NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1870544|gb|AAB48871|]
View 

T-cell receptor beta, partial [Saguinus oedipus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ig super family cl11960
Immunoglobulin domain; Immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
2-99 6.02e-33

Immunoglobulin domain; Immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


The actual alignment was detected with superfamily member cd05899:

Pssm-ID: 353325  Cd Length: 110  Bit Score: 110.07  E-value: 6.02e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544    2 GQRVALRCSPRSGDLSVYWYRQRLDQSLQLLIQYYNGNEGEK-GNIPERFSGQQFPNMSSELNLSSLELGDSALYFCASS 80
Cdd:cd05899  13 GQSVTLRCSQTSGHDNMYWYRQDPGKGLQLLFYSNGGSLNEEeGDPKDRFSASRPSLTRSSLTIKSAEPEDSAVYLCASS 92
                        90
                ....*....|....*....
gi 1870544   81 iDRGNTAQLVFGEGSRLTV 99
Cdd:cd05899  93 -LGGGADEAYFGPGTRLTV 110
 
Name Accession Description Interval E-value
IgV_TCR_beta cd05899
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain; IgV_TCR_beta: ...
2-99 6.02e-33

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain; IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 143307  Cd Length: 110  Bit Score: 110.07  E-value: 6.02e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544    2 GQRVALRCSPRSGDLSVYWYRQRLDQSLQLLIQYYNGNEGEK-GNIPERFSGQQFPNMSSELNLSSLELGDSALYFCASS 80
Cdd:cd05899  13 GQSVTLRCSQTSGHDNMYWYRQDPGKGLQLLFYSNGGSLNEEeGDPKDRFSASRPSLTRSSLTIKSAEPEDSAVYLCASS 92
                        90
                ....*....|....*....
gi 1870544   81 iDRGNTAQLVFGEGSRLTV 99
Cdd:cd05899  93 -LGGGADEAYFGPGTRLTV 110
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
2-100 1.39e-18

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 336766  Cd Length: 109  Bit Score: 73.65  E-value: 1.39e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544      2 GQRVALRC----SPRSGDLSVYWYRQRLDQSLQLLIQYYNgNEGEKGNIPERFSGQQFPNMSS-ELNLSSLELGDSALYF 76
Cdd:pfam07686  11 GGSVTLPCtyssSMSEGSTSVYWYRQPPGKGPEELIAYYS-NKSPEGKKKGRFSLRGDPSNSDfSLTIQNLTPSDSGTYF 89
                          90       100
                  ....*....|....*....|....
gi 1870544     77 CASsidrGNTAQLVFGEGSRLTVL 100
Cdd:pfam07686  90 CAV----GPNGEGVFGKGTRLTVL 109
IG smart00409
Immunoglobulin;
2-99 1.71e-07

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 44.80  E-value: 1.71e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544       2 GQRVALRCSPRS-GDLSVYWYRQRLdqslQLLIQyyngnegekgniPERFSGQQFPNMSSeLNLSSLELGDSALYFCASS 80
Cdd:smart00409   9 GESVTLSCEASGsPPPEVTWYKQGG----KLLAE------------SGRFSVSRSGSTST-LTISNVTPEDSGTYTCAAT 71
                           90
                   ....*....|....*....
gi 1870544      81 IDRGNTAQlvfgeGSRLTV 99
Cdd:smart00409  72 NSSGSASS-----GTTLTV 85
 
Name Accession Description Interval E-value
IgV_TCR_beta cd05899
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain; IgV_TCR_beta: ...
2-99 6.02e-33

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain; IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 143307  Cd Length: 110  Bit Score: 110.07  E-value: 6.02e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544    2 GQRVALRCSPRSGDLSVYWYRQRLDQSLQLLIQYYNGNEGEK-GNIPERFSGQQFPNMSSELNLSSLELGDSALYFCASS 80
Cdd:cd05899  13 GQSVTLRCSQTSGHDNMYWYRQDPGKGLQLLFYSNGGSLNEEeGDPKDRFSASRPSLTRSSLTIKSAEPEDSAVYLCASS 92
                        90
                ....*....|....*....
gi 1870544   81 iDRGNTAQLVFGEGSRLTV 99
Cdd:cd05899  93 -LGGGADEAYFGPGTRLTV 110
IgV cd00099
Immunoglobulin variable domain (IgV); IgV: Immunoglobulin variable domain (IgV). Members of ...
2-99 2.28e-23

Immunoglobulin variable domain (IgV); IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 319275  Cd Length: 103  Bit Score: 85.91  E-value: 2.28e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544    2 GQRVALRCSPRS--GDLSVYWYRQRLDQSLQLLIQYYNGnegEKGNIPERFSGQQFP-NMSSELNLSSLELGDSALYFCA 78
Cdd:cd00099   6 GESVTLNCVLSGsfSLYSISWYRQKPGKQPQFLISGSST---GKPGIPGRFSGTRNGgSSSFSLTISNLRPEDSGTYYCA 82
                        90       100
                ....*....|....*....|.
gi 1870544   79 SSIDRGNTAQLVFGEGSRLTV 99
Cdd:cd00099  83 VSEGPGGGDKLVFGAGTRLTV 103
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
2-100 1.39e-18

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 336766  Cd Length: 109  Bit Score: 73.65  E-value: 1.39e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544      2 GQRVALRC----SPRSGDLSVYWYRQRLDQSLQLLIQYYNgNEGEKGNIPERFSGQQFPNMSS-ELNLSSLELGDSALYF 76
Cdd:pfam07686  11 GGSVTLPCtyssSMSEGSTSVYWYRQPPGKGPEELIAYYS-NKSPEGKKKGRFSLRGDPSNSDfSLTIQNLTPSDSGTYF 89
                          90       100
                  ....*....|....*....|....
gi 1870544     77 CASsidrGNTAQLVFGEGSRLTVL 100
Cdd:pfam07686  90 CAV----GPNGEGVFGKGTRLTVL 109
IgV_TCR_alpha cd04983
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar ...
2-99 9.06e-18

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins; IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 319287  Cd Length: 109  Bit Score: 71.53  E-value: 9.06e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544    2 GQRVALRCS-PRSGDLSVYWYRQRLDQSLQLLIQYY-NGNEGEKGnipeRFSGQ-QFPNMSSELNLSSLELGDSALYFCA 78
Cdd:cd04983  13 GENVTLNCNySTSTFPYLFWYRQYPGQGPEFLLYISsNGEEKEKG----RFSATlDKSRKSSSLHITAAQLSDSAVYYCA 88
                        90       100
                ....*....|....*....|.
gi 1870544   79 SSiDRGNTAQLVFGEGSRLTV 99
Cdd:cd04983  89 LS-ESSGTGKLTFGQGTRLTV 108
IgV_L_lambda cd04984
Immunoglobulin (Ig) lambda light chain variable (V) domain; IgV_L_lambda: Immunoglobulin (Ig) ...
2-99 4.39e-17

Immunoglobulin (Ig) lambda light chain variable (V) domain; IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.


Pssm-ID: 143185  Cd Length: 98  Bit Score: 69.78  E-value: 4.39e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544    2 GQRVALRCSPRSGDLS---VYWYRQRLDQSLQLLIqYYNGNEGEkgNIPERFSGQQFPNMSSeLNLSSLELGDSALYFCA 78
Cdd:cd04984   6 GETVTITCTGSSGNISgnyVNWYQQKPGSAPRYLI-YEDSDRPS--GIPDRFSGSKSGNTAS-LTISGAQTEDEADYYCQ 81
                        90       100
                ....*....|....*....|.
gi 1870544   79 SsidrGNTAQLVFGEGSRLTV 99
Cdd:cd04984  82 V----WDSNSYVFGGGTKLTV 98
IgV_TCR_delta cd07706
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain; IgV_TCR_delta: ...
2-99 3.94e-15

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain; IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains. Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is located at the N-terminus of the receptor.


Pssm-ID: 319330  Cd Length: 112  Bit Score: 65.21  E-value: 3.94e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544    2 GQRVALRCSPRSGDLSVY--WYRQRLDQSLQLLI-QYYNGNEGEKGnipeRFSGQ-QFPNMSSELNLSSLELGDSALYFC 77
Cdd:cd07706  14 GEEVTLNCRYETSWTNYYlfWYKQLPSGEMTFLIrQDSSRSNATSG----RYSVNfQKAQKSISLTISALQLEDSAKYFC 89
                        90       100
                ....*....|....*....|..
gi 1870544   78 ASSiDRGNTAQLVFGEGSRLTV 99
Cdd:cd07706  90 ALS-LPYPTDKLIFGKGTRLTV 110
IgV_TCR_gamma cd04982
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain; IgV_TCR_gamma: ...
17-99 1.63e-11

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain; IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains. Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is located at the N-terminus of the receptor.


Pssm-ID: 143183  Cd Length: 116  Bit Score: 55.83  E-value: 1.63e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544   17 SVYWYRQRLDQSLQLLIqYYNGNEG---EKGNIPERFSGQQFPNMS-SELNLSSLELGDSALYFCASSIDRGNTAQLVFG 92
Cdd:cd04982  31 YIHWYRQKPGQALERLL-YVSSTSTqrkLSGGTKNKFEARKDVGKStSTLTIQNLEKEDSATYYCAYWESGSSYYIKVFG 109

                ....*..
gi 1870544   93 EGSRLTV 99
Cdd:cd04982 110 SGTKLIV 116
IgV_L_kappa cd04980
Immunoglobulin (Ig) light chain, kappa type, variable (V) domain; IgV_L_kappa: Immunoglobulin ...
2-99 1.15e-10

Immunoglobulin (Ig) light chain, kappa type, variable (V) domain; IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds.There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.


Pssm-ID: 143181  Cd Length: 106  Bit Score: 53.25  E-value: 1.15e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544    2 GQRVALRC--SPRSGDLSVYWYRQRLDQSLQLLIqyYNGNEGEKGnIPERFSGqQFPNMSSELNLSSLELGDSALYFCAS 79
Cdd:cd04980  15 GESATISCkaSQSVSSNYLAWYQQKPGQAPKLLI--YGASTLASG-TPSRFSG-SGSGTDFTLTISRVEPEDAAVYYCQQ 90
                        90       100
                ....*....|....*....|
gi 1870544   80 sidrGNTAQLVFGEGSRLTV 99
Cdd:cd04980  91 ----YGTFPYTFGGGTKLEI 106
IG smart00409
Immunoglobulin;
2-99 1.71e-07

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 44.80  E-value: 1.71e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544       2 GQRVALRCSPRS-GDLSVYWYRQRLdqslQLLIQyyngnegekgniPERFSGQQFPNMSSeLNLSSLELGDSALYFCASS 80
Cdd:smart00409   9 GESVTLSCEASGsPPPEVTWYKQGG----KLLAE------------SGRFSVSRSGSTST-LTISNVTPEDSGTYTCAAT 71
                           90
                   ....*....|....*....
gi 1870544      81 IDRGNTAQlvfgeGSRLTV 99
Cdd:smart00409  72 NSSGSASS-----GTTLTV 85
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
2-99 1.71e-07

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653  Cd Length: 85  Bit Score: 44.80  E-value: 1.71e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544       2 GQRVALRCSPRS-GDLSVYWYRQRLdqslQLLIQyyngnegekgniPERFSGQQFPNMSSeLNLSSLELGDSALYFCASS 80
Cdd:smart00410   9 GESVTLSCEASGsPPPEVTWYKQGG----KLLAE------------SGRFSVSRSGSTST-LTISNVTPEDSGTYTCAAT 71
                           90
                   ....*....|....*....
gi 1870544      81 IDRGNTAQlvfgeGSRLTV 99
Cdd:smart00410  72 NSSGSASS-----GTTLTV 85
IgV_CD8_beta cd07700
Immunoglobulin (Ig) like domain of CD8 beta chain; IgV_CD8_beta: immunoglobulin (Ig)-like ...
17-99 1.35e-06

Immunoglobulin (Ig) like domain of CD8 beta chain; IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.


Pssm-ID: 319326  Cd Length: 108  Bit Score: 42.81  E-value: 1.35e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544   17 SVYWYRQRL----DQSLQLLIqYYNGNEGE---KGNIPERFSGQQFPNMSSE-LNLSSLELGDSALYFCASSidrgNTAQ 88
Cdd:cd07700  23 RIYWLRQRQapskDSHFEFLA-SWSPSKGIvygEGVDQEKNIILSSSDSSRYiLSLMSVKPEDSGTYFCMTV----GSPE 97
                        90
                ....*....|.
gi 1870544   89 LVFGEGSRLTV 99
Cdd:cd07700  98 LIFGTGTKLSV 108
IGv smart00406
Immunoglobulin V-Type;
5-78 1.81e-06

Immunoglobulin V-Type;


Pssm-ID: 214650  Cd Length: 81  Bit Score: 41.98  E-value: 1.81e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544       5 VALRCS---PRSGDLSVYWYRQRLDQSLQLLIQYYNGNEGEKGN-IPERFSGQqfPNMSSE---LNLSSLELGDSALYFC 77
Cdd:smart00406   2 VTLSCKfsgSTFSSYYVSWVRQPPGKGLEWLGYIGSNGSSYYQEsYKGRFTIS--KDTSKNdvsLTISNLRVEDTGTYYC 79

                   .
gi 1870544      78 A 78
Cdd:smart00406  80 A 80
Ig_HHLA2 cd16091
Immunoglobulin (Ig) domain in HERV-H LTR-associating 2; HERV-H LTR-associating 2 (HHLA2) is a ...
7-90 6.19e-04

Immunoglobulin (Ig) domain in HERV-H LTR-associating 2; HERV-H LTR-associating 2 (HHLA2) is a protein ligand found on the surface of monocytes which is believed to regulate cell-mediated immunity by binding to a receptor on T lymphocytes and inhibiting the proliferation of these cells. Alternate splicing results in multiple transcript variants. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 319340  Cd Length: 91  Bit Score: 35.76  E-value: 6.19e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544    7 LRCSPRSG-DLSVYWYRQRLDQSLQllIQYYNGNEGEKGNipERFSG------QQFPNMSSELNLSSLELGDSALYFCAS 79
Cdd:cd16091   3 LPCSFTPGgEEVIHWYKLNSDIPVH--SYYYNKDQLEHQD--QRYRGrtslfkDQISKGNASLLLKNVKVQDEGRYKCYT 78
                        90
                ....*....|.
gi 1870544   80 SIDRGNTAQLV 90
Cdd:cd16091  79 STIKGNQESFV 89
IgV_H_TCR_mu cd16095
T-cell receptor Mu, Heavy chain, variable (V) domain; IgV_H: Immunoglobulin (Ig) heavy chain ...
62-99 2.37e-03

T-cell receptor Mu, Heavy chain, variable (V) domain; IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain in mu. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.


Pssm-ID: 319344  Cd Length: 112  Bit Score: 34.45  E-value: 2.37e-03
                        10        20        30
                ....*....|....*....|....*....|....*....
gi 1870544   62 LNLSSLELGDSALYFCASSIDRGN-TAQLVFGEGSRLTV 99
Cdd:cd16095  73 LQIKGLGLRDSGQYHCARRVGYGDdTDKLIFGPGTDVIV 111
Ig_Semaphorin_C cd04979
Immunoglobulin (Ig)-like domain of semaphorin; Ig_Semaphorin_C; Immunoglobulin (Ig)-like ...
2-101 2.52e-03

Immunoglobulin (Ig)-like domain of semaphorin; Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may be involved in ligand binding or dimerization.


Pssm-ID: 319285  Cd Length: 91  Bit Score: 33.97  E-value: 2.52e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1870544    2 GQRVALRCSPRSGDLSVYWYRQrldqslqlliqyyNGNEGEKGnipERFSGQQFPNMSSELNLSSLELGDSALYFCASSI 81
Cdd:cd04979  11 GGSVVLPCSPKSNLARVVWYHN-------------NREVPREE---GRSPGLHLEVGRRGLLIVSVNPADSGVYLCQSEE 74
                        90       100
                ....*....|....*....|
gi 1870544   82 DRGNTAQLVFgegsRLTVLD 101
Cdd:cd04979  75 RGKPTLLFAV----TLTVLD 90
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH