NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|5348336|gb|AAD42109|]
View 

forkhead protein FKHR [Gallus gallus]

Protein Classification

FH and FOXO_KIX_bdg domain-containing protein (domain architecture ID 10811646)

protein containing domains FH, FOXO_KIX_bdg, and FOXO-TAD

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FH cd00059
Forkhead (FH), also known as a "winged helix". FH is named for the Drosophila fork head ...
230-310 3.83e-36

Forkhead (FH), also known as a "winged helix". FH is named for the Drosophila fork head protein, a transcription factor which promotes terminal rather than segmental development. This family of transcription factor domains, which bind to B-DNA as monomers, are also found in the Hepatocyte nuclear factor (HNF) proteins, which provide tissue-specific gene regulation. The structure contains 2 flexible loops or "wings" in the C-terminal region, hence the term winged helix.


:

Pssm-ID: 238016  Cd Length: 78  Bit Score: 130.37  E-value: 3.83e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5348336  230 WGNLSYADLITKAIESSPEKRLTLSQIYEWMVKSVPYFKDKgdsnsSAGWKNSIRHNLSLHSKFIRVQNE--GTGKSSWW 307
Cdd:cd00059   1 KPPYSYSALIAMAIQSSPEKRLTLSEIYKWISDNFPYFRDA-----PAGWQNSIRHNLSLNKCFVKVPREpdEPGKGSYW 75

                ...
gi 5348336  308 MLN 310
Cdd:cd00059  76 TLD 78
FOXO_KIX_bdg pfam16675
KIX-binding domain of forkhead box O, CR2; FOXO_KIX_bd is the first part of the region of ...
493-570 1.11e-27

KIX-binding domain of forkhead box O, CR2; FOXO_KIX_bd is the first part of the region of transcription factor forkhead box O family proteins that binds to the CREB-binding proteins via the KIX domain. Coactivator CBP/p300 is recruited by FOXO3 via the binding of this domain as well as the simultaneous binding of the more C-terminal TAD domain.


:

Pssm-ID: 318810  Cd Length: 78  Bit Score: 106.34  E-value: 1.11e-27
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 5348336    493 KFTYAQASMNSLPQIPMQTLQDSK-SSYGSMSQFNcPAGLLKELLTSDSPPHNDILASVDTGVSQAGGRALGQGVLMVT 570
Cdd:pfam16675   1 KYIYGQPSMNSLRQMPMQTIQENKqASFSSMSQYG-NAGLLQELLTSDSYPHKDILTQVDTLVSQASSRVLSQNHRMNT 78
FOXO-TAD pfam16676
Transactivation domain of FOXO protein family; TAD is a promiscuous binding domain that ...
669-707 3.70e-18

Transactivation domain of FOXO protein family; TAD is a promiscuous binding domain that mediates the association of the transcription factor FOXO with the coactivator CBP/p300. Both this domain and the FOXO-KIX_bd family pfam16675 bind simultaneously the KIX domain of CBP/p300. Coactivator CBP/p300 is recruited by FOXO3 though binding to these two regions. The promiscuity of the TAD is further evidenced by that the finding that they also bind the TAZ1 and TAZ2 domains of CBP/p300.


:

Pssm-ID: 318811  Cd Length: 40  Bit Score: 78.09  E-value: 3.70e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 5348336    669 KLPSDLD-DMLIERLDCDMESIIRNDLMDGETLDFNFDSV 707
Cdd:pfam16676   1 RLPSDLDlDMFIGSLDCDVDSIIRNDLMDGDGLDFNFDSS 40
 
Name Accession Description Interval E-value
FH cd00059
Forkhead (FH), also known as a "winged helix". FH is named for the Drosophila fork head ...
230-310 3.83e-36

Forkhead (FH), also known as a "winged helix". FH is named for the Drosophila fork head protein, a transcription factor which promotes terminal rather than segmental development. This family of transcription factor domains, which bind to B-DNA as monomers, are also found in the Hepatocyte nuclear factor (HNF) proteins, which provide tissue-specific gene regulation. The structure contains 2 flexible loops or "wings" in the C-terminal region, hence the term winged helix.


Pssm-ID: 238016  Cd Length: 78  Bit Score: 130.37  E-value: 3.83e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5348336  230 WGNLSYADLITKAIESSPEKRLTLSQIYEWMVKSVPYFKDKgdsnsSAGWKNSIRHNLSLHSKFIRVQNE--GTGKSSWW 307
Cdd:cd00059   1 KPPYSYSALIAMAIQSSPEKRLTLSEIYKWISDNFPYFRDA-----PAGWQNSIRHNLSLNKCFVKVPREpdEPGKGSYW 75

                ...
gi 5348336  308 MLN 310
Cdd:cd00059  76 TLD 78
FH smart00339
FORKHEAD; FORKHEAD, also known as a "winged helix"
230-312 3.29e-34

FORKHEAD; FORKHEAD, also known as a "winged helix"


Pssm-ID: 214627 [Multi-domain]  Cd Length: 89  Bit Score: 125.04  E-value: 3.29e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5348336     230 WGNLSYADLITKAIESSPEKRLTLSQIYEWMVKSVPYFKDKGDsnssaGWKNSIRHNLSLHSKFIRVQNEGT--GKSSWW 307
Cdd:smart00339   1 KPPYSYIALIAMAILSSPDKRLTLSEIYKWIEDNFPYYRENRA-----GWQNSIRHNLSLNDCFVKVPREGDrpGKGSYW 75

                   ....*
gi 5348336     308 MLNPE 312
Cdd:smart00339  76 TLDPA 80
Forkhead pfam00250
Forkhead domain;
232-313 3.86e-31

Forkhead domain;


Pssm-ID: 333958  Cd Length: 86  Bit Score: 116.43  E-value: 3.86e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5348336    232 NLSYADLITKAIESSPEKRLTLSQIYEWMVKSVPYFKdkgdsNSSAGWKNSIRHNLSLHSKFIRV---QNEGtGKSSWWM 308
Cdd:pfam00250   3 PYSYAALIAMAILSSPEKKLTLSEIYEWIKENFPYYR-----TADSGWQNSIRHNLSLNKCFKKVprsKEEP-GKGSYWT 76

                  ....*
gi 5348336    309 LNPEG 313
Cdd:pfam00250  77 IDPEC 81
FOXO_KIX_bdg pfam16675
KIX-binding domain of forkhead box O, CR2; FOXO_KIX_bd is the first part of the region of ...
493-570 1.11e-27

KIX-binding domain of forkhead box O, CR2; FOXO_KIX_bd is the first part of the region of transcription factor forkhead box O family proteins that binds to the CREB-binding proteins via the KIX domain. Coactivator CBP/p300 is recruited by FOXO3 via the binding of this domain as well as the simultaneous binding of the more C-terminal TAD domain.


Pssm-ID: 318810  Cd Length: 78  Bit Score: 106.34  E-value: 1.11e-27
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 5348336    493 KFTYAQASMNSLPQIPMQTLQDSK-SSYGSMSQFNcPAGLLKELLTSDSPPHNDILASVDTGVSQAGGRALGQGVLMVT 570
Cdd:pfam16675   1 KYIYGQPSMNSLRQMPMQTIQENKqASFSSMSQYG-NAGLLQELLTSDSYPHKDILTQVDTLVSQASSRVLSQNHRMNT 78
FOXO-TAD pfam16676
Transactivation domain of FOXO protein family; TAD is a promiscuous binding domain that ...
669-707 3.70e-18

Transactivation domain of FOXO protein family; TAD is a promiscuous binding domain that mediates the association of the transcription factor FOXO with the coactivator CBP/p300. Both this domain and the FOXO-KIX_bd family pfam16675 bind simultaneously the KIX domain of CBP/p300. Coactivator CBP/p300 is recruited by FOXO3 though binding to these two regions. The promiscuity of the TAD is further evidenced by that the finding that they also bind the TAZ1 and TAZ2 domains of CBP/p300.


Pssm-ID: 318811  Cd Length: 40  Bit Score: 78.09  E-value: 3.70e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 5348336    669 KLPSDLD-DMLIERLDCDMESIIRNDLMDGETLDFNFDSV 707
Cdd:pfam16676   1 RLPSDLDlDMFIGSLDCDVDSIIRNDLMDGDGLDFNFDSS 40
COG5025 COG5025
Transcription factor of the Forkhead/HNF3 family [Transcription];
222-337 1.44e-13

Transcription factor of the Forkhead/HNF3 family [Transcription];


Pssm-ID: 227358 [Multi-domain]  Cd Length: 610  Bit Score: 73.69  E-value: 1.44e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5348336  222 SSSSRRNAWGNLSYADLITKAIESSPEKRLTLSQIYEWMVKSVPYFKDKGDsnssaGWKNSIRHNLSLHSKFIRVQNE-- 299
Cdd:COG5025 329 SADVNRTSKPAFSYANSITQAILSSPSGKMTLSEIYSWISSNLPYYRHKPT-----AWQNSIRHNLSLNKSFEKVPRSas 403
                        90       100       110
                ....*....|....*....|....*....|....*...
gi 5348336  300 GTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSR 337
Cdd:COG5025 404 QPGKGCFWKIDYSYIYEKESKRNPRSPKKSPSAHSVHQ 441
 
Name Accession Description Interval E-value
FH cd00059
Forkhead (FH), also known as a "winged helix". FH is named for the Drosophila fork head ...
230-310 3.83e-36

Forkhead (FH), also known as a "winged helix". FH is named for the Drosophila fork head protein, a transcription factor which promotes terminal rather than segmental development. This family of transcription factor domains, which bind to B-DNA as monomers, are also found in the Hepatocyte nuclear factor (HNF) proteins, which provide tissue-specific gene regulation. The structure contains 2 flexible loops or "wings" in the C-terminal region, hence the term winged helix.


Pssm-ID: 238016  Cd Length: 78  Bit Score: 130.37  E-value: 3.83e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5348336  230 WGNLSYADLITKAIESSPEKRLTLSQIYEWMVKSVPYFKDKgdsnsSAGWKNSIRHNLSLHSKFIRVQNE--GTGKSSWW 307
Cdd:cd00059   1 KPPYSYSALIAMAIQSSPEKRLTLSEIYKWISDNFPYFRDA-----PAGWQNSIRHNLSLNKCFVKVPREpdEPGKGSYW 75

                ...
gi 5348336  308 MLN 310
Cdd:cd00059  76 TLD 78
FH smart00339
FORKHEAD; FORKHEAD, also known as a "winged helix"
230-312 3.29e-34

FORKHEAD; FORKHEAD, also known as a "winged helix"


Pssm-ID: 214627 [Multi-domain]  Cd Length: 89  Bit Score: 125.04  E-value: 3.29e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5348336     230 WGNLSYADLITKAIESSPEKRLTLSQIYEWMVKSVPYFKDKGDsnssaGWKNSIRHNLSLHSKFIRVQNEGT--GKSSWW 307
Cdd:smart00339   1 KPPYSYIALIAMAILSSPDKRLTLSEIYKWIEDNFPYYRENRA-----GWQNSIRHNLSLNDCFVKVPREGDrpGKGSYW 75

                   ....*
gi 5348336     308 MLNPE 312
Cdd:smart00339  76 TLDPA 80
Forkhead pfam00250
Forkhead domain;
232-313 3.86e-31

Forkhead domain;


Pssm-ID: 333958  Cd Length: 86  Bit Score: 116.43  E-value: 3.86e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5348336    232 NLSYADLITKAIESSPEKRLTLSQIYEWMVKSVPYFKdkgdsNSSAGWKNSIRHNLSLHSKFIRV---QNEGtGKSSWWM 308
Cdd:pfam00250   3 PYSYAALIAMAILSSPEKKLTLSEIYEWIKENFPYYR-----TADSGWQNSIRHNLSLNKCFKKVprsKEEP-GKGSYWT 76

                  ....*
gi 5348336    309 LNPEG 313
Cdd:pfam00250  77 IDPEC 81
FOXO_KIX_bdg pfam16675
KIX-binding domain of forkhead box O, CR2; FOXO_KIX_bd is the first part of the region of ...
493-570 1.11e-27

KIX-binding domain of forkhead box O, CR2; FOXO_KIX_bd is the first part of the region of transcription factor forkhead box O family proteins that binds to the CREB-binding proteins via the KIX domain. Coactivator CBP/p300 is recruited by FOXO3 via the binding of this domain as well as the simultaneous binding of the more C-terminal TAD domain.


Pssm-ID: 318810  Cd Length: 78  Bit Score: 106.34  E-value: 1.11e-27
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 5348336    493 KFTYAQASMNSLPQIPMQTLQDSK-SSYGSMSQFNcPAGLLKELLTSDSPPHNDILASVDTGVSQAGGRALGQGVLMVT 570
Cdd:pfam16675   1 KYIYGQPSMNSLRQMPMQTIQENKqASFSSMSQYG-NAGLLQELLTSDSYPHKDILTQVDTLVSQASSRVLSQNHRMNT 78
FOXO-TAD pfam16676
Transactivation domain of FOXO protein family; TAD is a promiscuous binding domain that ...
669-707 3.70e-18

Transactivation domain of FOXO protein family; TAD is a promiscuous binding domain that mediates the association of the transcription factor FOXO with the coactivator CBP/p300. Both this domain and the FOXO-KIX_bd family pfam16675 bind simultaneously the KIX domain of CBP/p300. Coactivator CBP/p300 is recruited by FOXO3 though binding to these two regions. The promiscuity of the TAD is further evidenced by that the finding that they also bind the TAZ1 and TAZ2 domains of CBP/p300.


Pssm-ID: 318811  Cd Length: 40  Bit Score: 78.09  E-value: 3.70e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 5348336    669 KLPSDLD-DMLIERLDCDMESIIRNDLMDGETLDFNFDSV 707
Cdd:pfam16676   1 RLPSDLDlDMFIGSLDCDVDSIIRNDLMDGDGLDFNFDSS 40
COG5025 COG5025
Transcription factor of the Forkhead/HNF3 family [Transcription];
222-337 1.44e-13

Transcription factor of the Forkhead/HNF3 family [Transcription];


Pssm-ID: 227358 [Multi-domain]  Cd Length: 610  Bit Score: 73.69  E-value: 1.44e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5348336  222 SSSSRRNAWGNLSYADLITKAIESSPEKRLTLSQIYEWMVKSVPYFKDKGDsnssaGWKNSIRHNLSLHSKFIRVQNE-- 299
Cdd:COG5025 329 SADVNRTSKPAFSYANSITQAILSSPSGKMTLSEIYSWISSNLPYYRHKPT-----AWQNSIRHNLSLNKSFEKVPRSas 403
                        90       100       110
                ....*....|....*....|....*....|....*...
gi 5348336  300 GTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSR 337
Cdd:COG5025 404 QPGKGCFWKIDYSYIYEKESKRNPRSPKKSPSAHSVHQ 441
COG5025 COG5025
Transcription factor of the Forkhead/HNF3 family [Transcription];
233-296 6.50e-07

Transcription factor of the Forkhead/HNF3 family [Transcription];


Pssm-ID: 227358 [Multi-domain]  Cd Length: 610  Bit Score: 52.50  E-value: 6.50e-07
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 5348336  233 LSYADLITKAIESSPEKRLTLSQIYEWMVKSVPYFKdkgdsNSSAGWKNSIRHNLSLHSKFIRV 296
Cdd:COG5025  89 YSYATGRGLAILNSPDKPLTLSKIYTWIHNTFFYYA-----KVVSRWQNSIRHNLSLNDAFIKI 147
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH