NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|83576051|gb|ABC22602|]
View 

chemotaxis sensory transducer [Rhodospirillum rubrum ATCC 11170]

Protein Classification

PAS and MCP_signal domain-containing protein (domain architecture ID 12092684)

PAS and MCP_signal domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCPsignal super family cl28165
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
178-430 6.87e-47

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


The actual alignment was detected with superfamily member smart00283:

Pssm-ID: 332985  Cd Length: 262  Bit Score: 164.77  E-value: 6.87e-47
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    178 VSGASGDLQTTARWLSSGAAEAADQAVTVAAAAGQATSNVETVASAAEELSASVSEISRQMADSARISTAASEEAARTNA 257
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    258 MVQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEIGLQIAAVQEETR 337
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETN 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    338 KTVEAIKGI-------AATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNNATEAVKGAGQVL 410
Cdd:smart00283 162 EAVAAMEESsseveegVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|
gi 83576051    411 TSADGLATSSQNLRDAVTRF 430
Cdd:smart00283 242 AAAEELSGLAEELDELVERF 261
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
50-139 6.59e-16

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


:

Pssm-ID: 312074  Cd Length: 89  Bit Score: 73.91  E-value: 6.59e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    50 VWHWSSELRRLLGFTdAAEFPDVVKSWSERLHPDDVATALGAFTNCLSGRSAvkdsYDVSYRLKRKDGAYHWFRAMGGVN 129
Cdd:pfam08447   1 IIYWSPRFEEILGYT-PEELLGKGESWLDLVHPDDRERVREALWEALKGGEP----YSGEYRIRRKDGEYRWVEARARPI 75
                          90
                  ....*....|
gi 83576051   130 RDGAGKATRM 139
Cdd:pfam08447  76 RDENGKPVRV 85
 
Name Accession Description Interval E-value
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
178-430 6.87e-47

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 164.77  E-value: 6.87e-47
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    178 VSGASGDLQTTARWLSSGAAEAADQAVTVAAAAGQATSNVETVASAAEELSASVSEISRQMADSARISTAASEEAARTNA 257
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    258 MVQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEIGLQIAAVQEETR 337
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETN 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    338 KTVEAIKGI-------AATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNNATEAVKGAGQVL 410
Cdd:smart00283 162 EAVAAMEESsseveegVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|
gi 83576051    411 TSADGLATSSQNLRDAVTRF 430
Cdd:smart00283 242 AAAEELSGLAEELDELVERF 261
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
170-430 2.45e-41

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 153.22  E-value: 2.45e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 170 QVMGLVQSVSGASGDLQTTARWLSSGAAEAADQAVTVAAAAGQATSNVETVASAAEELSASVSEISRQMADSARISTAAS 249
Cdd:COG0840 135 AVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAV 214
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 250 EEAARTNAM----VQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEI 325
Cdd:COG0840 215 EQMQEIAEElaevVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEI 294
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 326 GLQIAAVQEETRKTVEAIKGIA-------ATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNN 398
Cdd:COG0840 295 GLLIEEIQNEAADAVEHMEESAsevsegvKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDV 374
                       250       260       270
                ....*....|....*....|....*....|..
gi 83576051 399 ATEAVKGAGQVLTSADGLATSSQNLRDAVTRF 430
Cdd:COG0840 375 TQENAAAVEELAAASEELKELAEKLLELVAKF 406
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
206-396 1.70e-38

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 140.06  E-value: 1.70e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 206 VAAAAGQATSNVETVASAAEELSASVSEISRQMADSaristaaSEEAARTNAMVQGLATAANKIGEVVKLINDIASQTNL 285
Cdd:cd11386  10 VAASADQVAETSQQAAELAEKGREAAEDAINQMNQI-------DESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 286 LALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEIGLQIAAVQEET-------RKTVEAIKGIAATIEQVRENAS 358
Cdd:cd11386  83 LALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTeeaveamEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 83576051 359 GIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSIS 396
Cdd:cd11386 163 EIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
259-430 7.22e-28

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 110.23  E-value: 7.22e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051   259 VQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEIGLQIAAVQEETRK 338
Cdd:pfam00015  29 MEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKEIEALIEEIVKQTND 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051   339 TVEAIKGI-------AATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNNATEAVKGAGQVLT 411
Cdd:pfam00015 109 STASIQQTrtevevgSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSAGIDQVNQAVARIDQVTQQNAALVEESAA 188
                         170
                  ....*....|....*....
gi 83576051   412 SADGLATSSQNLRDAVTRF 430
Cdd:pfam00015 189 AAETLEEQAEELTASVAQF 207
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
169-418 5.39e-27

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 112.86  E-value: 5.39e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  169 AQVMGLVQSVSGASGDLQTTARWLSSGAAEAADQAVTVAAAAGQATSNVETVASAAEELSASV----------SEISRQM 238
Cdd:PRK09793 250 ASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVgqnadnarqaSELAKNA 329
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  239 ADSARistAASEEAARTNAMVQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQT 318
Cdd:PRK09793 330 ATTAQ---AGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRS 406
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  319 GRATDEIGLQIAAVQEETRKTVEAIKGIAATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNN 398
Cdd:PRK09793 407 AQAAKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQNASL 486
                        250       260
                 ....*....|....*....|
gi 83576051  399 ATEAVKGAGQVLTSADGLAT 418
Cdd:PRK09793 487 VEEAAVATEQLANQADHLSS 506
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
50-139 6.59e-16

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312074  Cd Length: 89  Bit Score: 73.91  E-value: 6.59e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    50 VWHWSSELRRLLGFTdAAEFPDVVKSWSERLHPDDVATALGAFTNCLSGRSAvkdsYDVSYRLKRKDGAYHWFRAMGGVN 129
Cdd:pfam08447   1 IIYWSPRFEEILGYT-PEELLGKGESWLDLVHPDDRERVREALWEALKGGEP----YSGEYRIRRKDGEYRWVEARARPI 75
                          90
                  ....*....|
gi 83576051   130 RDGAGKATRM 139
Cdd:pfam08447  76 RDENGKPVRV 85
PRK09776 PRK09776
putative diguanylate cyclase; Provisional
31-150 2.20e-09

putative diguanylate cyclase; Provisional


Pssm-ID: 182070  Cd Length: 1092  Bit Score: 59.69  E-value: 2.20e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    31 GVGLWDVKLHGSdplhplsVWHWSSELRRLLGfTDAAEFPDVvKSWSERLHPDDVATALGAFTNCLSGRSavkdSYDVSY 110
Cdd:PRK09776  420 GIGIWEWDLKPN-------IISWDKRMFELYE-IPPHIKPTW-QVWYACLHPEDRQRVEKEIRDALQGRS----PFKLEF 486
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 83576051   111 RLKRKDGAyHWFRAMGGVNRDGAGKATRMCGSLIDIDAER 150
Cdd:PRK09776  487 RIVVKDGV-RHIRALANRVLNKDGEVERLLGINMDMTEVR 525
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
52-146 8.05e-06

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075  Cd Length: 103  Bit Score: 44.93  E-value: 8.05e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  52 HWSSELRRLLGFTdAAEFPDvvKSWSERLHPDDVATALGAFTNCLSGRsavkDSYDVSYRLKRKDGAYHWFRAMGGVNRD 131
Cdd:cd00130  16 YANPAAEQLLGYS-PEELIG--KSLLDLIHPEDREELRERLENLLSGG----EPVTLEVRLRRKDGSVIWVLVSLTPIRD 88
                        90
                ....*....|....*
gi 83576051 132 GAGKATRMCGSLIDI 146
Cdd:cd00130  89 EGGEVIGLLGVVRDI 103
PAS COG2202
PAS domain [Signal transduction mechanisms];
50-153 6.10e-03

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112  Cd Length: 232  Bit Score: 37.91  E-value: 6.10e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  50 VWHWSSELRRLLGFTDAAEFpdvVKSWSERLHPDDVATALGAFTNclSGRSAVKDSYDVSYRLKRKDGAYHWFRAMGGVN 129
Cdd:COG2202 134 ILYANPAAEELLGYSPEEEL---GRGLSDLIHPEDEERRELELAR--ALAEGRGGPLEIEYRVRRKDGERVRWILSRISP 208
                        90       100
                ....*....|....*....|....
gi 83576051 130 RDGAGKATRMCGSLIDIDAERVSE 153
Cdd:COG2202 209 VRDDGEIVGVVGIARDITERKQAE 232
 
Name Accession Description Interval E-value
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
178-430 6.87e-47

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 164.77  E-value: 6.87e-47
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    178 VSGASGDLQTTARWLSSGAAEAADQAVTVAAAAGQATSNVETVASAAEELSASVSEISRQMADSARISTAASEEAARTNA 257
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    258 MVQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEIGLQIAAVQEETR 337
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETN 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    338 KTVEAIKGI-------AATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNNATEAVKGAGQVL 410
Cdd:smart00283 162 EAVAAMEESsseveegVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|
gi 83576051    411 TSADGLATSSQNLRDAVTRF 430
Cdd:smart00283 242 AAAEELSGLAEELDELVERF 261
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
170-430 2.45e-41

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 153.22  E-value: 2.45e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 170 QVMGLVQSVSGASGDLQTTARWLSSGAAEAADQAVTVAAAAGQATSNVETVASAAEELSASVSEISRQMADSARISTAAS 249
Cdd:COG0840 135 AVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAV 214
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 250 EEAARTNAM----VQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEI 325
Cdd:COG0840 215 EQMQEIAEElaevVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEI 294
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 326 GLQIAAVQEETRKTVEAIKGIA-------ATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNN 398
Cdd:COG0840 295 GLLIEEIQNEAADAVEHMEESAsevsegvKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDV 374
                       250       260       270
                ....*....|....*....|....*....|..
gi 83576051 399 ATEAVKGAGQVLTSADGLATSSQNLRDAVTRF 430
Cdd:COG0840 375 TQENAAAVEELAAASEELKELAEKLLELVAKF 406
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
206-396 1.70e-38

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 140.06  E-value: 1.70e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 206 VAAAAGQATSNVETVASAAEELSASVSEISRQMADSaristaaSEEAARTNAMVQGLATAANKIGEVVKLINDIASQTNL 285
Cdd:cd11386  10 VAASADQVAETSQQAAELAEKGREAAEDAINQMNQI-------DESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 286 LALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEIGLQIAAVQEET-------RKTVEAIKGIAATIEQVRENAS 358
Cdd:cd11386  83 LALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTeeaveamEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 83576051 359 GIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSIS 396
Cdd:cd11386 163 EIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
259-430 7.22e-28

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 110.23  E-value: 7.22e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051   259 VQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEIGLQIAAVQEETRK 338
Cdd:pfam00015  29 MEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKEIEALIEEIVKQTND 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051   339 TVEAIKGI-------AATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNNATEAVKGAGQVLT 411
Cdd:pfam00015 109 STASIQQTrtevevgSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSAGIDQVNQAVARIDQVTQQNAALVEESAA 188
                         170
                  ....*....|....*....
gi 83576051   412 SADGLATSSQNLRDAVTRF 430
Cdd:pfam00015 189 AAETLEEQAEELTASVAQF 207
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
169-418 5.39e-27

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 112.86  E-value: 5.39e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  169 AQVMGLVQSVSGASGDLQTTARWLSSGAAEAADQAVTVAAAAGQATSNVETVASAAEELSASV----------SEISRQM 238
Cdd:PRK09793 250 ASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVgqnadnarqaSELAKNA 329
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  239 ADSARistAASEEAARTNAMVQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQT 318
Cdd:PRK09793 330 ATTAQ---AGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRS 406
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  319 GRATDEIGLQIAAVQEETRKTVEAIKGIAATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNN 398
Cdd:PRK09793 407 AQAAKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQNASL 486
                        250       260
                 ....*....|....*....|
gi 83576051  399 ATEAVKGAGQVLTSADGLAT 418
Cdd:PRK09793 487 VEEAAVATEQLANQADHLSS 506
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
162-388 7.50e-24

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 103.88  E-value: 7.50e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  162 RFADSFEAQVMGLVQSVsgasGDLQTTARWLSSGAAEAADQAVTVAAAAGQATSNVETVASAAEELSASVSEISRQMADS 241
Cdd:PRK15041 251 QLAESLRHMQGELMRTV----GDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQA 326
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  242 ARISTAASEEAARTNAMV-------QGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNL 314
Cdd:PRK15041 327 SHLALSASETAQRGGKVVdnvvqtmRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNL 406
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 83576051  315 ANQTGRATDEIGLQIaavqeetRKTVEAIKGIAATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQV 388
Cdd:PRK15041 407 AQRSAQAAREIKSLI-------EDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQV 473
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
174-430 6.83e-23

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 100.85  E-value: 6.83e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  174 LVQSVSGASGDLQTTARWLSSGAAEAADQAVTVAAAAGQATSNVETVASAAEELSASVSEIS---RQMADSAR----IST 246
Cdd:PRK15048 250 LAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTatvKQNADNARqasqLAQ 329
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  247 AASEEAARTNAMVQG-------LATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQTG 319
Cdd:PRK15048 330 SASDTAQHGGKVVDGvvktmheIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSA 409
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  320 RATDEIGLQIaavqeetRKTVEAIKGIAATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNNA 399
Cdd:PRK15048 410 QAAKEIKALI-------EDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVT 482
                        250       260       270
                 ....*....|....*....|....*....|.
gi 83576051  400 TEAVKGAGQVLTSADGLATSSQNLRDAVTRF 430
Cdd:PRK15048 483 QQNASLVQESAAAAAALEEQASRLTQAVSAF 513
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
50-139 6.59e-16

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 312074  Cd Length: 89  Bit Score: 73.91  E-value: 6.59e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    50 VWHWSSELRRLLGFTdAAEFPDVVKSWSERLHPDDVATALGAFTNCLSGRSAvkdsYDVSYRLKRKDGAYHWFRAMGGVN 129
Cdd:pfam08447   1 IIYWSPRFEEILGYT-PEELLGKGESWLDLVHPDDRERVREALWEALKGGEP----YSGEYRIRRKDGEYRWVEARARPI 75
                          90
                  ....*....|
gi 83576051   130 RDGAGKATRM 139
Cdd:pfam08447  76 RDENGKPVRV 85
PRK09776 PRK09776
putative diguanylate cyclase; Provisional
31-150 2.20e-09

putative diguanylate cyclase; Provisional


Pssm-ID: 182070  Cd Length: 1092  Bit Score: 59.69  E-value: 2.20e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    31 GVGLWDVKLHGSdplhplsVWHWSSELRRLLGfTDAAEFPDVvKSWSERLHPDDVATALGAFTNCLSGRSavkdSYDVSY 110
Cdd:PRK09776  420 GIGIWEWDLKPN-------IISWDKRMFELYE-IPPHIKPTW-QVWYACLHPEDRQRVEKEIRDALQGRS----PFKLEF 486
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 83576051   111 RLKRKDGAyHWFRAMGGVNRDGAGKATRMCGSLIDIDAER 150
Cdd:PRK09776  487 RIVVKDGV-RHIRALANRVLNKDGEVERLLGINMDMTEVR 525
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
52-146 8.05e-06

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075  Cd Length: 103  Bit Score: 44.93  E-value: 8.05e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  52 HWSSELRRLLGFTdAAEFPDvvKSWSERLHPDDVATALGAFTNCLSGRsavkDSYDVSYRLKRKDGAYHWFRAMGGVNRD 131
Cdd:cd00130  16 YANPAAEQLLGYS-PEELIG--KSLLDLIHPEDREELRERLENLLSGG----EPVTLEVRLRRKDGSVIWVLVSLTPIRD 88
                        90
                ....*....|....*
gi 83576051 132 GAGKATRMCGSLIDI 146
Cdd:cd00130  89 EGGEVIGLLGVVRDI 103
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
246-436 3.96e-05

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 45.37  E-value: 3.96e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 246 TAASEEAARTNAMVQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEI 325
Cdd:COG0840  46 DAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEM 125
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 326 GLQIAAVQEETRKTVEAIkgiAATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNNATEAVKG 405
Cdd:COG0840 126 ILNLRQIIDAVQDNAEAL---SGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQV 202
                       170       180       190
                ....*....|....*....|....*....|.
gi 83576051 406 AGQVLTSADGLATSSQNLRDAVTRFLAEVRS 436
Cdd:COG0840 203 AEEGGEEVRQAVEQMQEIAEELAEVVKKLSE 233
MlaD COG1463
ABC-type transporter Mla maintaining outer membrane lipid asymmetry, periplasmic component ...
307-437 2.77e-04

ABC-type transporter Mla maintaining outer membrane lipid asymmetry, periplasmic component MlaD [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 224380  Cd Length: 359  Bit Score: 42.84  E-value: 2.77e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 307 VAGEVKNLANQTGRATDEIGlqIAAVQEETRKTVEAIKGIAATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTR 386
Cdd:COG1463 137 VPIDLEDLLGDLLLLLGGLD--PDRLNAILNEAAAALAGTGPQLNALLDNLAQFTDALNARDGDIGALIANLNQLLDSLA 214
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|.
gi 83576051 387 QVSQNIDSISNNATEAVKGAGQVLTSADGLATSSQNLRDAVTRFLAEVRST 437
Cdd:COG1463 215 AASDQLDRLLDNLATLTAALAARRDALDDALAALSALAATVNDLLAENRPN 265
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
338-429 3.55e-04

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 41.89  E-value: 3.55e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    338 KTVEAIKGIAATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISNNATEAVKGAGQVLTSADGLA 417
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90
                   ....*....|..
gi 83576051    418 TSSQNLRDAVTR 429
Cdd:smart00283  81 SAVEELEESSDE 92
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
176-397 5.49e-04

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 41.90  E-value: 5.49e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 176 QSVSGASGDLQTTARWLSSGAAEAADQAVTVAAAAGQATSNVETVASAAEELSASVSE-ISRQMADSARISTAASEEAAR 254
Cdd:COG0840  21 AGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAIlLLRAILEPISDLLEVVERIAA 100
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051 255 TNAMVQGLATAANKIGEVVKLINDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKNLANQTGRATDEIGLQIAAVQE 334
Cdd:COG0840 101 GDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSE 180
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 83576051 335 ETRKTVEAIKGIAATIEQVRENASGIASAVEQQGAATREIARNVEQAATGTRQVSQNIDSISN 397
Cdd:COG0840 181 TVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEITS 243
PRK09776 PRK09776
putative diguanylate cyclase; Provisional
57-169 2.39e-03

putative diguanylate cyclase; Provisional


Pssm-ID: 182070  Cd Length: 1092  Bit Score: 40.04  E-value: 2.39e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    57 LRRLLGFTdAAEFPDVvkSWSERLHPDDVATALGAFTNCLSGRSavkDSYDVSYRLKRKDGAYHWFRAMGGVNRDGAGKA 136
Cdd:PRK09776  312 LCQFLGYS-QEELRGL--TFQQLTWPEDLNKDLQQVEKLLSGEI---NSYSMEKRYYRRDGEVVWALLAVSLVRDTDGTP 385
                          90       100       110
                  ....*....|....*....|....*....|...
gi 83576051   137 TRMCGSLIDIDAERVSEARRREDTQRFADSFEA 169
Cdd:PRK09776  386 LYFIAQIEDINELKRTEQVNERLMERITLANEA 418
PHA02515 PHA02515
hypothetical protein; Provisional
169-362 4.52e-03

hypothetical protein; Provisional


Pssm-ID: 107197  Cd Length: 508  Bit Score: 38.99  E-value: 4.52e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  169 AQVMGLVQSVSGASGDLQTTARWLSSGAAEAADQAVTVAAAAGqaTSNVETVASAAeelsasvseisrqmadsARISTAA 248
Cdd:PHA02515 224 ANSIGNVDTVAENIGDVSTVSTHLSSMLAVANDIDSVVSVAGD--LENIDAVADNA-----------------ANINTVA 284
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  249 SeeaarTNAMVQGLATAANKIGEVVKLINDI------ASQTNLLALNA-TIEAARAGEAGKGFAV-----VAGEVKNLAN 316
Cdd:PHA02515 285 G-----ANANVNTVASNILDVGTVAGNIDDVqavagnAANINVVADNAdNINATAANQANINAAVgnadnINAAVANQAN 359
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
gi 83576051  317 QTGRATDEIGLQIAAVQEETRKTV-------EAIKGIAATIEQVRENASGIAS 362
Cdd:PHA02515 360 INAVVGNANNINAVAANEGNVNTVvdnladvQTVAGIAADVSTVAENEAAVAA 412
PRK13560 PRK13560
hypothetical protein; Provisional
68-157 4.76e-03

hypothetical protein; Provisional


Pssm-ID: 106506  Cd Length: 807  Bit Score: 39.27  E-value: 4.76e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051   68 EFPDVVKSWSERLHPDD---VATALGAFTnclsgRSAVkDSYDVSYRLKRKDGAYHWFRAMGGVNRDGAGKATRMCGSLI 144
Cdd:PRK13560 513 EFISGKRMFAAIIHPADleqVAAEVAEFA-----AQGV-DRFEQEYRILGKGGAVCWIDDQSAAERDEEGQISHFEGIVI 586
                         90
                 ....*....|...
gi 83576051  145 DIDAERVSEARRR 157
Cdd:PRK13560 587 DISERKHAEEKIK 599
PAS COG2202
PAS domain [Signal transduction mechanisms];
50-153 6.10e-03

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112  Cd Length: 232  Bit Score: 37.91  E-value: 6.10e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051  50 VWHWSSELRRLLGFTDAAEFpdvVKSWSERLHPDDVATALGAFTNclSGRSAVKDSYDVSYRLKRKDGAYHWFRAMGGVN 129
Cdd:COG2202 134 ILYANPAAEELLGYSPEEEL---GRGLSDLIHPEDEERRELELAR--ALAEGRGGPLEIEYRVRRKDGERVRWILSRISP 208
                        90       100
                ....*....|....*....|....
gi 83576051 130 RDGAGKATRMCGSLIDIDAERVSE 153
Cdd:COG2202 209 VRDDGEIVGVVGIARDITERKQAE 232
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
52-146 6.55e-03

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 307226  Cd Length: 113  Bit Score: 36.24  E-value: 6.55e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83576051    52 HWSSELRRLLGFTDAaefpDVV-KSWSERLHPDDVATALGAFTNCLSGRSAVKDsydVSYRLKRKDGAYHWFRAMGGVNR 130
Cdd:pfam00989  25 YVNAAAEELLGLSRE----EVIgKSLLDLIPEEDDAEVAELLRQALLQGEESRG---FEVSFRVPDGRPRHVEVRASPVR 97
                          90
                  ....*....|....*.
gi 83576051   131 DGAGKATRMCGSLIDI 146
Cdd:pfam00989  98 DAGGEILGFLGVLRDI 113
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH