein family includes Arabidopsis thaliana BTB/POZ and MATH domain-containing proteins, AtBPM1-6, and similar proteins from other plants. BPM protein, also called protein BTB-POZ and MATH domain, may act as a substrate-specific adaptor of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349589 [Multi-domain]  Cd Length: 121  Bit Score: 37.69  E-value: 3.08e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   56 YKALFKEEKNSDVAVMALDKVWHLHKVYL-SQSPYFYTMFNGTWREAQqnfiqitilDDRITVASLDA-VFGSM----YS 129
Cdd:cd18280   5 FGALLESEEGADVTFNVDGEKFRAHKLVLaARSPVFRSMLFGPMREEN---------EGEIVIEDVEPpVFKALlhfiYK 75
                        90       100       110
                ....*....|....*....|....*....|....*
gi 7304006  130 DEI----EIESADVIS--------VLATATLFHLD 152
Cdd:cd18280  76 DELpddvEPAGSDSSSldttmaqhLLAAADRYALE 110
BTB_POZ_KLHL40-like cd18269
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
57-158 6.20e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like proteins, KLHL40 and KLHL41; This family includes Kelch-like proteins, KLHL40 and KLHL41. KLHL40 is a substrate-specific adaptor of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a key regulator of skeletal muscle development. KLHL41 is a novel kelch related protein that is involved in pseudopod elongation in transformed cells. They both contain a BTB domain and kelch repeats, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349578 [Multi-domain]  Cd Length: 133  Bit Score: 37.00  E-value: 6.20e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   57 KALFKEEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIqitILDDrITVASLDAVFGSMYSDEIEIE 135
Cdd:cd18269  19 KDLLDENKFVDCVLKIGDKEFPCHRLVLAAcSPYFRAMFLSDLEESKKKEV---VLED-VDPDVMGMILKYLYTSEIDLN 94
                        90       100
                ....*....|....*....|...
gi 7304006  136 SADVISVLATATLFHLDGIIDKC 158
Cdd:cd18269  95 DQNVQDIFALASRFQIPSIFTVC 117
BTB1_POZ_ABTB1_BPOZ1 cd18295
first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
66-162 6.23e-03

first BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ankyrin repeat and BTB/POZ domain-containing protein 1 (ABTB1); ABTB1, also called elongation factor 1A-binding protein or bood POZ containing gene type 1 (BPOZ-1), is an anti-proliferative factor that may act as a mediator of the phosphatase and tensin homolog (PTEN) growth-suppressive signaling pathway. It may play a role in developmental processes. ABTB1 contains an ankyrin repeat and two BTB domains. This model corresponds to the first BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349604 [Multi-domain]  Cd Length: 119  Bit Score: 36.84  E-value: 6.23e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALDKVWHLHKVYLS-QSPYFYTMFNGTWReaqqNFIQITILDDRITVASLDAVFGSMYSDEIEIESADVISVLA 144
Cdd:cd18295  20 SDVTFNVHGESFPAHRCILSaRSPYFAEMFETKWK----DKREINLKHPLVNPDAFRALLQYLYTGRLEIHVDDVEDCKR 95
                        90
                ....*....|....*...
gi 7304006  145 TATLFHLDGIIDKCAEVM 162
Cdd:cd18295  96 LAKQCRLEELIEELEAKC 113
BTB_POZ_ABTB2_BPOZ2 cd18350
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
66-172 7.56e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2); ABTB2, also called bood POZ containing gene type 2 (BPOZ-2), is a scaffold protein that controls the degradation of many biological proteins with various functions ranging from embryonic development to tumor progression. It may be involved in the initiation of hepatocyte growth. It inhibits the aggregation of alpha-synuclein, with implications for Parkinson's disease. ABTB2 functions as an adaptor protein for the E3 ubiquitin ligase scaffold protein Cullin-3. It directly binds to eukaryotic elongation factor 1A1 (eEF1A1) to promote eEF1A1 ubiquitylation and degradation, and prevent translation. It is also involved in the growth suppressive effect of the phosphatase and tensin homolog (PTEN). It contains an ankyrin repeat, BTB/POZ, and BACK domains. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349659 [Multi-domain]  Cd Length: 134  Bit Score: 36.75  E-value: 7.56e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALDKVWHLHKVYL-SQSPYFYTMFngTWREAQQNFIQITILDDRITVASLDAVFGSMY---SDEIEIESADVIS 141
Cdd:cd18350  25 SDVTFLVEGKLFYAHKVLLvTASNRFKSLL--TNKSEQESQGSKTIEISDIKYHIFQMLMQYLYyggTESMEIPIADVLE 102
                        90       100       110
                ....*....|....*....|....*....|.
gi 7304006  142 VLATATLFHLDGIIDKCAEVMVDNISPETAI 172
Cdd:cd18350 103 LLSAASLFQLDALQRHCEILCSQTINLENAV 133
BTB_POZ_KLHL1 cd18335
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
57-172 8.11e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Kelch-like protein 1 (KLHL1); KLHL1 is a neuronal actin-binding protein that modulates voltage-gated CaV2.1 (P/Q-type) and CaV3.2 (alpha1H T-type) calcium channels. It may play a role in organizing the actin cytoskeleton the brain cells. KLHL1 contains a BTB domain and kelch repeat domains, characteristics of a kelch family protein. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349644 [Multi-domain]  Cd Length: 126  Bit Score: 36.56  E-value: 8.11e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   57 KALFKEEKNSDVAVMALDKVWHLHKVYLSQ-SPYFYTMFNGTWREAQQNFIQITILDDritvASLDAVFGSMYSDEIEIE 135
Cdd:cd18335  11 ESYLKQQQLCDVILIAGNRKIPAHRLVLSAvSDYFAAMFTSDVCEAKQEEIKMEGIDP----NALWDLVQFAYTGCLELK 86
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 7304006  136 SADVISVLATATLFHLDGIIDKCAEVMVDNISPETAI 172
Cdd:cd18335  87 EDTIENLLAAACLLQLSQVVEVCCHFLMKLLHPSNCL 123
BTB2_POZ_IBtk cd18302
second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain ...
66-167 8.93e-03

second BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in inhibitor of Bruton tyrosine kinase (IBtk); IBtk is an inhibitor or negative regulator of Bruton tyrosine kinase (Btk), which is required for B-cell differentiation and development. IBtk binds to the PH domain of Btk and down-regulates the Btk kinase activity. It contains two BTB domains. This model corresponds to the second BTB domain. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349611 [Multi-domain]  Cd Length: 113  Bit Score: 36.19  E-value: 8.93e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   66 SDVAVMALD-KVWHLHK-VYLSQSPYFYTMFNGTWREAQQNfiqiTILDDRITVASLDAVFGSMYSDEIEI--ESADV-- 139
Cdd:cd18302   6 YDVTIVSEDgKEFPCHKcVLVARLEYFHSMLSSSWIEASSC----SALTMPIPSDILEIILDYLYTDEASAvkESQNVef 81
                        90       100
                ....*....|....*....|....*....
gi 7304006  140 -ISVLATATLFHLDGIIDKCAEVMVDNIS 167
Cdd:cd18302  82 lCNVLVIADQLLITRLKEICEVALVELLS 110
BTB_POZ_ZBTB37 cd18222
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
67-162 9.26e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in zinc finger and BTB domain-containing protein 37 (ZBTB37); ZBTB37 may be involved in transcriptional regulation. It is differentially expressed in aryl hydrocarbon receptor (AhR)-KO mice compared with WT mice, and may potentially contribute to the aging phenotype of AhR-KO mice. It contains a BTB/POZ domain, a common protein-protein interaction motif of about 100 amino acids.


Pssm-ID: 349531 [Multi-domain]  Cd Length: 123  Bit Score: 36.17  E-value: 9.26e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7304006   67 DVAVMALDKVWHLHKVYLS-QSPYFYTMFNgtwrEAQQNFIQITILDDRITVASLdavFGSMYSDEIEIESADVISVLAT 145
Cdd:cd18222  27 DIVVNVQGQSFRAHKVVLAaSSPYFRDHMS----LNEMSTVSISVIKNPTVFEQL---LSFCYTGRICLQLADIISYLTA 99
                        90
                ....*....|....*..
gi 7304006  146 ATLFHLDGIIDKCAEVM 162
Cdd:cd18222 100 ASFLQMQHIIDKCTQIL 116
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH