NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|83572016|gb|ABC18568|]
View 

2-octaprenylphenol hydroxylase [Moorella thermoacetica ATCC 39073]

Protein Classification

AarF/ABC1/UbiB kinase family protein (domain architecture ID 11429476)

AarF/ABC1/UbiB kinase family protein belonging to the protein kinase superfamily, similar to Saccharomyces cerevisiae ABC1 family protein MCP2 and to Arabidopsis thaliana ABC1-like kinase 1 (ABC1K1) and ABC1K3, which are atypical protein kinases that act in opposition to cope with photodamage under continuous red light

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family ...
19-513 2.52e-155

Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family [Coenzyme transport and metabolism, Signal transduction mechanisms];


:

Pssm-ID: 223733  Cd Length: 517  Bit Score: 458.31  E-value: 2.52e-155
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  19 VLARYGFGYLLDQVGLGELILRR----------SREEAPLSLGQRLRLALEELGPTFIKLGQLLSTRPDLLPADIISELT 88
Cdd:COG0661  16 VRLRYLLGRLLRLTGRLALLLRLlswlgksklaSSEELREKRAERLRLALEELGPTFIKLGQILSTRPDLVPPEYAEELA 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  89 RLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLEILFDL 168
Cdd:COG0661  96 KLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEADLKLLRRL 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 169 ARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEYVEAVKLNN 248
Cdd:COG0661 176 ARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRVLTMEWIDGIKISD 255
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 249 LEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLPGEVIVFMDFGLTGTLTEELKEQFVNLVLGIIRRRS 328
Cdd:COG0661 256 IAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFRRYLAELLLAFLNRDY 335
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 329 QDVLRTIIAMGMVPAEVDRGALRREIEALRDKYYHLSFRQISLGQAIEELLQLAFRYHLRMPPELTLLGKTLLTLEGLVR 408
Cdd:COG0661 336 DRVAELHVELGYVPPDTDRDPLAAAIRAVLEPIYGKPLEEISFGEILDKLFEVARRFPMRLPPELVLLQRTLLLVEGVGR 415
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 409 KLDPELELAELAEPYGRELLRRRFSVRFLwRALTENLASGWEVMQSLPRQFQHLLDLAERGELTLRVEplhlrGLVRQID 488
Cdd:COG0661 416 QLDPRFNLWAVAQPLLAKWLKKQLSPKLL-RELKDEAVAVLNALPLLPRLLRDLLDNDREELSLRSSE-----ELALLLL 489
                       490       500
                ....*....|....*....|....*.
gi 83572016 489 RIINKLTM-SVVLLAFSIIMASLIIS 513
Cdd:COG0661 490 KAVARLSIgSILLVVLAVTVLLIAIL 515
 
Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family ...
19-513 2.52e-155

Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family [Coenzyme transport and metabolism, Signal transduction mechanisms];


Pssm-ID: 223733  Cd Length: 517  Bit Score: 458.31  E-value: 2.52e-155
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  19 VLARYGFGYLLDQVGLGELILRR----------SREEAPLSLGQRLRLALEELGPTFIKLGQLLSTRPDLLPADIISELT 88
Cdd:COG0661  16 VRLRYLLGRLLRLTGRLALLLRLlswlgksklaSSEELREKRAERLRLALEELGPTFIKLGQILSTRPDLVPPEYAEELA 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  89 RLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLEILFDL 168
Cdd:COG0661  96 KLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEADLKLLRRL 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 169 ARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEYVEAVKLNN 248
Cdd:COG0661 176 ARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRVLTMEWIDGIKISD 255
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 249 LEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLPGEVIVFMDFGLTGTLTEELKEQFVNLVLGIIRRRS 328
Cdd:COG0661 256 IAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFRRYLAELLLAFLNRDY 335
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 329 QDVLRTIIAMGMVPAEVDRGALRREIEALRDKYYHLSFRQISLGQAIEELLQLAFRYHLRMPPELTLLGKTLLTLEGLVR 408
Cdd:COG0661 336 DRVAELHVELGYVPPDTDRDPLAAAIRAVLEPIYGKPLEEISFGEILDKLFEVARRFPMRLPPELVLLQRTLLLVEGVGR 415
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 409 KLDPELELAELAEPYGRELLRRRFSVRFLwRALTENLASGWEVMQSLPRQFQHLLDLAERGELTLRVEplhlrGLVRQID 488
Cdd:COG0661 416 QLDPRFNLWAVAQPLLAKWLKKQLSPKLL-RELKDEAVAVLNALPLLPRLLRDLLDNDREELSLRSSE-----ELALLLL 489
                       490       500
                ....*....|....*....|....*.
gi 83572016 489 RIINKLTM-SVVLLAFSIIMASLIIS 513
Cdd:COG0661 490 KAVARLSIgSILLVVLAVTVLLIAIL 515
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
12-438 3.97e-151

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]


Pssm-ID: 273909  Cd Length: 437  Bit Score: 444.82  E-value: 3.97e-151
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016    12 RYRQVVNVLARYGFGYLLD-QVGLGELILRR-------SREEAPLSLGQRLRLALEELGPTFIKLGQLLSTRPDLLPADI 83
Cdd:TIGR01982   3 RLRRIIRVLIRYGFLALVEsPIGPLSLRLLRrlllpfsNRENRLMSRGERLRLALEELGPTFIKFGQTLSTRADLLPADI 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016    84 ISELTRLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLE 163
Cdd:TIGR01982  83 AEELSLLQDRVPPFDFKVARKVIEAALGGPLEELFAEFEEKPLAAASIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIA 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   164 ILFDLARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEYVEA 243
Cdd:TIGR01982 163 LLYRLARIVERLSPDSRRLRPTEVVKEFEKTLRRELDLRREAANASELGENFKNDPGVYVPEVYWDRTSERVLTMEWIDG 242
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   244 VKLNNLEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLPGEVIVFMDFGLTGTLTEELKEQFVNLVLGI 323
Cdd:TIGR01982 243 IPLSDIAALDEAGLDRKALAENLARSFLNQVLRDGFFHADLHPGNIFVLKDGKIIALDFGIVGRLSEEDRRYLAEILYGF 322
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   324 IRRRSQDVLRTIIAMGMVPAEVDRGALRREIEALRDKYYHLSFRQISLGQAIEELLQLAFRYHLRMPPELTLLGKTLLTL 403
Cdd:TIGR01982 323 LNRDYRRVAEVHFDAGYVPSDTDMAEFEQAIRAIGEPIFGQPLKEISVGRLLAGLFKITRDFNMELQPQLLLLQKTLLTV 402
                         410       420       430
                  ....*....|....*....|....*....|....*
gi 83572016   404 EGLVRKLDPELELAELAEPYGRELLRRRFSVRFLW 438
Cdd:TIGR01982 403 EGVGRQLDPDLNMWKVAEPFVKRWIRKRLGPKAKI 437
ABC1_ADCK3-like cd05121
Activator of bc1 complex (ABC1) kinases (also called aarF domain containing kinase 3) and ...
89-335 1.38e-115

Activator of bc1 complex (ABC1) kinases (also called aarF domain containing kinase 3) and similar proteins; This family is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. Eukaryotes contain at least two more ABC1/ADCK3-like proteins: in humans, these are the putative atypical protein kinases named ADCK1 and ADCK2. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Eight of these plant ABC1 kinase subfamilies (ABC1K1-8) are specific for photosynthetic organisms. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270691  Cd Length: 247  Bit Score: 346.40  E-value: 1.38e-115
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  89 RLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLEILFDL 168
Cdd:cd05121   1 KLQDDVPPFPFEEVRKIIEEELGRPLEEVFAEFDPEPLAAASIAQVHRARLKDGREVAVKVQRPGIEEIIEADLRILRRL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 169 ARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEYVEAVKLNN 248
Cdd:cd05121  81 ARLLERLSPLLRRLDLVAIVDEFARSLLEELDFRREARNAERFRKNLKDSPDVYVPKVYPELSTRRVLVMEYIDGVKLTD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 249 LEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLPGEVIVFMDFGLTGTLTEELKEQFVNLVLGIIRRRS 328
Cdd:cd05121 161 LEALRAAGIDRKELARRLVDAYLKQIFEDGFFHADPHPGNILVLPDGRIALLDFGMVGRLDPETREALADLLLALVNGDA 240

                ....*..
gi 83572016 329 QDVLRTI 335
Cdd:cd05121 241 EGLAEAL 247
ubiB PRK04750
putative ubiquinone biosynthesis protein UbiB; Reviewed
1-518 1.46e-99

putative ubiquinone biosynthesis protein UbiB; Reviewed


Pssm-ID: 235310  Cd Length: 537  Bit Score: 315.31  E-value: 1.46e-99
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016    1 MSLRRRYihlnryrQVVNVLARYGfgylLDQVGLGELILRRSREEAPL-----------SLGQRLRLALEELGPTFIKLG 69
Cdd:PRK04750   2 MELFRLY-------KIIRVFLRYG----LDELILSHRLTRPLRLWRRSlfwmpnrhkdkPRGERLRLALEELGPIFVKFG 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   70 QLLSTRPDLLPADIISELTRLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPD-GSQVIVK 148
Cdd:PRK04750  71 QMLSTRRDLFPPDIADELALLQDRVPPFDGALARAIIEKALGGPVEEWFDDFDIKPLASASIAQVHFARLKDnGREVVVK 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  149 VQRPGIARQVRVDLEILFDLARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYW 228
Cdd:PRK04750 151 VLRPDILPVIDADLALMYRLARWVERLLPDGRRLKPREVVAEFEKTLHDELDLMREAANASQLRRNFEDSDMLYVPEVYW 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  229 DYTTRGVLTQEYVEAVKLNNLEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLP-----GEVIVfMDFG 303
Cdd:PRK04750 231 DYCSETVMVMERMYGIPVSDVAALRAAGTDMKLLAERGVEVFFTQVFRDGFFHADMHPGNIFVSYdppenPRYIA-LDFG 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  304 LTGTLTEELKEQFVNLVLGIIRRRSQDVLRTIIAMGMVPAEVDRGALRREIEALRDKYYHLSFRQISLGQAIEELLQLAF 383
Cdd:PRK04750 310 IVGSLNKEDKRYLAENFLAFFNRDYRRVAELHVESGWVPPDTRVEELEFAIRAVCEPIFDKPLAEISFGHVLLRLFNTAR 389
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  384 RYHLRMPPELTLLGKTLLTLEGLVRKLDPELELAELAEPYGRELLRRRFSVRFLWRALTENLASGWEVMQSLPRQFQHLL 463
Cdd:PRK04750 390 RFNVEIQPQLVLLQKTLLNVEGLGRQLDPQLDLWKTAKPFLERWMKEQVGPRALVRALKEEAPFWAEKLPELPRLVHDSL 469
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 83572016  464 DLAERGELT--LRVEPLHLRGLVRQIDR-IINKLTMSVVLLAFSIIMASLIISTALGA 518
Cdd:PRK04750 470 RQGKLLQHSvdLLAEQLRTNRLRQGQSRyLLGVGATLLLAGTLLLLSRPELMPGAAGL 527
ABC1 pfam03109
ABC1 family; This family includes ABC1 from yeast and AarF from E. coli. These proteins have a ...
109-226 1.16e-44

ABC1 family; This family includes ABC1 from yeast and AarF from E. coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and E. coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins.


Pssm-ID: 281150  Cd Length: 117  Bit Score: 155.43  E-value: 1.16e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   109 ELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLEILFDLARLAQRHTPyGKIYDFNQMA 188
Cdd:pfam03109   1 ELGAPVEEIFAEFDEEPIAAASIAQVHRAVLKDGEEVAVKVQRPGVKKRIRSDLLLLKFLAKVLERFFP-GFRLDLDWIV 79
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 83572016   189 AEFARALTEELDYTREGRNADRFRENFAGDASVYFPAV 226
Cdd:pfam03109  80 DEFRKSLPQELDFLREAANAEKFRENFADDPWVYVPKV 117
 
Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family ...
19-513 2.52e-155

Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family [Coenzyme transport and metabolism, Signal transduction mechanisms];


Pssm-ID: 223733  Cd Length: 517  Bit Score: 458.31  E-value: 2.52e-155
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  19 VLARYGFGYLLDQVGLGELILRR----------SREEAPLSLGQRLRLALEELGPTFIKLGQLLSTRPDLLPADIISELT 88
Cdd:COG0661  16 VRLRYLLGRLLRLTGRLALLLRLlswlgksklaSSEELREKRAERLRLALEELGPTFIKLGQILSTRPDLVPPEYAEELA 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  89 RLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLEILFDL 168
Cdd:COG0661  96 KLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEADLKLLRRL 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 169 ARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEYVEAVKLNN 248
Cdd:COG0661 176 ARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRVLTMEWIDGIKISD 255
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 249 LEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLPGEVIVFMDFGLTGTLTEELKEQFVNLVLGIIRRRS 328
Cdd:COG0661 256 IAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFRRYLAELLLAFLNRDY 335
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 329 QDVLRTIIAMGMVPAEVDRGALRREIEALRDKYYHLSFRQISLGQAIEELLQLAFRYHLRMPPELTLLGKTLLTLEGLVR 408
Cdd:COG0661 336 DRVAELHVELGYVPPDTDRDPLAAAIRAVLEPIYGKPLEEISFGEILDKLFEVARRFPMRLPPELVLLQRTLLLVEGVGR 415
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 409 KLDPELELAELAEPYGRELLRRRFSVRFLwRALTENLASGWEVMQSLPRQFQHLLDLAERGELTLRVEplhlrGLVRQID 488
Cdd:COG0661 416 QLDPRFNLWAVAQPLLAKWLKKQLSPKLL-RELKDEAVAVLNALPLLPRLLRDLLDNDREELSLRSSE-----ELALLLL 489
                       490       500
                ....*....|....*....|....*.
gi 83572016 489 RIINKLTM-SVVLLAFSIIMASLIIS 513
Cdd:COG0661 490 KAVARLSIgSILLVVLAVTVLLIAIL 515
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
12-438 3.97e-151

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]


Pssm-ID: 273909  Cd Length: 437  Bit Score: 444.82  E-value: 3.97e-151
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016    12 RYRQVVNVLARYGFGYLLD-QVGLGELILRR-------SREEAPLSLGQRLRLALEELGPTFIKLGQLLSTRPDLLPADI 83
Cdd:TIGR01982   3 RLRRIIRVLIRYGFLALVEsPIGPLSLRLLRrlllpfsNRENRLMSRGERLRLALEELGPTFIKFGQTLSTRADLLPADI 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016    84 ISELTRLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLE 163
Cdd:TIGR01982  83 AEELSLLQDRVPPFDFKVARKVIEAALGGPLEELFAEFEEKPLAAASIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIA 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   164 ILFDLARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEYVEA 243
Cdd:TIGR01982 163 LLYRLARIVERLSPDSRRLRPTEVVKEFEKTLRRELDLRREAANASELGENFKNDPGVYVPEVYWDRTSERVLTMEWIDG 242
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   244 VKLNNLEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLPGEVIVFMDFGLTGTLTEELKEQFVNLVLGI 323
Cdd:TIGR01982 243 IPLSDIAALDEAGLDRKALAENLARSFLNQVLRDGFFHADLHPGNIFVLKDGKIIALDFGIVGRLSEEDRRYLAEILYGF 322
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   324 IRRRSQDVLRTIIAMGMVPAEVDRGALRREIEALRDKYYHLSFRQISLGQAIEELLQLAFRYHLRMPPELTLLGKTLLTL 403
Cdd:TIGR01982 323 LNRDYRRVAEVHFDAGYVPSDTDMAEFEQAIRAIGEPIFGQPLKEISVGRLLAGLFKITRDFNMELQPQLLLLQKTLLTV 402
                         410       420       430
                  ....*....|....*....|....*....|....*
gi 83572016   404 EGLVRKLDPELELAELAEPYGRELLRRRFSVRFLW 438
Cdd:TIGR01982 403 EGVGRQLDPDLNMWKVAEPFVKRWIRKRLGPKAKI 437
ABC1_ADCK3-like cd05121
Activator of bc1 complex (ABC1) kinases (also called aarF domain containing kinase 3) and ...
89-335 1.38e-115

Activator of bc1 complex (ABC1) kinases (also called aarF domain containing kinase 3) and similar proteins; This family is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. Eukaryotes contain at least two more ABC1/ADCK3-like proteins: in humans, these are the putative atypical protein kinases named ADCK1 and ADCK2. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Eight of these plant ABC1 kinase subfamilies (ABC1K1-8) are specific for photosynthetic organisms. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270691  Cd Length: 247  Bit Score: 346.40  E-value: 1.38e-115
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  89 RLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLEILFDL 168
Cdd:cd05121   1 KLQDDVPPFPFEEVRKIIEEELGRPLEEVFAEFDPEPLAAASIAQVHRARLKDGREVAVKVQRPGIEEIIEADLRILRRL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 169 ARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEYVEAVKLNN 248
Cdd:cd05121  81 ARLLERLSPLLRRLDLVAIVDEFARSLLEELDFRREARNAERFRKNLKDSPDVYVPKVYPELSTRRVLVMEYIDGVKLTD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 249 LEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLPGEVIVFMDFGLTGTLTEELKEQFVNLVLGIIRRRS 328
Cdd:cd05121 161 LEALRAAGIDRKELARRLVDAYLKQIFEDGFFHADPHPGNILVLPDGRIALLDFGMVGRLDPETREALADLLLALVNGDA 240

                ....*..
gi 83572016 329 QDVLRTI 335
Cdd:cd05121 241 EGLAEAL 247
ubiB PRK04750
putative ubiquinone biosynthesis protein UbiB; Reviewed
1-518 1.46e-99

putative ubiquinone biosynthesis protein UbiB; Reviewed


Pssm-ID: 235310  Cd Length: 537  Bit Score: 315.31  E-value: 1.46e-99
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016    1 MSLRRRYihlnryrQVVNVLARYGfgylLDQVGLGELILRRSREEAPL-----------SLGQRLRLALEELGPTFIKLG 69
Cdd:PRK04750   2 MELFRLY-------KIIRVFLRYG----LDELILSHRLTRPLRLWRRSlfwmpnrhkdkPRGERLRLALEELGPIFVKFG 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   70 QLLSTRPDLLPADIISELTRLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPD-GSQVIVK 148
Cdd:PRK04750  71 QMLSTRRDLFPPDIADELALLQDRVPPFDGALARAIIEKALGGPVEEWFDDFDIKPLASASIAQVHFARLKDnGREVVVK 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  149 VQRPGIARQVRVDLEILFDLARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYW 228
Cdd:PRK04750 151 VLRPDILPVIDADLALMYRLARWVERLLPDGRRLKPREVVAEFEKTLHDELDLMREAANASQLRRNFEDSDMLYVPEVYW 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  229 DYTTRGVLTQEYVEAVKLNNLEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLP-----GEVIVfMDFG 303
Cdd:PRK04750 231 DYCSETVMVMERMYGIPVSDVAALRAAGTDMKLLAERGVEVFFTQVFRDGFFHADMHPGNIFVSYdppenPRYIA-LDFG 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  304 LTGTLTEELKEQFVNLVLGIIRRRSQDVLRTIIAMGMVPAEVDRGALRREIEALRDKYYHLSFRQISLGQAIEELLQLAF 383
Cdd:PRK04750 310 IVGSLNKEDKRYLAENFLAFFNRDYRRVAELHVESGWVPPDTRVEELEFAIRAVCEPIFDKPLAEISFGHVLLRLFNTAR 389
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  384 RYHLRMPPELTLLGKTLLTLEGLVRKLDPELELAELAEPYGRELLRRRFSVRFLWRALTENLASGWEVMQSLPRQFQHLL 463
Cdd:PRK04750 390 RFNVEIQPQLVLLQKTLLNVEGLGRQLDPQLDLWKTAKPFLERWMKEQVGPRALVRALKEEAPFWAEKLPELPRLVHDSL 469
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 83572016  464 DLAERGELT--LRVEPLHLRGLVRQIDR-IINKLTMSVVLLAFSIIMASLIISTALGA 518
Cdd:PRK04750 470 RQGKLLQHSvdLLAEQLRTNRLRQGQSRyLLGVGATLLLAGTLLLLSRPELMPGAAGL 527
UbiB cd13972
Ubiquinone biosynthetic protein UbiB; UbiB is the prokaryotic homolog of yeast Abc1p and human ...
89-326 1.84e-82

Ubiquinone biosynthetic protein UbiB; UbiB is the prokaryotic homolog of yeast Abc1p and human ADCK3 (aarF domain containing kinase 3). It is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is required in the first monooxygenase step in Q biosynthesis. Mutant strains with disrupted ubiB genes lack Q and accumulate octaprenylphenol, a Q biosynthetic intermediate.


Pssm-ID: 270874  Cd Length: 247  Bit Score: 260.98  E-value: 1.84e-82
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  89 RLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLEILFDL 168
Cdd:cd13972   1 KLQDRVPPFSGKEARAIIEAELGKPLDALFSDFDEEPVAAASIAQVHKARLLDGREVAVKVLRPGIEKRIERDLELLRFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 169 ARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEYVEAVKLNN 248
Cdd:cd13972  81 ARLAERLLPEARRLRPVEVVKEFARSLLLELDLRLEAANASELRENFLDDPGFYVPEVYWELTSKNVLTMEWIDGIPISD 160
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 83572016 249 LEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLPGEVIVFMDFGLTGTLTEELKEQFVNLVLGIIRR 326
Cdd:cd13972 161 IEALDAAGIDRKALAERLVEIFFRQVFRDGFFHADMHPGNIFVDPNGRIIAVDFGIMGRLDKKDRRYLAEILYGFLTR 238
ADCK1-like cd13969
aarF domain containing kinase 1 and similar proteins; This subfamily is composed of ...
90-326 2.43e-76

aarF domain containing kinase 1 and similar proteins; This subfamily is composed of uncharacterized ABC1 kinase-like proteins including the human protein called aarF domain containing kinase 1 (ADCK1). Eukaryotes contain at least three ABC1-like proteins: in humans, these are ADCK3 and the putative protein kinases named ADCK1 and ADCK2. Yeast Abc1p and its human homolog ADCK3 are atypical protein kinases required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Plant subfamilies 14 and 15 (ABC1K14-15) belong to the same group of ABC1 kinases as human ADCK1. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270871  Cd Length: 253  Bit Score: 245.09  E-value: 2.43e-76
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  90 LQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLEILFDLA 169
Cdd:cd13969   2 LQDKAPQSPYEEVRRVFKEDLGKPPEELFSEFDEEPIASASLAQVHKAKLKDGEEVAVKVQHPDLRKQFAGDLATMEFLV 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 170 RLAQRHTPYgkiYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEYVEAVKLNNL 249
Cdd:cd13969  82 NLVEKLFPD---FPFSWLVDELKKNLPKELDFLNEARNAERCAKLFKHRPDVYVPKVYWDLSSKRVLTMEFIDGIKIDDV 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 250 EEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLPGEV-----IVFMDFGLTGTLTEELKEQFVNLVLGII 324
Cdd:cd13969 159 EALKKLGIDPKEVARLLSEAFAEMIFVHGFVHCDPHPGNLLVRKNPGpgkpqIVLLDHGLYRELDEEFRLNYCRLWKALI 238

                ..
gi 83572016 325 RR 326
Cdd:cd13969 239 LG 240
ABC1_ADCK3 cd13970
Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This ...
86-339 1.30e-68

Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This subfamily is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Subfamily 13 (ABC1K13) of plant ABC1 kinases belongs in this subfamily with yeast Abc1p and human ADCK3. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270872  Cd Length: 251  Bit Score: 224.70  E-value: 1.30e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  86 ELTRLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLEIL 165
Cdd:cd13970   2 ALARLRDSAPPMPWAQLEKVLEAELGEDWRELFAEFDEEPFAAASIGQVHRATLKDGREVAVKVQYPGVAESIDSDLNNL 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 166 FDLARLAqRHTPYGKiyDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEYVEAVK 245
Cdd:cd13970  82 RRLLKLT-GLLPKGL--DLDALIAELREELLEECDYEREAANQRRFRELLADDPRFVVPEVIPELSTKRVLTTEFVDGVP 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 246 LNNLEEIDRRgySRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAVLPGE-VIVFMDFGLTGTLTEELKEQFVNLVLGII 324
Cdd:cd13970 159 LDEAADLSQE--ERNRIGELLLRLCLRELFEFGFMQTDPNPGNFLYDPEDgRLGLLDFGAVREYPPEFVDGYRRLVRAAL 236
                       250
                ....*....|....*
gi 83572016 325 RRRSQDVLRTIIAMG 339
Cdd:cd13970 237 EGDREALLEASVELG 251
ADCK2-like cd13971
aarF domain containing kinase 2 and similar proteins; This subfamily is composed of ...
89-357 1.10e-53

aarF domain containing kinase 2 and similar proteins; This subfamily is composed of uncharacterized ABC1 kinase-like proteins including the human protein called aarF domain containing kinase 2 (ADCK2). Eukaryotes contain at least three ABC1-like proteins; in humans, these are ADCK3 and the putative protein kinases named ADCK1 and ADCK2. Yeast Abc1p and its human homolog ADCK3 are atypical protein kinases required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Plant subfamily 10 (ABC1K10) belong to the same group of ABC1 kinases as human ADCK2. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270873  Cd Length: 298  Bit Score: 186.66  E-value: 1.10e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  89 RLQDRVPPFPFADVRKAVEEELGQPLEELFASFDPEPLAVASIGQVHLATL--------PDGSQVIVKVQRPGIARQVRV 160
Cdd:cd13971   1 KLHSNAPPHSWAHTERALEAAFGKDWEDIFEEFDEEPIGSGSIAQVHRAKLkpdyggdgGGPRVVAVKVLHPGVREQIER 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 161 DLEILFDLARLAQrHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVYFPAVYWDYTTRGVLTQEY 240
Cdd:cd13971  81 DLAILRLFAKLLE-AIPPLRWLSLPESVEQFASLMLRQLDLRVEAANLERFRENFKDRKDVSFPKPLYPLVTEEVLVETF 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016 241 VEAVKLNNLEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFHGDPHPGNLAV---------LPGEV--------IVFMDFG 303
Cdd:cd13971 160 EEGVPISRTVLAHGGEPLKRKLARIGLDAFLKMLFVDNFVHGDLHPGNILVrfndsnrpsLLVSLdargspprLVFLDAG 239
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*
gi 83572016 304 LTGTLTEELKEQFVNLVLGIIRRRSQDVLRTIIAMGMVPAEV-DRGALRREIEAL 357
Cdd:cd13971 240 LVTELSPQDRRNFIDLFKAVARGDGYKAAELMLERSRSSQTCpDPEGFKSEMEEL 294
ABC1 pfam03109
ABC1 family; This family includes ABC1 from yeast and AarF from E. coli. These proteins have a ...
109-226 1.16e-44

ABC1 family; This family includes ABC1 from yeast and AarF from E. coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and E. coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins.


Pssm-ID: 281150  Cd Length: 117  Bit Score: 155.43  E-value: 1.16e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   109 ELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLEILFDLARLAQRHTPyGKIYDFNQMA 188
Cdd:pfam03109   1 ELGAPVEEIFAEFDEEPIAAASIAQVHRAVLKDGEEVAVKVQRPGVKKRIRSDLLLLKFLAKVLERFFP-GFRLDLDWIV 79
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 83572016   189 AEFARALTEELDYTREGRNADRFRENFAGDASVYFPAV 226
Cdd:pfam03109  80 DEFRKSLPQELDFLREAANAEKFRENFADDPWVYVPKV 117
PRK14879 PRK14879
serine/threonine protein kinase; Provisional
224-304 1.24e-03

serine/threonine protein kinase; Provisional


Pssm-ID: 237847  Cd Length: 211  Bit Score: 40.28  E-value: 1.24e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016  224 PAVYWDYTTRGVLTQEYVEAVKLNNLeeIDRRGYSRRriavNLARAVYQQVLV---DGFFHGDPHPGNLaVLPGEVIVFM 300
Cdd:PRK14879  64 PAVYFVDPENFIIVMEYIEGEPLKDL--INSNGMEEL----ELSREIGRLVGKlhsAGIIHGDLTTSNM-ILSGGKIYLI 136

                 ....
gi 83572016  301 DFGL 304
Cdd:PRK14879 137 DFGL 140
arch_bud32 TIGR03724
Kae1-associated kinase Bud32; Members of this protein family are the Bud32 protein associated ...
216-304 3.61e-03

Kae1-associated kinase Bud32; Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine. [Unknown function, General]


Pssm-ID: 274749  Cd Length: 199  Bit Score: 38.73  E-value: 3.61e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83572016   216 AGDASVYFPAVYWDYTTRGVLTQEYVEAVKLNNLEEIDRRGYSRR--RIAVNLARAvyqqvlvdGFFHGDPHPGNLaVLP 293
Cdd:TIGR03724  54 ARKAGVNTPVIYDVDPDNKTIVMEYIEGKPLKDVIEENGDELAREigRLVGKLHKA--------GIVHGDLTTSNI-IVR 124
                          90
                  ....*....|.
gi 83572016   294 GEVIVFMDFGL 304
Cdd:TIGR03724 125 DDKVYLIDFGL 135
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH