NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|22831864|gb|AAF46224|]
View 

uncharacterized protein Dmel_CG3040 [Drosophila melanogaster]

Protein Classification

leucine-rich repeat domain-containing protein (domain architecture ID 11469232)

leucine-rich repeat (LRR) domain-containing protein may participate in protein-protein interactions

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
18-167 2.17e-17

Leucine-rich repeat (LRR) protein [Transcription];


:

Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 80.01  E-value: 2.17e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  18 ILKISLQRLQEFPLQLRAYPNVLKTLDLSENRFERVPDELGKLTLLKHLNLSGNRLVELNEVVGELAKLEVLLLMDNMLT 97
Cdd:COG4886 120 SLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKIS 199
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 22831864  98 RLPKTLANCTHLKTVNLSNNQLKEFPSMLCGLKQLDVLDLSRNKITDVPADVGGLF-VTELNLNQNQISSL 167
Cdd:COG4886 200 DLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSnLETLDLSNNQISSI 270
 
Name Accession Description Interval E-value
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
18-167 2.17e-17

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 80.01  E-value: 2.17e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  18 ILKISLQRLQEFPLQLRAYPNVLKTLDLSENRFERVPDELGKLTLLKHLNLSGNRLVELNEVVGELAKLEVLLLMDNMLT 97
Cdd:COG4886 120 SLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKIS 199
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 22831864  98 RLPKTLANCTHLKTVNLSNNQLKEFPSMLCGLKQLDVLDLSRNKITDVPADVGGLF-VTELNLNQNQISSL 167
Cdd:COG4886 200 DLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSnLETLDLSNNQISSI 270
PRK15370 PRK15370
E3 ubiquitin-protein ligase SlrP; Provisional
18-171 4.07e-12

E3 ubiquitin-protein ligase SlrP; Provisional


Pssm-ID: 185268 [Multi-domain]  Cd Length: 754  Bit Score: 65.10  E-value: 4.07e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   18 ILKISLQRLQEFPLQLrayPNVLKTLDLSENRF----ERVPDELGKLTL---------------LKHLNLSGNRLVELNE 78
Cdd:PRK15370 245 EMELSINRITELPERL---PSALQSLDLFHNKIsclpENLPEELRYLSVydnsirtlpahlpsgITHLNVQSNSLTALPE 321
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   79 VVGelAKLEVLLLMDNMLTRLPKTLAncTHLKTVNLSNNQLKEFPSMLCglKQLDVLDLSRNKITDVPADVGGLfVTELN 158
Cdd:PRK15370 322 TLP--PGLKTLEAGENALTSLPASLP--PELQVLDVSKNQITVLPETLP--PTITTLDVSRNALTNLPENLPAA-LQIMQ 394
                        170
                 ....*....|...
gi 22831864  159 LNQNQISSLAEEV 171
Cdd:PRK15370 395 ASRNNLVRLPESL 407
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
4-192 1.06e-06

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 48.51  E-value: 1.06e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   4 KQIKQQLETAQKTGILKISLQRLQEFPLQLRAYP------NVLKTLDLSENRF-----ERVPDELGKLTLlKHLNLSGNR 72
Cdd:cd00116  41 KALASALRPQPSLKELCLSLNETGRIPRGLQSLLqgltkgCGLQELDLSDNALgpdgcGVLESLLRSSSL-QELKLNNNG 119
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  73 LVE-----LNEVVGELA-KLEVLLLMDNMLT-----RLPKTLANCTHLKTVNLSNNQLKE--FPSMLCGLK---QLDVLD 136
Cdd:cd00116 120 LGDrglrlLAKGLKDLPpALEKLVLGRNRLEgasceALAKALRANRDLKELNLANNGIGDagIRALAEGLKancNLEVLD 199
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 22831864 137 LSRNKITDVPA-DVGGLF-----VTELNLNQNQISSL-AEEVAD-----CPKLKTLRLEENCLQAAAF 192
Cdd:cd00116 200 LNNNGLTDEGAsALAETLaslksLEVLNLGDNNLTDAgAAALASallspNISLLTLSLSCNDITDDGA 267
LRR_8 pfam13855
Leucine rich repeat;
85-142 1.80e-06

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 44.05  E-value: 1.80e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864    85 KLEVLLLMDNMLTRL-PKTLANCTHLKTVNLSNNQLKEF-PSMLCGLKQLDVLDLSRNKI 142
Cdd:pfam13855   1 NLRSLDLSNNRLTVLdDGAFKGLSNLKVLDLSNNLLTTLsPGAFSGLPSLRYLDLSGNRL 60
 
Name Accession Description Interval E-value
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
18-167 2.17e-17

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 80.01  E-value: 2.17e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  18 ILKISLQRLQEFPLQLRAYPNVLKTLDLSENRFERVPDELGKLTLLKHLNLSGNRLVELNEVVGELAKLEVLLLMDNMLT 97
Cdd:COG4886 120 SLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKIS 199
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 22831864  98 RLPKTLANCTHLKTVNLSNNQLKEFPSMLCGLKQLDVLDLSRNKITDVPADVGGLF-VTELNLNQNQISSL 167
Cdd:COG4886 200 DLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSnLETLDLSNNQISSI 270
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
18-184 1.59e-16

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 77.32  E-value: 1.59e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  18 ILKISLQRLQEFPLQLRAYPNvLKTLDLSENRFERVPDELGKLTLLKHLNLSGNRLVELNEVVGELAKLEVLLLMDNMLT 97
Cdd:COG4886 144 ELDLSDNKIESLPSPLRNLPN-LKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLSNNSII 222
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  98 RLPKTLANCTHLKTVNLSNNQLKEFPSMLCGLKQLDVLDLSRNKITDVPADVGGLFVTELNLNQNQISSLAEEVADCPKL 177
Cdd:COG4886 223 ELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSISSLGSLTNLRELDLSGNSLSNALPLIALLLLL 302

                ....*..
gi 22831864 178 KTLRLEE 184
Cdd:COG4886 303 LELLLNL 309
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
40-185 7.30e-15

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 72.69  E-value: 7.30e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  40 LKTLDLSENRFERVPDELGKLTLLKHLNLSGNRLVELNEVVGELA-KLEVLLLMDNMLTRLPKTLANCTHLKTVNLSNNQ 118
Cdd:COG4886  95 LPSLDLNLNRLRSNISELLELTNLTSLDLDNNNITDIPPLIGLLKsNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFND 174
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 22831864 119 LKEFPSMLCGLKQLDVLDLSRNKITDVPADVGGL-FVTELNLNQNQISSLAEEVADCPKLKTLRLEEN 185
Cdd:COG4886 175 LSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLsALEELDLSNNSIIELLSSLSNLKNLSGLELSNN 242
PRK15370 PRK15370
E3 ubiquitin-protein ligase SlrP; Provisional
18-171 4.07e-12

E3 ubiquitin-protein ligase SlrP; Provisional


Pssm-ID: 185268 [Multi-domain]  Cd Length: 754  Bit Score: 65.10  E-value: 4.07e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   18 ILKISLQRLQEFPLQLrayPNVLKTLDLSENRF----ERVPDELGKLTL---------------LKHLNLSGNRLVELNE 78
Cdd:PRK15370 245 EMELSINRITELPERL---PSALQSLDLFHNKIsclpENLPEELRYLSVydnsirtlpahlpsgITHLNVQSNSLTALPE 321
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   79 VVGelAKLEVLLLMDNMLTRLPKTLAncTHLKTVNLSNNQLKEFPSMLCglKQLDVLDLSRNKITDVPADVGGLfVTELN 158
Cdd:PRK15370 322 TLP--PGLKTLEAGENALTSLPASLP--PELQVLDVSKNQITVLPETLP--PTITTLDVSRNALTNLPENLPAA-LQIMQ 394
                        170
                 ....*....|...
gi 22831864  159 LNQNQISSLAEEV 171
Cdd:PRK15370 395 ASRNNLVRLPESL 407
PRK15370 PRK15370
E3 ubiquitin-protein ligase SlrP; Provisional
4-187 1.15e-10

E3 ubiquitin-protein ligase SlrP; Provisional


Pssm-ID: 185268 [Multi-domain]  Cd Length: 754  Bit Score: 60.87  E-value: 1.15e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864    4 KQIKQQLETAQKTgiLKISLQRLQEFPLQLrayPNVLKTLDLSENRFERVPDELGklTLLKHLNLSGNRLVELNEVVGEl 83
Cdd:PRK15370 212 KSLPENLQGNIKT--LYANSNQLTSIPATL---PDTIQEMELSINRITELPERLP--SALQSLDLFHNKISCLPENLPE- 283
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   84 aKLEVLLLMDNMLTRLPKTL-ANCTHLktvNLSNNQLKEFPSMLCglKQLDVLDLSRNKITDVPADVGGLfVTELNLNQN 162
Cdd:PRK15370 284 -ELRYLSVYDNSIRTLPAHLpSGITHL---NVQSNSLTALPETLP--PGLKTLEAGENALTSLPASLPPE-LQVLDVSKN 356
                        170       180
                 ....*....|....*....|....*
gi 22831864  163 QISSLAEEVAdcPKLKTLRLEENCL 187
Cdd:PRK15370 357 QITVLPETLP--PTITTLDVSRNAL 379
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
40-162 1.12e-09

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 57.94  E-value: 1.12e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   40 LKTLDLSENRF-ERVPDELGKLTLLKHLNLSGNrlvelnEVVGELaklevlllmdnmltrlPKTLANCTHLKTVNLSNNQ 118
Cdd:PLN00113 477 LENLDLSRNQFsGAVPRKLGSLSELMQLKLSEN------KLSGEI----------------PDELSSCKKLVSLDLSHNQ 534
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 22831864  119 LK-EFPSMLCGLKQLDVLDLSRNKIT-DVPADVGGL-FVTELNLNQN 162
Cdd:PLN00113 535 LSgQIPASFSEMPVLSQLDLSQNQLSgEIPKNLGNVeSLVQVNISHN 581
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
53-143 1.15e-09

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 57.94  E-value: 1.15e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   53 VPDELGKLTLLKHLNLSGNRLV-ELNEVVGELAKLEVLLLMDNMLT-RLPKTLANCTHLKTVNLSNNQLK-EFPSMLCGL 129
Cdd:PLN00113 228 IPYEIGGLTSLNHLDLVYNNLTgPIPSSLGNLKNLQYLFLYQNKLSgPIPPSIFSLQKLISLDLSDNSLSgEIPELVIQL 307
                         90
                 ....*....|....
gi 22831864  130 KQLDVLDLSRNKIT 143
Cdd:PLN00113 308 QNLEILHLFSNNFT 321
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
30-187 8.62e-09

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 55.24  E-value: 8.62e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   30 PLQLRAYPNvLKTLDLSENRFE-RVPDELGKLTLLKHLNLSGNRLV-ELNEVVGELAKLEVLLLMDNML-TRLPKTLANC 106
Cdd:PLN00113 325 PVALTSLPR-LQVLQLWSNKFSgEIPKNLGKHNNLTVLDLSTNNLTgEIPEGLCSSGNLFKLILFSNSLeGEIPKSLGAC 403
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  107 THLKTVNLSNNQLK--------------------------------EFPSM----------------LCGLKQLDVLDLS 138
Cdd:PLN00113 404 RSLRRVRLQDNSFSgelpseftklplvyfldisnnnlqgrinsrkwDMPSLqmlslarnkffgglpdSFGSKRLENLDLS 483
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 22831864  139 RNKITD-VPADVGGLF-VTELNLNQNQISS-LAEEVADCPKLKTLRLEENCL 187
Cdd:PLN00113 484 RNQFSGaVPRKLGSLSeLMQLKLSENKLSGeIPDELSSCKKLVSLDLSHNQL 535
PRK15370 PRK15370
E3 ubiquitin-protein ligase SlrP; Provisional
45-210 1.98e-08

E3 ubiquitin-protein ligase SlrP; Provisional


Pssm-ID: 185268 [Multi-domain]  Cd Length: 754  Bit Score: 53.93  E-value: 1.98e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   45 LSENRFERVPDELGkLTLLKH--------LNLSGNRLVELNEVVGelAKLEVLLLMDNMLTRLPKTLANCthLKTVNLSN 116
Cdd:PRK15370 176 LKNNKTELRLKILG-LTTIPAcipeqittLILDNNELKSLPENLQ--GNIKTLYANSNQLTSIPATLPDT--IQEMELSI 250
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  117 NQLKEFPSML-CGLKQLDV------------------LDLSRNKITDVPADVGGlFVTELNLNQNQISSLAEEVAdcPKL 177
Cdd:PRK15370 251 NRITELPERLpSALQSLDLfhnkisclpenlpeelryLSVYDNSIRTLPAHLPS-GITHLNVQSNSLTALPETLP--PGL 327
                        170       180       190
                 ....*....|....*....|....*....|....
gi 22831864  178 KTLRLEENCLQA-AAFTPKILKdskicNLAVDGN 210
Cdd:PRK15370 328 KTLEAGENALTSlPASLPPELQ-----VLDVSKN 356
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
41-185 2.07e-08

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 53.82  E-value: 2.07e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  41 KTLDLSENRFERVPDELGKLTLLKHLNLSGNRLVELNEVVGELAKLEVLLLMDNMLTRLPKTLANCTHLKTVNLSNNQLK 120
Cdd:COG4886  50 LALNLSSNTLLLLPSSLSRLLSLDLLSPSGISSLDGSENLLNLLPLPSLDLNLNRLRSNISELLELTNLTSLDLDNNNIT 129
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 22831864 121 EFPSMLCGLK-QLDVLDLSRNKITDVPADVGGL-FVTELNLNQNQISSLAEEVADCPKLKTLRLEEN 185
Cdd:COG4886 130 DIPPLIGLLKsNLKELDLSDNKIESLPSPLRNLpNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGN 196
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
28-196 9.66e-08

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 52.16  E-value: 9.66e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   28 EFPLQLRAYPNvLKTLDLSENRFE-RVPDELGKLTLLKHLNLSGNRLVelNEVVGELAKLEVL----LLMDNMLTRLPKT 102
Cdd:PLN00113 155 EIPNDIGSFSS-LKVLDLGGNVLVgKIPNSLTNLTSLEFLTLASNQLV--GQIPRELGQMKSLkwiyLGYNNLSGEIPYE 231
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  103 LANCTHLKTVNLS-NNQLKEFPSMLCGLKQLDVLDLSRNKITD-VPADVGGLF-VTELNLNQNQIS-SLAEEVADCPKLK 178
Cdd:PLN00113 232 IGGLTSLNHLDLVyNNLTGPIPSSLGNLKNLQYLFLYQNKLSGpIPPSIFSLQkLISLDLSDNSLSgEIPELVIQLQNLE 311
                        170
                 ....*....|....*...
gi 22831864  179 TLRLEENclqaaAFTPKI 196
Cdd:PLN00113 312 ILHLFSN-----NFTGKI 324
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
4-192 1.06e-06

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 48.51  E-value: 1.06e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   4 KQIKQQLETAQKTGILKISLQRLQEFPLQLRAYP------NVLKTLDLSENRF-----ERVPDELGKLTLlKHLNLSGNR 72
Cdd:cd00116  41 KALASALRPQPSLKELCLSLNETGRIPRGLQSLLqgltkgCGLQELDLSDNALgpdgcGVLESLLRSSSL-QELKLNNNG 119
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  73 LVE-----LNEVVGELA-KLEVLLLMDNMLT-----RLPKTLANCTHLKTVNLSNNQLKE--FPSMLCGLK---QLDVLD 136
Cdd:cd00116 120 LGDrglrlLAKGLKDLPpALEKLVLGRNRLEgasceALAKALRANRDLKELNLANNGIGDagIRALAEGLKancNLEVLD 199
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 22831864 137 LSRNKITDVPA-DVGGLF-----VTELNLNQNQISSL-AEEVAD-----CPKLKTLRLEENCLQAAAF 192
Cdd:cd00116 200 LNNNGLTDEGAsALAETLaslksLEVLNLGDNNLTDAgAAALASallspNISLLTLSLSCNDITDDGA 267
PRK15387 PRK15387
E3 ubiquitin-protein ligase SspH2; Provisional
25-121 1.08e-06

E3 ubiquitin-protein ligase SspH2; Provisional


Pssm-ID: 185285 [Multi-domain]  Cd Length: 788  Bit Score: 49.01  E-value: 1.08e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   25 RLQEFPlqlrAYPNVLKTLDLSENRFERVPDELGKLtllKHLNLSGNRLVELNEVVGELAKLEVlllMDNMLTRLPKTLA 104
Cdd:PRK15387 373 RLTSLP----ALPSGLKELIVSGNRLTSLPVLPSEL---KELMVSGNRLTSLPMLPSGLLSLSV---YRNQLTRLPESLI 442
                         90
                 ....*....|....*..
gi 22831864  105 NCTHLKTVNLSNNQLKE 121
Cdd:PRK15387 443 HLSSETTVNLEGNPLSE 459
LRR_8 pfam13855
Leucine rich repeat;
85-142 1.80e-06

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 44.05  E-value: 1.80e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864    85 KLEVLLLMDNMLTRL-PKTLANCTHLKTVNLSNNQLKEF-PSMLCGLKQLDVLDLSRNKI 142
Cdd:pfam13855   1 NLRSLDLSNNRLTVLdDGAFKGLSNLKVLDLSNNLLTTLsPGAFSGLPSLRYLDLSGNRL 60
PLN03150 PLN03150
hypothetical protein; Provisional
90-165 3.07e-06

hypothetical protein; Provisional


Pssm-ID: 178695 [Multi-domain]  Cd Length: 623  Bit Score: 47.50  E-value: 3.07e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   90 LLMDNMLTR--LPKTLANCTHLKTVNLSNNQLK-EFPSMLCGLKQLDVLDLSRNKIT-DVPADVGGL-FVTELNLNQNQI 164
Cdd:PLN03150 423 LGLDNQGLRgfIPNDISKLRHLQSINLSGNSIRgNIPPSLGSITSLEVLDLSYNSFNgSIPESLGQLtSLRILNLNGNSL 502

                 .
gi 22831864  165 S 165
Cdd:PLN03150 503 S 503
PLN03150 PLN03150
hypothetical protein; Provisional
40-73 9.70e-06

hypothetical protein; Provisional


Pssm-ID: 178695 [Multi-domain]  Cd Length: 623  Bit Score: 45.96  E-value: 9.70e-06
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 22831864   40 LKTLDLSENRFE-RVPDELGKLTLLKHLNLSGNRL 73
Cdd:PLN03150 468 LEVLDLSYNSFNgSIPESLGQLTSLRILNLNGNSL 502
PLN03150 PLN03150
hypothetical protein; Provisional
53-129 2.84e-05

hypothetical protein; Provisional


Pssm-ID: 178695 [Multi-domain]  Cd Length: 623  Bit Score: 44.42  E-value: 2.84e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   53 VPDELGKLTLLKHLNLSGNRLV-ELNEVVGELAKLEVLLLMDNMLT-RLPKTLANCTHLKTVNLSNNQLK-EFPSMLCGL 129
Cdd:PLN03150 434 IPNDISKLRHLQSINLSGNSIRgNIPPSLGSITSLEVLDLSYNSFNgSIPESLGQLTSLRILNLNGNSLSgRVPAALGGR 513
LRR_8 pfam13855
Leucine rich repeat;
40-96 4.41e-05

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 39.81  E-value: 4.41e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 22831864    40 LKTLDLSENRFERVPDE-LGKLTLLKHLNLSGNRLVELNEVVGE-LAKLEVLLLMDNML 96
Cdd:pfam13855   2 LRSLDLSNNRLTVLDDGaFKGLSNLKVLDLSNNLLTTLSPGAFSgLPSLRYLDLSGNRL 60
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
63-187 7.29e-05

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 42.73  E-value: 7.29e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864  63 LKHLNLSGNRL-----VELNEVVGELAKLEVLLLMDNML-----TRLPKTLANCTHLKTVNLSNNQLK-EFPSMLCG--- 128
Cdd:cd00116 139 LEKLVLGRNRLegascEALAKALRANRDLKELNLANNGIgdagiRALAEGLKANCNLEVLDLNNNGLTdEGASALAEtla 218
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 22831864 129 -LKQLDVLDLSRNKITDVPA-------DVGGLFVTELNLNQNQIS-----SLAEEVADCPKLKTLRLEENCL 187
Cdd:cd00116 219 sLKSLEVLNLGDNNLTDAGAaalasalLSPNISLLTLSLSCNDITddgakDLAEVLAEKESLLELDLRGNKF 290
PRK15387 PRK15387
E3 ubiquitin-protein ligase SspH2; Provisional
33-214 2.94e-04

E3 ubiquitin-protein ligase SspH2; Provisional


Pssm-ID: 185285 [Multi-domain]  Cd Length: 788  Bit Score: 41.30  E-value: 2.94e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   33 LRAYPNVLKTLDLSENRFERVP---DELGKLTL----LKHLN----------LSGNRLVELNEVVGELAKLEVlllMDNM 95
Cdd:PRK15387 237 LPALPPELRTLEVSGNQLTSLPvlpPGLLELSIfsnpLTHLPalpsglcklwIFGNQLTSLPVLPPGLQELSV---SDNQ 313
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   96 LTRLPktlANCTHLKTVNLSNNQLKEFPSMLCGLKQLDVLDlsrNKITDVPADVGGLFvtELNLNQNQISSLAeevADCP 175
Cdd:PRK15387 314 LASLP---ALPSELCKLWAYNNQLTSLPTLPSGLQELSVSD---NQLASLPTLPSELY--KLWAYNNRLTSLP---ALPS 382
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 22831864  176 KLKTLRLEENCLQAAAFTPKILKDskicnLAVDGNLFNS 214
Cdd:PRK15387 383 GLKELIVSGNRLTSLPVLPSELKE-----LMVSGNRLTS 416
LRR_8 pfam13855
Leucine rich repeat;
108-164 8.54e-04

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 36.35  E-value: 8.54e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864   108 HLKTVNLSNNQLKEF-PSMLCGLKQLDVLDLSRNKITDVPADVGGLF--VTELNLNQNQI 164
Cdd:pfam13855   1 NLRSLDLSNNRLTVLdDGAFKGLSNLKVLDLSNNLLTTLSPGAFSGLpsLRYLDLSGNRL 60
LRR_9 pfam14580
Leucine-rich repeat;
23-100 1.76e-03

Leucine-rich repeat;


Pssm-ID: 339288 [Multi-domain]  Cd Length: 175  Bit Score: 37.79  E-value: 1.76e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22831864    23 LQRLQEFPLQLRaypnvLKTLDLSENRFERVPDELGK-LTLLKHLNLSGNRLVELNEV--VGELAKLEVLLLMDNMLTRL 99
Cdd:pfam14580  54 IRKLDNFPLLKR-----LKTLLVNNNRILRIGEGLGQvLPNLEELVLTNNSLQELGDLdpLASLKKLTYLSLLRNPVTNK 128

                  .
gi 22831864   100 P 100
Cdd:pfam14580 129 P 129
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH