NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|82947660|dbj|BAE52524|]
View 

Methyl-accepting chemotaxis protein [Magnetospirillum magneticum AMB-1]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal super family cl23763
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
73-267 7.49e-33

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 304920  Cd Length: 200  Bit Score: 123.50  E-value: 7.49e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  73 MAETIGLIDNAGRETRDMTVQAGHQSSESLRTVEEALSGVNQLVGAVQGIEERLEGLEGALGEVSTMSRNIQKIARQTNL 152
Cdd:cd11386   3 LSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660 153 LALNATIEAARAGEAGKGFAVVATEVKTLARQTADVTSGIDETVHKLSGSVTDLIETSTDTLKMADSVGSGVGVINQAVS 232
Cdd:cd11386  83 LALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 82947660 233 VFGDVIESVESKVGDISQAA---SASLSQCGDVIGEID 267
Cdd:cd11386 163 EIVASVEEVADGIQEISAATqeqSASTQEIAAAVEEIA 200
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
20-297 3.78e-33

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


:

Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 128.96  E-value: 3.78e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  20 TAESVDSFATEVLKQIDSLSLEVADIAGTMDGLTRFVKHQEELFGHLKMIAHAMAETIGLIDNAGRETRDMTVQAGHQSS 99
Cdd:COG0840 125 MILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAE 204
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660 100 ESLRTVEEALSGVNQLVGAVQgieERLEGLEGALGEVSTMSRNIQKIARQTNLLALNATIEAARAGEAGKGFAVVATEVK 179
Cdd:COG0840 205 EGGEEVRQAVEQMQEIAEELA---EVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVR 281
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660 180 TLARQTADVTSGIDETVHKLSGSVTDLIETSTDtlkMADSVGSGVGVINQAVSVFGDVIESVESKVGDISQAASASLSQc 259
Cdd:COG0840 282 KLAERSADSAKEIGLLIEEIQNEAADAVEHMEE---SASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQ- 357
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 82947660 260 GDVIGEIDKFFEGIAMTSESLRKADERIASllgNSEEL 297
Cdd:COG0840 358 TAVLEEINASIEELDDVTQENAAAVEELAA---ASEEL 392
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
73-267 7.49e-33

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 123.50  E-value: 7.49e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  73 MAETIGLIDNAGRETRDMTVQAGHQSSESLRTVEEALSGVNQLVGAVQGIEERLEGLEGALGEVSTMSRNIQKIARQTNL 152
Cdd:cd11386   3 LSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660 153 LALNATIEAARAGEAGKGFAVVATEVKTLARQTADVTSGIDETVHKLSGSVTDLIETSTDTLKMADSVGSGVGVINQAVS 232
Cdd:cd11386  83 LALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 82947660 233 VFGDVIESVESKVGDISQAA---SASLSQCGDVIGEID 267
Cdd:cd11386 163 EIVASVEEVADGIQEISAATqeqSASTQEIAAAVEEIA 200
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
20-297 3.78e-33

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 128.96  E-value: 3.78e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  20 TAESVDSFATEVLKQIDSLSLEVADIAGTMDGLTRFVKHQEELFGHLKMIAHAMAETIGLIDNAGRETRDMTVQAGHQSS 99
Cdd:COG0840 125 MILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAE 204
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660 100 ESLRTVEEALSGVNQLVGAVQgieERLEGLEGALGEVSTMSRNIQKIARQTNLLALNATIEAARAGEAGKGFAVVATEVK 179
Cdd:COG0840 205 EGGEEVRQAVEQMQEIAEELA---EVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVR 281
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660 180 TLARQTADVTSGIDETVHKLSGSVTDLIETSTDtlkMADSVGSGVGVINQAVSVFGDVIESVESKVGDISQAASASLSQc 259
Cdd:COG0840 282 KLAERSADSAKEIGLLIEEIQNEAADAVEHMEE---SASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQ- 357
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 82947660 260 GDVIGEIDKFFEGIAMTSESLRKADERIASllgNSEEL 297
Cdd:COG0840 358 TAVLEEINASIEELDDVTQENAAAVEELAA---ASEEL 392
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
24-299 9.03e-33

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 125.09  E-value: 9.03e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660     24 VDSFATEVLKQIDSLSLEVADIAGTMDgltrfvkhqeelfghlkmiahAMAETIGLIDNAGRETRDMTVQAGHQSSESLR 103
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERME---------------------ELSASIEEVAANADEIAATAQSAAEAAEEGRE 60
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660    104 TVEEALSGVNQLVGAVQGIEERLEGLEGALGEVSTMSRNIQKIARQTNLLALNATIEAARAGEAGKGFAVVATEVKTLAR 183
Cdd:smart00283  61 AVEDAITAMDQIREVVEEAVSAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAE 140
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660    184 QTADVTSGIDETVHKLsgsVTDLIETSTDTLKMADSVGSGVGVINQAVSVFGDVIESVE---SKVGDISQAA---SASLS 257
Cdd:smart00283 141 RSAESAKEIESLIKEI---QEETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEeiaDLVQEIAAATdeqAAGSE 217
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|..
gi 82947660    258 QCGDVIGEIDKFFEGIAMTSESLRKADERIASLLGNSEELMG 299
Cdd:smart00283 218 EVNAAIDEIAQVTQETAAMSEEISAAAEELSGLAEELDELVE 259
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
106-303 2.40e-25

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444 [Multi-domain]  Cd Length: 207  Bit Score: 102.53  E-value: 2.40e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660   106 EEALSGVNQLVGAVQGIEERLEGLEGALGEVSTMSRNIQKIARQTNLLALNATIEAARAGEAGKGFAVVATEVKTLARQT 185
Cdd:pfam00015   9 EEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERS 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660   186 ADVTSGIDETVHKLSGSVTDLIETSTDTLKMADSVGSGVGVINQAVSVFGDVIESVESKVGDISQAA---SASLSQCGDV 262
Cdd:pfam00015  89 AQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASdeqSAGIDQVNQA 168
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 82947660   263 IGEIDKFFEGIAMTSESLRKAderIASLLGNSEELMGYIAA 303
Cdd:pfam00015 169 VARIDQVTQQNAALVEESAAA---AETLEEQAEELTASVAQ 206
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
29-289 1.80e-15

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 77.42  E-value: 1.80e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660   29 TEVLKQIDSLSLEVADIAGTMDGLTRFVKHQEELFGHLKMIAHAMAETIGLIDNAGRETRDMTVQAGHQSSESLRTVEEA 108
Cdd:PRK09793 264 SDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGVQVSTM 343
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  109 LSGVNQLVGAVQGIEERLEGLEGalgevstmsrniqkIARQTNLLALNATIEAARAGEAGKGFAVVATEVKTLARQTADV 188
Cdd:PRK09793 344 THTMQEIATSSQKIGDIISVIDG--------------IAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQA 409
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  189 TSGIdetvhklsgsvTDLIETSTdtlkmaDSVGSGVGVINQAVSVFGDVIESVeSKVGDI-SQAASAS------LSQCGD 261
Cdd:PRK09793 410 AKEI-----------KGLIEESV------NRVQQGSKLVNNAAATMTDIVSSV-TRVNDImGEIASASeeqrrgIEQVAQ 471
                        250       260
                 ....*....|....*....|....*...
gi 82947660  262 VIGEIDKFFEGIAMTSESLRKADERIAS 289
Cdd:PRK09793 472 AVSQMDQVTQQNASLVEEAAVATEQLAN 499
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
73-267 7.49e-33

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 123.50  E-value: 7.49e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  73 MAETIGLIDNAGRETRDMTVQAGHQSSESLRTVEEALSGVNQLVGAVQGIEERLEGLEGALGEVSTMSRNIQKIARQTNL 152
Cdd:cd11386   3 LSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660 153 LALNATIEAARAGEAGKGFAVVATEVKTLARQTADVTSGIDETVHKLSGSVTDLIETSTDTLKMADSVGSGVGVINQAVS 232
Cdd:cd11386  83 LALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 82947660 233 VFGDVIESVESKVGDISQAA---SASLSQCGDVIGEID 267
Cdd:cd11386 163 EIVASVEEVADGIQEISAATqeqSASTQEIAAAVEEIA 200
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
20-297 3.78e-33

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 128.96  E-value: 3.78e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  20 TAESVDSFATEVLKQIDSLSLEVADIAGTMDGLTRFVKHQEELFGHLKMIAHAMAETIGLIDNAGRETRDMTVQAGHQSS 99
Cdd:COG0840 125 MILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAE 204
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660 100 ESLRTVEEALSGVNQLVGAVQgieERLEGLEGALGEVSTMSRNIQKIARQTNLLALNATIEAARAGEAGKGFAVVATEVK 179
Cdd:COG0840 205 EGGEEVRQAVEQMQEIAEELA---EVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVR 281
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660 180 TLARQTADVTSGIDETVHKLSGSVTDLIETSTDtlkMADSVGSGVGVINQAVSVFGDVIESVESKVGDISQAASASLSQc 259
Cdd:COG0840 282 KLAERSADSAKEIGLLIEEIQNEAADAVEHMEE---SASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQ- 357
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 82947660 260 GDVIGEIDKFFEGIAMTSESLRKADERIASllgNSEEL 297
Cdd:COG0840 358 TAVLEEINASIEELDDVTQENAAAVEELAA---ASEEL 392
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
24-299 9.03e-33

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 125.09  E-value: 9.03e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660     24 VDSFATEVLKQIDSLSLEVADIAGTMDgltrfvkhqeelfghlkmiahAMAETIGLIDNAGRETRDMTVQAGHQSSESLR 103
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERME---------------------ELSASIEEVAANADEIAATAQSAAEAAEEGRE 60
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660    104 TVEEALSGVNQLVGAVQGIEERLEGLEGALGEVSTMSRNIQKIARQTNLLALNATIEAARAGEAGKGFAVVATEVKTLAR 183
Cdd:smart00283  61 AVEDAITAMDQIREVVEEAVSAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAE 140
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660    184 QTADVTSGIDETVHKLsgsVTDLIETSTDTLKMADSVGSGVGVINQAVSVFGDVIESVE---SKVGDISQAA---SASLS 257
Cdd:smart00283 141 RSAESAKEIESLIKEI---QEETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEeiaDLVQEIAAATdeqAAGSE 217
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|..
gi 82947660    258 QCGDVIGEIDKFFEGIAMTSESLRKADERIASLLGNSEELMG 299
Cdd:smart00283 218 EVNAAIDEIAQVTQETAAMSEEISAAAEELSGLAEELDELVE 259
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
106-303 2.40e-25

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444 [Multi-domain]  Cd Length: 207  Bit Score: 102.53  E-value: 2.40e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660   106 EEALSGVNQLVGAVQGIEERLEGLEGALGEVSTMSRNIQKIARQTNLLALNATIEAARAGEAGKGFAVVATEVKTLARQT 185
Cdd:pfam00015   9 EEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERS 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660   186 ADVTSGIDETVHKLSGSVTDLIETSTDTLKMADSVGSGVGVINQAVSVFGDVIESVESKVGDISQAA---SASLSQCGDV 262
Cdd:pfam00015  89 AQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASdeqSAGIDQVNQA 168
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 82947660   263 IGEIDKFFEGIAMTSESLRKAderIASLLGNSEELMGYIAA 303
Cdd:pfam00015 169 VARIDQVTQQNAALVEESAAA---AETLEEQAEELTASVAQ 206
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
29-289 1.80e-15

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 77.42  E-value: 1.80e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660   29 TEVLKQIDSLSLEVADIAGTMDGLTRFVKHQEELFGHLKMIAHAMAETIGLIDNAGRETRDMTVQAGHQSSESLRTVEEA 108
Cdd:PRK09793 264 SDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGVQVSTM 343
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  109 LSGVNQLVGAVQGIEERLEGLEGalgevstmsrniqkIARQTNLLALNATIEAARAGEAGKGFAVVATEVKTLARQTADV 188
Cdd:PRK09793 344 THTMQEIATSSQKIGDIISVIDG--------------IAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQA 409
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  189 TSGIdetvhklsgsvTDLIETSTdtlkmaDSVGSGVGVINQAVSVFGDVIESVeSKVGDI-SQAASAS------LSQCGD 261
Cdd:PRK09793 410 AKEI-----------KGLIEESV------NRVQQGSKLVNNAAATMTDIVSSV-TRVNDImGEIASASeeqrrgIEQVAQ 471
                        250       260
                 ....*....|....*....|....*...
gi 82947660  262 VIGEIDKFFEGIAMTSESLRKADERIAS 289
Cdd:PRK09793 472 AVSQMDQVTQQNASLVEEAAVATEQLAN 499
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
70-327 3.91e-15

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 76.20  E-value: 3.91e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660   70 AHAMAETIGLIDNAGRETRDMTVQAGHQSSESLRTVEEALSGVNQLVGAVQGIEErlegLEGALGEVSTMSRNIQKIARQ 149
Cdd:PRK15048 297 ASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHE----IADSSKKIADIISVIDGIAFQ 372
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  150 TNLLALNATIEAARAGEAGKGFAVVATEVKTLARQTA----DVTSGIDETVHKL-SGSVtdLIETSTDTlkMADSVGSgv 224
Cdd:PRK15048 373 TNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAqaakEIKALIEDSVSRVdTGSV--LVESAGET--MNNIVNA-- 446
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  225 gvINQAVSVFGDVIESVESKVGDISQAASAslsqcgdvIGEIDKFF-EGIAMTSESLRKAderiASLLGNSEELMgyIAA 303
Cdd:PRK15048 447 --VTRVTDIMGEIASASDEQSRGIDQVALA--------VSEMDRVTqQNASLVQESAAAA----AALEEQASRLT--QAV 510
                        250       260
                 ....*....|....*....|....
gi 82947660  304 SGFRTADTPFIEAIQSAARQVTAA 327
Cdd:PRK15048 511 SAFRLAASPLTNKPQTPSRPASEQ 534
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
143-268 2.18e-14

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 73.84  E-value: 2.18e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947660  143 IQKIARQTNLLALNATIEAARAGEAGKGFAVVATEVKTLARQTA----DVTSGIDETVHKLSGSVTdlietstdtlkMAD 218
Cdd:PRK15041 368 IDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAqaarEIKSLIEDSVGKVDVGST-----------LVE 436
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 82947660  219 SVGSGVGVINQAVSVFGDVIESVESKvgdiSQAASASLSQCGDVIGEIDK 268
Cdd:PRK15041 437 SAGETMAEIVSAVTRVTDIMGEIASA----SDEQSRGIDQVGLAVAEMDR 482
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH