NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|3056600|gb|AAC13911|]
View 

T1F9.21 [Arabidopsis thaliana]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
NB-ARC pfam00931
NB-ARC domain;
45-329 1.59e-133

NB-ARC domain;


:

Pssm-ID: 307194  Cd Length: 287  Bit Score: 396.76  E-value: 1.59e-133
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600     45 QEEMLEKAWNRLME--DRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFDIVIWIVVSKGAKLSKLQEDIAEKLHLCDD 122
Cdd:pfam00931   1 RETMVEKVIGKLSE*nDELGIVGIHGMGGVGKTTLAAQIFNDDSLVGGHFDSVAWVVVSKTFTIEDLQQDILKRLGLEDS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600    123 LWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGVPYPSEVNKCKVAFTTRDQKVCGEMGD-HKPMQVKCLEPE 201
Cdd:pfam00931  81 DWVEKNEGELADKIRRLLLRKRFLLVLDDVWDEEDWDKIGVPFPDRENGSRVLLTTRSESVANRVGGtSYPHEVELLEPD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600    202 DAWELFKNKVGDNTLRSDPVIVELAREVAQKCRGLPLALSVIGETMASKTMVQEWEHAIDVLTRSAAEFSNMGNKILPIL 281
Cdd:pfam00931 161 EAWELFENKVFEKELETCPDLEDVAKEIVEKCRGLPLALKVIGGLLATKSTVQEWEHVADQLNNKLAESRGYLNEVLSIL 240
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*...
gi 3056600    282 KYSYDSLGDeHIKSCFLYCALFPEDDEIYNEKLIDYWICEGFIGEDQV 329
Cdd:pfam00931 241 SLSYDNLPS-CLKRCFLYLSLFPEDKEIPVKRLVKLWVAEGFVIPSDG 287
LRR_8 pfam13855
Leucine rich repeat;
423-482 1.90e-08

Leucine rich repeat;


:

Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 50.98  E-value: 1.90e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 3056600    423 ELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSYN--RDFNklPEQISGLVSLQFLDLSNTSI 482
Cdd:pfam13855   1 NLRSLDLSNNRLTVLDDGAFKGLSNLKVLDLSNNllTTLS--PGAFSGLPSLRYLDLSGNRL 60
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
402-631 4.91e-06

Leucine-rich repeat (LRR) protein [Transcription];


:

Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 49.20  E-value: 4.91e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600  402 VRRMSLMDNHIEEITCESK--CSELTTLFLQSNQLKNLSGEfIRYMQKLVVLDLSYNR---------------------- 457
Cdd:COG4886 118 LTSLDLDNNNITDIPPLIGllKSNLKELDLSDNKIESLPSP-LRNLPNLKNLDLSFNDlsdlpkllsnlsnlnnldlsgn 196
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600  458 DFNKLPEQISGLVSLQFLDLSNTSIKQLPVGLKKLKKLTFLNLAYTVRLCSISGIsrllslrllrllgskvhgdaSVLKE 537
Cdd:COG4886 197 KISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESI--------------------GNLSN 256
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600  538 LQKLQNLQHLAITLSAELSLnQRLANLISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIkcrESETASSYLRIN 617
Cdd:COG4886 257 LETLDLSNNQISSISSLGSL-TNLRELDLSGNSLSNALPLIALLLLLLELLLNLLLTLKALELKL---NSILLNNNILSN 332
                       250
                ....*....|....
gi 3056600  618 PKIPCFTNLSRLGL 631
Cdd:COG4886 333 GETSSPEALSILES 346
 
Name Accession Description Interval E-value
NB-ARC pfam00931
NB-ARC domain;
45-329 1.59e-133

NB-ARC domain;


Pssm-ID: 307194  Cd Length: 287  Bit Score: 396.76  E-value: 1.59e-133
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600     45 QEEMLEKAWNRLME--DRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFDIVIWIVVSKGAKLSKLQEDIAEKLHLCDD 122
Cdd:pfam00931   1 RETMVEKVIGKLSE*nDELGIVGIHGMGGVGKTTLAAQIFNDDSLVGGHFDSVAWVVVSKTFTIEDLQQDILKRLGLEDS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600    123 LWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGVPYPSEVNKCKVAFTTRDQKVCGEMGD-HKPMQVKCLEPE 201
Cdd:pfam00931  81 DWVEKNEGELADKIRRLLLRKRFLLVLDDVWDEEDWDKIGVPFPDRENGSRVLLTTRSESVANRVGGtSYPHEVELLEPD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600    202 DAWELFKNKVGDNTLRSDPVIVELAREVAQKCRGLPLALSVIGETMASKTMVQEWEHAIDVLTRSAAEFSNMGNKILPIL 281
Cdd:pfam00931 161 EAWELFENKVFEKELETCPDLEDVAKEIVEKCRGLPLALKVIGGLLATKSTVQEWEHVADQLNNKLAESRGYLNEVLSIL 240
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*...
gi 3056600    282 KYSYDSLGDeHIKSCFLYCALFPEDDEIYNEKLIDYWICEGFIGEDQV 329
Cdd:pfam00931 241 SLSYDNLPS-CLKRCFLYLSLFPEDKEIPVKRLVKLWVAEGFVIPSDG 287
LRR_8 pfam13855
Leucine rich repeat;
423-482 1.90e-08

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 50.98  E-value: 1.90e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 3056600    423 ELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSYN--RDFNklPEQISGLVSLQFLDLSNTSI 482
Cdd:pfam13855   1 NLRSLDLSNNRLTVLDDGAFKGLSNLKVLDLSNNllTTLS--PGAFSGLPSLRYLDLSGNRL 60
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
402-631 4.91e-06

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 49.20  E-value: 4.91e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600  402 VRRMSLMDNHIEEITCESK--CSELTTLFLQSNQLKNLSGEfIRYMQKLVVLDLSYNR---------------------- 457
Cdd:COG4886 118 LTSLDLDNNNITDIPPLIGllKSNLKELDLSDNKIESLPSP-LRNLPNLKNLDLSFNDlsdlpkllsnlsnlnnldlsgn 196
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600  458 DFNKLPEQISGLVSLQFLDLSNTSIKQLPVGLKKLKKLTFLNLAYTVRLCSISGIsrllslrllrllgskvhgdaSVLKE 537
Cdd:COG4886 197 KISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESI--------------------GNLSN 256
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600  538 LQKLQNLQHLAITLSAELSLnQRLANLISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIkcrESETASSYLRIN 617
Cdd:COG4886 257 LETLDLSNNQISSISSLGSL-TNLRELDLSGNSLSNALPLIALLLLLLELLLNLLLTLKALELKL---NSILLNNNILSN 332
                       250
                ....*....|....
gi 3056600  618 PKIPCFTNLSRLGL 631
Cdd:COG4886 333 GETSSPEALSILES 346
PLN03150 PLN03150
hypothetical protein; Provisional
429-512 1.41e-04

hypothetical protein; Provisional


Pssm-ID: 178695 [Multi-domain]  Cd Length: 623  Bit Score: 45.19  E-value: 1.41e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600   429 LQSNQLKNLSGEFIR--------YMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIK-QLP--VGLKKLKKLTF 497
Cdd:PLN03150 441 LRHLQSINLSGNSIRgnippslgSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSgRVPaaLGGRLLHRASF 520
                         90
                 ....*....|....*
gi 3056600   498 lNLAYTVRLCSISGI 512
Cdd:PLN03150 521 -NFTDNAGLCGIPGL 534
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
43-152 7.03e-03

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707 [Multi-domain]  Cd Length: 151  Bit Score: 37.51  E-value: 7.03e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600   43 IGQEEMLEKAWNRLMEDRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFdiviwIVVSKGAKLSKLQEDIAEKLHlcdd 122
Cdd:cd00009   1 VGQEEAIEALREALELPPPKNLLLYGPPGTGKTTLARAIANELFRPGAPF-----LYLNASDLLEGLVVAELFGHF---- 71
                        90       100       110
                ....*....|....*....|....*....|
gi 3056600  123 LWKNKNEsdkatdihRVLKGKRFVLMLDDI 152
Cdd:cd00009  72 LVRLLFE--------LAEKAKPGVLFIDEI 93
 
Name Accession Description Interval E-value
NB-ARC pfam00931
NB-ARC domain;
45-329 1.59e-133

NB-ARC domain;


Pssm-ID: 307194  Cd Length: 287  Bit Score: 396.76  E-value: 1.59e-133
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600     45 QEEMLEKAWNRLME--DRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFDIVIWIVVSKGAKLSKLQEDIAEKLHLCDD 122
Cdd:pfam00931   1 RETMVEKVIGKLSE*nDELGIVGIHGMGGVGKTTLAAQIFNDDSLVGGHFDSVAWVVVSKTFTIEDLQQDILKRLGLEDS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600    123 LWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGVPYPSEVNKCKVAFTTRDQKVCGEMGD-HKPMQVKCLEPE 201
Cdd:pfam00931  81 DWVEKNEGELADKIRRLLLRKRFLLVLDDVWDEEDWDKIGVPFPDRENGSRVLLTTRSESVANRVGGtSYPHEVELLEPD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600    202 DAWELFKNKVGDNTLRSDPVIVELAREVAQKCRGLPLALSVIGETMASKTMVQEWEHAIDVLTRSAAEFSNMGNKILPIL 281
Cdd:pfam00931 161 EAWELFENKVFEKELETCPDLEDVAKEIVEKCRGLPLALKVIGGLLATKSTVQEWEHVADQLNNKLAESRGYLNEVLSIL 240
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*...
gi 3056600    282 KYSYDSLGDeHIKSCFLYCALFPEDDEIYNEKLIDYWICEGFIGEDQV 329
Cdd:pfam00931 241 SLSYDNLPS-CLKRCFLYLSLFPEDKEIPVKRLVKLWVAEGFVIPSDG 287
LRR_8 pfam13855
Leucine rich repeat;
423-482 1.90e-08

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 50.98  E-value: 1.90e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 3056600    423 ELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSYN--RDFNklPEQISGLVSLQFLDLSNTSI 482
Cdd:pfam13855   1 NLRSLDLSNNRLTVLDDGAFKGLSNLKVLDLSNNllTTLS--PGAFSGLPSLRYLDLSGNRL 60
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
402-631 4.91e-06

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 49.20  E-value: 4.91e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600  402 VRRMSLMDNHIEEITCESK--CSELTTLFLQSNQLKNLSGEfIRYMQKLVVLDLSYNR---------------------- 457
Cdd:COG4886 118 LTSLDLDNNNITDIPPLIGllKSNLKELDLSDNKIESLPSP-LRNLPNLKNLDLSFNDlsdlpkllsnlsnlnnldlsgn 196
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600  458 DFNKLPEQISGLVSLQFLDLSNTSIKQLPVGLKKLKKLTFLNLAYTVRLCSISGIsrllslrllrllgskvhgdaSVLKE 537
Cdd:COG4886 197 KISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESI--------------------GNLSN 256
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600  538 LQKLQNLQHLAITLSAELSLnQRLANLISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIkcrESETASSYLRIN 617
Cdd:COG4886 257 LETLDLSNNQISSISSLGSL-TNLRELDLSGNSLSNALPLIALLLLLLELLLNLLLTLKALELKL---NSILLNNNILSN 332
                       250
                ....*....|....
gi 3056600  618 PKIPCFTNLSRLGL 631
Cdd:COG4886 333 GETSSPEALSILES 346
PLN03150 PLN03150
hypothetical protein; Provisional
429-512 1.41e-04

hypothetical protein; Provisional


Pssm-ID: 178695 [Multi-domain]  Cd Length: 623  Bit Score: 45.19  E-value: 1.41e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600   429 LQSNQLKNLSGEFIR--------YMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIK-QLP--VGLKKLKKLTF 497
Cdd:PLN03150 441 LRHLQSINLSGNSIRgnippslgSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSgRVPaaLGGRLLHRASF 520
                         90
                 ....*....|....*
gi 3056600   498 lNLAYTVRLCSISGI 512
Cdd:PLN03150 521 -NFTDNAGLCGIPGL 534
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
43-152 7.03e-03

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707 [Multi-domain]  Cd Length: 151  Bit Score: 37.51  E-value: 7.03e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3056600   43 IGQEEMLEKAWNRLMEDRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFdiviwIVVSKGAKLSKLQEDIAEKLHlcdd 122
Cdd:cd00009   1 VGQEEAIEALREALELPPPKNLLLYGPPGTGKTTLARAIANELFRPGAPF-----LYLNASDLLEGLVVAELFGHF---- 71
                        90       100       110
                ....*....|....*....|....*....|
gi 3056600  123 LWKNKNEsdkatdihRVLKGKRFVLMLDDI 152
Cdd:cd00009  72 LVRLLFE--------LAEKAKPGVLFIDEI 93
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH