NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|85097536|ref|XP_960461|]
View 

homogentisate 1,2-dioxygenase [Neurospora crassa OR74A]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
cupin_like super family cl21464
Conserved domain found in cupin and related proteins; A diverse protein domains superfamily ...
12-452 0e+00

Conserved domain found in cupin and related proteins; A diverse protein domains superfamily which includes both metal-dependent and metal-independent enzymes, as well as catalytically inactive seed storage proteins


The actual alignment was detected with superfamily member TIGR01015:

Pssm-ID: 304367  Cd Length: 429  Bit Score: 670.31  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536    12 YRYQNGFDSYLESEAVSGALPIGHNSPQKPPLGLYAEKLSGTAFTAPRHENKQSWLYRILPSCSHPPFVqatPRNGQEPV 91
Cdd:TIGR01015   2 LKYLSGFGNEFESERVPGALPVGQNSPQKCPYGLYAEQLSGSAFTAPRHENKRSWLYRIRPSAAHEPFE---PRDGNPGH 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536    92 LERSPARLHYIPNQLRWDPFDHESD--TDFVSGLRLVAGAGDPTLKQGLGMYIYAAGKSMSaQSAFYSADGDLLIVAQDG 169
Cdd:TIGR01015  79 VTANFDEQAPDPNQLRWSPFPIPSDeaVDFVDGLHTLCGAGDATSRTGLAIHIYLCNASME-NRAFYNADGDFLIVPQQG 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   170 VLDIRTEFGWLLVRPMEIAVIPRGVRYQVFLPsGPVRGYALELYQGHFQLPELGPIGSNGLANVRDFQAPVACFsEDhgs 249
Cdd:TIGR01015 158 ALLITTEFGRLLVEPNEICVIPRGVRFRVTVL-EPARGYICEVYGAHFQLPDLGPIGANGLANPRDFEAPVAAF-ED--- 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   250 iaLDGPNSYTITAKFNNTLFETKQPHTPFDVVAWHGNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLSAPSDHAGTAIAD 329
Cdd:TIGR01015 233 --REVPGPYTVINKFQGSLFAAKQDHSPFDVVAWHGNYVPYKYDLKRFNVINSVSFDHPDPSIFTVLTAPSDRPGTAIAD 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   330 FVIFPPRWLVGEDTFRPPWYHRNTMSEFMGLITGAYDAkkgGKGGFVPGGASLHNVMSGHGPDAASYEGARNADLKPQKV 409
Cdd:TIGR01015 311 FVIFPPRWLVAEKTFRPPYYHRNCMSEFMGLITGAYDA---KEGGFVPGGGSLHNMMTPHGPDFDCFEKASNAKLKPERI 387
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|...
gi 85097536   410 GEGSCAFMFESCLMVGVTDWGLeTCHKVQEDYNEHsWGGVKVH 452
Cdd:TIGR01015 388 ADGTMAFMFESSLSLAVTKWGA-TCQKLQEDYYKC-WQPLKRH 428
 
Name Accession Description Interval E-value
hmgA TIGR01015
homogentisate 1,2-dioxygenase; Missing in human disease alkaptonuria. [Energy metabolism, ...
12-452 0e+00

homogentisate 1,2-dioxygenase; Missing in human disease alkaptonuria. [Energy metabolism, Amino acids and amines]


Pssm-ID: 273395  Cd Length: 429  Bit Score: 670.31  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536    12 YRYQNGFDSYLESEAVSGALPIGHNSPQKPPLGLYAEKLSGTAFTAPRHENKQSWLYRILPSCSHPPFVqatPRNGQEPV 91
Cdd:TIGR01015   2 LKYLSGFGNEFESERVPGALPVGQNSPQKCPYGLYAEQLSGSAFTAPRHENKRSWLYRIRPSAAHEPFE---PRDGNPGH 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536    92 LERSPARLHYIPNQLRWDPFDHESD--TDFVSGLRLVAGAGDPTLKQGLGMYIYAAGKSMSaQSAFYSADGDLLIVAQDG 169
Cdd:TIGR01015  79 VTANFDEQAPDPNQLRWSPFPIPSDeaVDFVDGLHTLCGAGDATSRTGLAIHIYLCNASME-NRAFYNADGDFLIVPQQG 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   170 VLDIRTEFGWLLVRPMEIAVIPRGVRYQVFLPsGPVRGYALELYQGHFQLPELGPIGSNGLANVRDFQAPVACFsEDhgs 249
Cdd:TIGR01015 158 ALLITTEFGRLLVEPNEICVIPRGVRFRVTVL-EPARGYICEVYGAHFQLPDLGPIGANGLANPRDFEAPVAAF-ED--- 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   250 iaLDGPNSYTITAKFNNTLFETKQPHTPFDVVAWHGNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLSAPSDHAGTAIAD 329
Cdd:TIGR01015 233 --REVPGPYTVINKFQGSLFAAKQDHSPFDVVAWHGNYVPYKYDLKRFNVINSVSFDHPDPSIFTVLTAPSDRPGTAIAD 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   330 FVIFPPRWLVGEDTFRPPWYHRNTMSEFMGLITGAYDAkkgGKGGFVPGGASLHNVMSGHGPDAASYEGARNADLKPQKV 409
Cdd:TIGR01015 311 FVIFPPRWLVAEKTFRPPYYHRNCMSEFMGLITGAYDA---KEGGFVPGGGSLHNMMTPHGPDFDCFEKASNAKLKPERI 387
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|...
gi 85097536   410 GEGSCAFMFESCLMVGVTDWGLeTCHKVQEDYNEHsWGGVKVH 452
Cdd:TIGR01015 388 ADGTMAFMFESSLSLAVTKWGA-TCQKLQEDYYKC-WQPLKRH 428
HgmA pfam04209
homogentisate 1,2-dioxygenase; Homogentisate dioxygenase cleaves the aromatic ring during the ...
13-452 0e+00

homogentisate 1,2-dioxygenase; Homogentisate dioxygenase cleaves the aromatic ring during the metabolic degradation of Phe and Tyr. Homogentisate dioxygenase deficiency causes alkaptonuria. The structure of homogentisate dioxygenase shows that the enzyme forms a hexamer arrangement comprised of a dimer of trimers. The active site iron ion is coordinated near the interface between the trimers.


Pssm-ID: 282114  Cd Length: 424  Bit Score: 670.21  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536    13 RYQNGFDSYLESEAVSGALPIGHNSPQKPPLGLYAEKLSGTAFTAPRHENKQSWLYRILPSCSHPPFVQATPRNGQEPVL 92
Cdd:pfam04209   1 KYQSGFGNEFESEAVPGALPVGQNSPQKCPYGLYAEQLSGTAFTAPRHENQRSWLYRIRPSVAHEPFFPRDPEHLTAPFV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536    93 ErsparLHYIPNQLRWDPFDHESD--TDFVSGLRLVAGAGDPTLKQGLGMYIYAAGKSMSaQSAFYSADGDLLIVAQDGV 170
Cdd:pfam04209  81 G-----EHPDPNQLRWKPLPLPSQepTDFVEGLHTIAGAGDALVRTGLAIHIYLANKSME-NRAFYNADGDFLIVPQQGA 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   171 LDIRTEFGWLLVRPMEIAVIPRGVRYQVFLPSGPVRGYALELYQGHFQLPELGPIGSNGLANVRDFQAPVACFsEDHGSI 250
Cdd:pfam04209 155 LDITTEFGRLLVEPGEIAVIPRGVRFRVEVLDGPARGYICENYGAHFQLPDLGPIGANGLANPRDFLAPVAAF-EDKEVG 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   251 aldgpnSYTITAKFNNTLFETKQPHTPFDVVAWHGNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLSAPSDHAGTAIADF 330
Cdd:pfam04209 234 ------PYTVINKFQGKLFAAKQDHSPFDVVAWHGNYVPYKYDLSRFNVINTVSFDHPDPSIFTVLTAPSDEPGTANADF 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   331 VIFPPRWLVGEDTFRPPWYHRNTMSEFMGLITGAYDAkkgGKGGFVPGGASLHNVMSGHGPDAASYEGARNADLKPQKVG 410
Cdd:pfam04209 308 VIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYDA---KAEGFVPGGASLHNCMTPHGPDAESFEKASNADLKPHRID 384
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|..
gi 85097536   411 EgSCAFMFESCLMVGVTDWGLEtCHKVQEDYNEHsWGGVKVH 452
Cdd:pfam04209 385 D-TMAFMFESSLVLAVTEWALE-SPKLQDDYYKC-WQGLKRH 423
PRK05341 PRK05341
homogentisate 1,2-dioxygenase; Provisional
13-457 0e+00

homogentisate 1,2-dioxygenase; Provisional


Pssm-ID: 235421  Cd Length: 438  Bit Score: 643.85  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   13 RYQNGFDSYLESEAVSGALPIGHNSPQKPPLGLYAEKLSGTAFTAPRHENKQSWLYRILPSCSHPPFVQATPRNgqepvl 92
Cdd:PRK05341  13 GYQSGFGNEFATEALPGALPVGQNSPQRAPYGLYAEQLSGTAFTAPRAENRRSWLYRIRPSVVHGPFEPVDSRL------ 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   93 eRSPARLHYI-PNQLRWDPFDH-ESDTDFVSGLRLVAGAGDPTLKQGLGMYIYAAGKSMSaQSAFYSADGDLLIVAQDGV 170
Cdd:PRK05341  87 -WRTFDEVPTpPNQLRWDPLPLpAEPTDFVDGLVTMAGNGDAEAQAGMAIHLYAANRSMQ-DRYFYNADGELLIVPQQGR 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  171 LDIRTEFGWLLVRPMEIAVIPRGVRYQVFLPSGPVRGYALELYQGHFQLPELGPIGSNGLANVRDFQAPVACFsEDhgsi 250
Cdd:PRK05341 165 LRLATELGVLDVEPGEIAVIPRGVKFRVELPDGPARGYVCENYGAPFRLPDLGPIGANGLANPRDFLTPVAAF-ED---- 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  251 aLDGPnsYTITAKFNNTLFETKQPHTPFDVVAWHGNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLSAPSDHAGTAIADF 330
Cdd:PRK05341 240 -REGP--FELVAKFGGRLWRAEIDHSPLDVVAWHGNYAPYKYDLRRFNTIGSISFDHPDPSIFTVLTSPSDTPGTANIDF 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  331 VIFPPRWLVGEDTFRPPWYHRNTMSEFMGLITGAYDAkkgGKGGFVPGGASLHNVMSGHGPDAASYEGARNADLKPQKVg 410
Cdd:PRK05341 317 VIFPPRWLVAENTFRPPWFHRNVMSEFMGLIHGVYDA---KAEGFVPGGASLHNCMSPHGPDAETFEKASNADLKPHKI- 392
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*..
gi 85097536  411 EGSCAFMFESCLMVGVTDWGLETCHkVQEDYNEhSWGGVKVHWKGMP 457
Cdd:PRK05341 393 DNTMAFMFETRYPIRPTRFALETPQ-LQADYDD-CWQGLKKHFDPER 437
HmgA COG3508
Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport and catabolism];
13-448 3.56e-155

Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport and catabolism];


Pssm-ID: 226039  Cd Length: 427  Bit Score: 450.44  E-value: 3.56e-155
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  13 RYQNGFDSYLESEAVSGALPIGHNSPQKPPLGLYAEKLSGTAFTAPRHENKQSWLYRILPSCSHPPFvqatpRNGQEPVL 92
Cdd:COG3508   4 RYQSGFGNVFETEALPGALPVGQNSPQKAPYGLYAEQLSGSAFTAPRGENRRSWLYRIRPSANHPTF-----RPMKLGEW 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  93 ERSPARLHYIPNQLRWDPFD-HESDTDFVSGLRLVAGAGDPTLKQGLGMYIYAAGKSMSaQSAFYSADGDLLIVAQDGVL 171
Cdd:COG3508  79 KSALIGPWATPNQLRWSPLPlPKAPTDFLDGILLIANNGDADTQDGVAIHVYKVNESMT-KRFFRNADGELLIVPQQGEL 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536 172 DIRTEFGWLLVRPMEIAVIPRGVRYQVFLPSGPVRGYALELYQGHFQLPELGPIGSNGLANVRDFQAPVACFSEDHGSia 251
Cdd:COG3508 158 RLKTELGVLEVEPGEIAVIPRGTTFRVELKDGEARGYGCENYGAKFRLPELGPIGANGLANPRDFKTPVARYEDSEGP-- 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536 252 ldgpnsYTITAKFNNTLFETKQPHTPFDVVAWHGNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLSAPSDHAGTAIADFV 331
Cdd:COG3508 236 ------TQLVVKTHGGLWAVELDHSPLDVVAWHGNLAPYKYDLRDFNPIGTISYDHPDPSIFTVLTAPSDTPGFANCDFV 309
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536 332 IFPPRWLVGEDTFRPPWYHRNTMSEFMGLITGAYDAkkgGKGGFVPGGASLHNVMSGHGPDAASYEGARNADLKPQKVgE 411
Cdd:COG3508 310 IFPPRWLVAEQTFRPPWYHRNDMSEFMGLISGQYDA---KAEGFVPGGASLHNCMSAHGPDPSAFEKALNARLKPHKI-D 385
                       410       420       430
                ....*....|....*....|....*....|....*..
gi 85097536 412 GSCAFMFESCLMVGVTDWGLETcHKVQEDYNEhSWGG 448
Cdd:COG3508 386 DTMAFMFETRKVLRPSRYAAEI-DALQDDYDA-CWQG 420
 
Name Accession Description Interval E-value
hmgA TIGR01015
homogentisate 1,2-dioxygenase; Missing in human disease alkaptonuria. [Energy metabolism, ...
12-452 0e+00

homogentisate 1,2-dioxygenase; Missing in human disease alkaptonuria. [Energy metabolism, Amino acids and amines]


Pssm-ID: 273395  Cd Length: 429  Bit Score: 670.31  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536    12 YRYQNGFDSYLESEAVSGALPIGHNSPQKPPLGLYAEKLSGTAFTAPRHENKQSWLYRILPSCSHPPFVqatPRNGQEPV 91
Cdd:TIGR01015   2 LKYLSGFGNEFESERVPGALPVGQNSPQKCPYGLYAEQLSGSAFTAPRHENKRSWLYRIRPSAAHEPFE---PRDGNPGH 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536    92 LERSPARLHYIPNQLRWDPFDHESD--TDFVSGLRLVAGAGDPTLKQGLGMYIYAAGKSMSaQSAFYSADGDLLIVAQDG 169
Cdd:TIGR01015  79 VTANFDEQAPDPNQLRWSPFPIPSDeaVDFVDGLHTLCGAGDATSRTGLAIHIYLCNASME-NRAFYNADGDFLIVPQQG 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   170 VLDIRTEFGWLLVRPMEIAVIPRGVRYQVFLPsGPVRGYALELYQGHFQLPELGPIGSNGLANVRDFQAPVACFsEDhgs 249
Cdd:TIGR01015 158 ALLITTEFGRLLVEPNEICVIPRGVRFRVTVL-EPARGYICEVYGAHFQLPDLGPIGANGLANPRDFEAPVAAF-ED--- 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   250 iaLDGPNSYTITAKFNNTLFETKQPHTPFDVVAWHGNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLSAPSDHAGTAIAD 329
Cdd:TIGR01015 233 --REVPGPYTVINKFQGSLFAAKQDHSPFDVVAWHGNYVPYKYDLKRFNVINSVSFDHPDPSIFTVLTAPSDRPGTAIAD 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   330 FVIFPPRWLVGEDTFRPPWYHRNTMSEFMGLITGAYDAkkgGKGGFVPGGASLHNVMSGHGPDAASYEGARNADLKPQKV 409
Cdd:TIGR01015 311 FVIFPPRWLVAEKTFRPPYYHRNCMSEFMGLITGAYDA---KEGGFVPGGGSLHNMMTPHGPDFDCFEKASNAKLKPERI 387
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|...
gi 85097536   410 GEGSCAFMFESCLMVGVTDWGLeTCHKVQEDYNEHsWGGVKVH 452
Cdd:TIGR01015 388 ADGTMAFMFESSLSLAVTKWGA-TCQKLQEDYYKC-WQPLKRH 428
HgmA pfam04209
homogentisate 1,2-dioxygenase; Homogentisate dioxygenase cleaves the aromatic ring during the ...
13-452 0e+00

homogentisate 1,2-dioxygenase; Homogentisate dioxygenase cleaves the aromatic ring during the metabolic degradation of Phe and Tyr. Homogentisate dioxygenase deficiency causes alkaptonuria. The structure of homogentisate dioxygenase shows that the enzyme forms a hexamer arrangement comprised of a dimer of trimers. The active site iron ion is coordinated near the interface between the trimers.


Pssm-ID: 282114  Cd Length: 424  Bit Score: 670.21  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536    13 RYQNGFDSYLESEAVSGALPIGHNSPQKPPLGLYAEKLSGTAFTAPRHENKQSWLYRILPSCSHPPFVQATPRNGQEPVL 92
Cdd:pfam04209   1 KYQSGFGNEFESEAVPGALPVGQNSPQKCPYGLYAEQLSGTAFTAPRHENQRSWLYRIRPSVAHEPFFPRDPEHLTAPFV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536    93 ErsparLHYIPNQLRWDPFDHESD--TDFVSGLRLVAGAGDPTLKQGLGMYIYAAGKSMSaQSAFYSADGDLLIVAQDGV 170
Cdd:pfam04209  81 G-----EHPDPNQLRWKPLPLPSQepTDFVEGLHTIAGAGDALVRTGLAIHIYLANKSME-NRAFYNADGDFLIVPQQGA 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   171 LDIRTEFGWLLVRPMEIAVIPRGVRYQVFLPSGPVRGYALELYQGHFQLPELGPIGSNGLANVRDFQAPVACFsEDHGSI 250
Cdd:pfam04209 155 LDITTEFGRLLVEPGEIAVIPRGVRFRVEVLDGPARGYICENYGAHFQLPDLGPIGANGLANPRDFLAPVAAF-EDKEVG 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   251 aldgpnSYTITAKFNNTLFETKQPHTPFDVVAWHGNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLSAPSDHAGTAIADF 330
Cdd:pfam04209 234 ------PYTVINKFQGKLFAAKQDHSPFDVVAWHGNYVPYKYDLSRFNVINTVSFDHPDPSIFTVLTAPSDEPGTANADF 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   331 VIFPPRWLVGEDTFRPPWYHRNTMSEFMGLITGAYDAkkgGKGGFVPGGASLHNVMSGHGPDAASYEGARNADLKPQKVG 410
Cdd:pfam04209 308 VIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYDA---KAEGFVPGGASLHNCMTPHGPDAESFEKASNADLKPHRID 384
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|..
gi 85097536   411 EgSCAFMFESCLMVGVTDWGLEtCHKVQEDYNEHsWGGVKVH 452
Cdd:pfam04209 385 D-TMAFMFESSLVLAVTEWALE-SPKLQDDYYKC-WQGLKRH 423
PRK05341 PRK05341
homogentisate 1,2-dioxygenase; Provisional
13-457 0e+00

homogentisate 1,2-dioxygenase; Provisional


Pssm-ID: 235421  Cd Length: 438  Bit Score: 643.85  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   13 RYQNGFDSYLESEAVSGALPIGHNSPQKPPLGLYAEKLSGTAFTAPRHENKQSWLYRILPSCSHPPFVQATPRNgqepvl 92
Cdd:PRK05341  13 GYQSGFGNEFATEALPGALPVGQNSPQRAPYGLYAEQLSGTAFTAPRAENRRSWLYRIRPSVVHGPFEPVDSRL------ 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   93 eRSPARLHYI-PNQLRWDPFDH-ESDTDFVSGLRLVAGAGDPTLKQGLGMYIYAAGKSMSaQSAFYSADGDLLIVAQDGV 170
Cdd:PRK05341  87 -WRTFDEVPTpPNQLRWDPLPLpAEPTDFVDGLVTMAGNGDAEAQAGMAIHLYAANRSMQ-DRYFYNADGELLIVPQQGR 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  171 LDIRTEFGWLLVRPMEIAVIPRGVRYQVFLPSGPVRGYALELYQGHFQLPELGPIGSNGLANVRDFQAPVACFsEDhgsi 250
Cdd:PRK05341 165 LRLATELGVLDVEPGEIAVIPRGVKFRVELPDGPARGYVCENYGAPFRLPDLGPIGANGLANPRDFLTPVAAF-ED---- 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  251 aLDGPnsYTITAKFNNTLFETKQPHTPFDVVAWHGNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLSAPSDHAGTAIADF 330
Cdd:PRK05341 240 -REGP--FELVAKFGGRLWRAEIDHSPLDVVAWHGNYAPYKYDLRRFNTIGSISFDHPDPSIFTVLTSPSDTPGTANIDF 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  331 VIFPPRWLVGEDTFRPPWYHRNTMSEFMGLITGAYDAkkgGKGGFVPGGASLHNVMSGHGPDAASYEGARNADLKPQKVg 410
Cdd:PRK05341 317 VIFPPRWLVAENTFRPPWFHRNVMSEFMGLIHGVYDA---KAEGFVPGGASLHNCMSPHGPDAETFEKASNADLKPHKI- 392
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*..
gi 85097536  411 EGSCAFMFESCLMVGVTDWGLETCHkVQEDYNEhSWGGVKVHWKGMP 457
Cdd:PRK05341 393 DNTMAFMFETRYPIRPTRFALETPQ-LQADYDD-CWQGLKKHFDPER 437
PLN02658 PLN02658
homogentisate 1,2-dioxygenase
14-455 0e+00

homogentisate 1,2-dioxygenase


Pssm-ID: 215355  Cd Length: 435  Bit Score: 570.50  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   14 YQNGFDSYLESEAVSGALPIGHNSPQKPPLGLYAEKLSGTAFTAPRHENKQSWLYRILPSCSHPPFVQATPRNGQEPVLE 93
Cdd:PLN02658   1 YQSGFGNHFSSEALPGALPRGQNNPLLCPYGLYAEQLSGTAFTAPRKLNRRSWLYRIKPSVTHEPFKPRVPAHEKLVGEF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536   94 RSPARLHYIPNQLRWDPFD-HESDTDFVSGLRLVAGAGDPTLKQGLGMYIYAAGKSMSaQSAFYSADGDLLIVAQDGVLD 172
Cdd:PLN02658  81 DPSNSCETTPTQLRWRPFPvPDSPVDFVDGLFTVCGAGSPFLRHGYAIHMYVANKSMD-DCAFCNADGDFLIVPQQGRLW 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  173 IRTEFGWLLVRPMEIAVIPRGVRYQVFLPSGPVRGYALELYQGHFQLPELGPIGSNGLANVRDFQAPVACFSEDHGSial 252
Cdd:PLN02658 160 IKTELGKLQVSPGEIVVIPRGFRFAVDLPDGPSRGYVLEIFGGHFQLPDLGPIGANGLANPRDFLHPVAWFEDGSRP--- 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  253 dgpnSYTITAKFNNTLFETKQPHTPFDVVAWHGNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLSAPSDHAGTAIADFVI 332
Cdd:PLN02658 237 ----GYTIVQKFGGELFTAKQDFSPFNVVAWHGNYVPYKYDLSKFCPVNTVLFDHADPSINTVLTAPTDKPGVALADFVI 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  333 FPPRWLVGEDTFRPPWYHRNTMSEFMGLITGAYDAkkgGKGGFVPGGASLHNVMSGHGPDAASYEGA-RNADLKPQKVGE 411
Cdd:PLN02658 313 FPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGSYEA---KADGFLPGGASLHSCMTPHGPDTATYEATiARPCADAPSKLT 389
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....
gi 85097536  412 GSCAFMFESCLMVGVTDWGLEtCHKVQEDYNEhSWGGVKVHWKG 455
Cdd:PLN02658 390 GTLAFMFESSLIPRVCPWALE-SPFRDRDYYQ-CWIGLKSHFSR 431
HmgA COG3508
Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport and catabolism];
13-448 3.56e-155

Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport and catabolism];


Pssm-ID: 226039  Cd Length: 427  Bit Score: 450.44  E-value: 3.56e-155
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  13 RYQNGFDSYLESEAVSGALPIGHNSPQKPPLGLYAEKLSGTAFTAPRHENKQSWLYRILPSCSHPPFvqatpRNGQEPVL 92
Cdd:COG3508   4 RYQSGFGNVFETEALPGALPVGQNSPQKAPYGLYAEQLSGSAFTAPRGENRRSWLYRIRPSANHPTF-----RPMKLGEW 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536  93 ERSPARLHYIPNQLRWDPFD-HESDTDFVSGLRLVAGAGDPTLKQGLGMYIYAAGKSMSaQSAFYSADGDLLIVAQDGVL 171
Cdd:COG3508  79 KSALIGPWATPNQLRWSPLPlPKAPTDFLDGILLIANNGDADTQDGVAIHVYKVNESMT-KRFFRNADGELLIVPQQGEL 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536 172 DIRTEFGWLLVRPMEIAVIPRGVRYQVFLPSGPVRGYALELYQGHFQLPELGPIGSNGLANVRDFQAPVACFSEDHGSia 251
Cdd:COG3508 158 RLKTELGVLEVEPGEIAVIPRGTTFRVELKDGEARGYGCENYGAKFRLPELGPIGANGLANPRDFKTPVARYEDSEGP-- 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536 252 ldgpnsYTITAKFNNTLFETKQPHTPFDVVAWHGNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLSAPSDHAGTAIADFV 331
Cdd:COG3508 236 ------TQLVVKTHGGLWAVELDHSPLDVVAWHGNLAPYKYDLRDFNPIGTISYDHPDPSIFTVLTAPSDTPGFANCDFV 309
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85097536 332 IFPPRWLVGEDTFRPPWYHRNTMSEFMGLITGAYDAkkgGKGGFVPGGASLHNVMSGHGPDAASYEGARNADLKPQKVgE 411
Cdd:COG3508 310 IFPPRWLVAEQTFRPPWYHRNDMSEFMGLISGQYDA---KAEGFVPGGASLHNCMSAHGPDPSAFEKALNARLKPHKI-D 385
                       410       420       430
                ....*....|....*....|....*....|....*..
gi 85097536 412 GSCAFMFESCLMVGVTDWGLETcHKVQEDYNEhSWGG 448
Cdd:COG3508 386 DTMAFMFETRKVLRPSRYAAEI-DALQDDYDA-CWQG 420
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH