NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7239180|gb|AAF43106|]
View 

P2X5a [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
P2X_receptor super family cl02993
ATP P2X receptor;
1-111 2.70e-70

ATP P2X receptor;


The actual alignment was detected with superfamily member TIGR00863:

Pssm-ID: 322156  Cd Length: 372  Bit Score: 218.83  E-value: 2.70e-70
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7239180      1 MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSD 80
Cdd:TIGR00863   1 MARRLAAGLSSFFFDYKTPKYVLVRNKKVGVIYRLVQLLILVYVIGWVFLAEKGYQESDTSPQSSVITKVKGVAVTQTSE 80
                          90       100       110
                  ....*....|....*....|....*....|.
gi 7239180     81 LGQRIWDVADYVIPAQGENVFFVVTNLIVTP 111
Cdd:TIGR00863  81 LGNRVWDVADYVKPPQGENVFFVMTNFIVTP 111
 
Name Accession Description Interval E-value
P2X TIGR00863
cation transporter protein; ATP-gated Cation Channel (ACC) Family (TC 1.A.7)Members of the ACC ...
1-111 2.70e-70

cation transporter protein; ATP-gated Cation Channel (ACC) Family (TC 1.A.7)Members of the ACC family (also called P2X receptors) respond to ATP, a functional neurotransmitter released by exocytosis from many types of neurons.These channels, which function at neuron-neuron and neuron-smooth muscle junctions, may play roles in the control of blood pressure and pain sensation. They may also function in lymphocyte and plateletphysiology. They are found only in animals.ACC channels are probably hetero- or homomultimers and transport small monovalent cations (Me+). Some also transport Ca2+; a few also transport small metabolites. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273307  Cd Length: 372  Bit Score: 218.83  E-value: 2.70e-70
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7239180      1 MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSD 80
Cdd:TIGR00863   1 MARRLAAGLSSFFFDYKTPKYVLVRNKKVGVIYRLVQLLILVYVIGWVFLAEKGYQESDTSPQSSVITKVKGVAVTQTSE 80
                          90       100       110
                  ....*....|....*....|....*....|.
gi 7239180     81 LGQRIWDVADYVIPAQGENVFFVVTNLIVTP 111
Cdd:TIGR00863  81 LGNRVWDVADYVKPPQGENVFFVMTNFIVTP 111
P2X_receptor pfam00864
ATP P2X receptor;
14-115 1.99e-60

ATP P2X receptor;


Pssm-ID: 307145  Cd Length: 366  Bit Score: 193.15  E-value: 1.99e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7239180     14 FDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLqSAVITKVKGVAFTNTSDLGQRIWDVADYVI 93
Cdd:pfam00864   1 FDYETPKVVVIRSKKVGLIYRLIQLLILSYVIGWVFIYEKGYQERDTAI-SSVTTKVKGVAVTNTSELGERVWDVADYVI 79
                          90       100
                  ....*....|....*....|....
gi 7239180     94 PAQGENVFFVVTNLIVTP--TSGR 115
Cdd:pfam00864  80 PPQGENSFFVMTNLIVTPnqTQGT 103
 
Name Accession Description Interval E-value
P2X TIGR00863
cation transporter protein; ATP-gated Cation Channel (ACC) Family (TC 1.A.7)Members of the ACC ...
1-111 2.70e-70

cation transporter protein; ATP-gated Cation Channel (ACC) Family (TC 1.A.7)Members of the ACC family (also called P2X receptors) respond to ATP, a functional neurotransmitter released by exocytosis from many types of neurons.These channels, which function at neuron-neuron and neuron-smooth muscle junctions, may play roles in the control of blood pressure and pain sensation. They may also function in lymphocyte and plateletphysiology. They are found only in animals.ACC channels are probably hetero- or homomultimers and transport small monovalent cations (Me+). Some also transport Ca2+; a few also transport small metabolites. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273307  Cd Length: 372  Bit Score: 218.83  E-value: 2.70e-70
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7239180      1 MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSD 80
Cdd:TIGR00863   1 MARRLAAGLSSFFFDYKTPKYVLVRNKKVGVIYRLVQLLILVYVIGWVFLAEKGYQESDTSPQSSVITKVKGVAVTQTSE 80
                          90       100       110
                  ....*....|....*....|....*....|.
gi 7239180     81 LGQRIWDVADYVIPAQGENVFFVVTNLIVTP 111
Cdd:TIGR00863  81 LGNRVWDVADYVKPPQGENVFFVMTNFIVTP 111
P2X_receptor pfam00864
ATP P2X receptor;
14-115 1.99e-60

ATP P2X receptor;


Pssm-ID: 307145  Cd Length: 366  Bit Score: 193.15  E-value: 1.99e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7239180     14 FDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLqSAVITKVKGVAFTNTSDLGQRIWDVADYVI 93
Cdd:pfam00864   1 FDYETPKVVVIRSKKVGLIYRLIQLLILSYVIGWVFIYEKGYQERDTAI-SSVTTKVKGVAVTNTSELGERVWDVADYVI 79
                          90       100
                  ....*....|....*....|....
gi 7239180     94 PAQGENVFFVVTNLIVTP--TSGR 115
Cdd:pfam00864  80 PPQGENSFFVMTNLIVTPnqTQGT 103
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH