NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|82947132|dbj|BAE51996|]
View 

Methyl-accepting chemotaxis protein [Magnetospirillum magneticum AMB-1]

Protein Classification

MCP_signal and CZB domain-containing protein (domain architecture ID 11949343)

MCP_signal and CZB domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCPsignal super family cl28165
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
100-359 1.13e-44

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


The actual alignment was detected with superfamily member smart00283:

Pssm-ID: 332985  Cd Length: 262  Bit Score: 159.37  E-value: 1.13e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132    100 AVTKAAGMMRD-VGEVDRRAQAIAVAAEQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQAIAEAVQAAA 178
Cdd:smart00283   1 DVSEAVEEIAAgAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132    179 GKVDSLAEASVQIGDIVNQIEDIASQTNLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIESLRVEM 258
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132    259 GEIVRTMQDGAGAVEHGKEVISATSDGMGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIAGLSARNVAtindV 338
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAA----M 236
                          250       260
                   ....*....|....*....|.
gi 82947132    339 VEEMDGASKGIVAALNEMAAL 359
Cdd:smart00283 237 SEEISAAAEELSGLAEELDEL 257
CZB pfam13682
Chemoreceptor zinc-binding domain; The chemoreceptor zinc-binding domain (CZB) is found in ...
373-439 2.54e-18

Chemoreceptor zinc-binding domain; The chemoreceptor zinc-binding domain (CZB) is found in bacterial signal transduction proteins - most frequently receptors involved in chemotaxis and motility, but also in c-di-GMP signalling and nitrate/nitrite-sensing. Originally discovered in the cytoplasmic chemoreceptor TlpD from Helicobacter pylori, it is often found C-terminal to the MCPsignal domain in cytoplasmic chemoreceptor proteins. The CZB domain contains a core sequence motif, Hxx[WFYL]x21-28Cx[LFMVI]Gx[WFLVI]x18-27HxxxH. The highly-conserved H-C-H-H residues of this motif are believed to coordinate zinc; mutating the latter two histidines of the motif to alanines abolishes Zn binding. This domain binds zinc with high affinity, with a Kd in the femtomolar range. Although the function of the CZB domain is not yet known, scientists have speculated that it may function as either an unknown signal input domain, based on its frequent association with signalling output domains, or as a domain that helps to stabilize protein tertiary or quaternary structure.


:

Pssm-ID: 316224  Cd Length: 66  Bit Score: 80.27  E-value: 2.54e-18
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 82947132   373 HMLWRKRLADMVVGREVlNPDDLADHTKCRLGKWCSTLTDESILRHPAYAALEAPHREVHRNGIDAA 439
Cdd:pfam13682   1 HLLWKNRLYKALEGGEV-DPEELADHHQCRLGKWYYGEGGERFGGLPAFKELEEPHKEVHELAAEIV 66
 
Name Accession Description Interval E-value
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
100-359 1.13e-44

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 159.37  E-value: 1.13e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132    100 AVTKAAGMMRD-VGEVDRRAQAIAVAAEQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQAIAEAVQAAA 178
Cdd:smart00283   1 DVSEAVEEIAAgAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132    179 GKVDSLAEASVQIGDIVNQIEDIASQTNLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIESLRVEM 258
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132    259 GEIVRTMQDGAGAVEHGKEVISATSDGMGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIAGLSARNVAtindV 338
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAA----M 236
                          250       260
                   ....*....|....*....|.
gi 82947132    339 VEEMDGASKGIVAALNEMAAL 359
Cdd:smart00283 237 SEEISAAAEELSGLAEELDEL 257
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
126-325 4.06e-42

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 150.47  E-value: 4.06e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132 126 EQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQAIAEAVQAAAGKVDSLAEASVQIGDIVNQIEDIASQT 205
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132 206 NLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIESLRVEMGEIVRTMQDGAGAVEHGKEVISATSDG 285
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 82947132 286 MGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIA 325
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
93-340 2.91e-38

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 145.13  E-value: 2.91e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132  93 LSVNVNEAVTKAAGMMRDVGEVDRRAQAIAVAAEQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQAIAE 172
Cdd:COG0840 143 LSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAE 222
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132 173 AVQAaagKVDSLAEASVQIGDIVNQIEDIASQTNLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIE 252
Cdd:COG0840 223 ELAE---VVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIE 299
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132 253 SLRVEMGEIVRTMQDGAGAVEHGKEVISATSDGMGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIAGLSARNV 332
Cdd:COG0840 300 EIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENA 379

                ....*...
gi 82947132 333 ATINDVVE 340
Cdd:COG0840 380 AAVEELAA 387
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
159-358 7.74e-31

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 119.09  E-value: 7.74e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132   159 AADQAIGAMQAIAEAVQAAAGKVDSLAEASVQIGDIVNQIEDIASQTNLLALNATIEAARAGEAGKGFAVVANEVKNLAN 238
Cdd:pfam00015   7 ASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAE 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132   239 QTARATVDIRARIESLRVEMGEIVRTMQDGAGAVEHGKEVISATSDGMGRLSTQVQGVSVKMAQIAGILNQQSAASAEVA 318
Cdd:pfam00015  87 RSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSAGIDQVN 166
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 82947132   319 EGVGAIAGLSARNVATindvVEEMDGASkgivAALNEMAA 358
Cdd:pfam00015 167 QAVARIDQVTQQNAAL----VEESAAAA----ETLEEQAE 198
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
126-359 1.81e-23

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 103.23  E-value: 1.81e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132  126 EQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQAIAEAVQAAAGKVDSLAEASVQIGDIVNQIEDIASQT 205
Cdd:PRK09793 292 EQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQT 371
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132  206 NLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIEslrvemgEIVRTMQDGAGAVEhgkevisATSDG 285
Cdd:PRK09793 372 NILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIE-------ESVNRVQQGSKLVN-------NAAAT 437
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 82947132  286 MGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIAGLSARNVAtindVVEEMDGASKGIVAALNEMAAL 359
Cdd:PRK09793 438 MTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQNAS----LVEEAAVATEQLANQADHLSSR 507
CZB pfam13682
Chemoreceptor zinc-binding domain; The chemoreceptor zinc-binding domain (CZB) is found in ...
373-439 2.54e-18

Chemoreceptor zinc-binding domain; The chemoreceptor zinc-binding domain (CZB) is found in bacterial signal transduction proteins - most frequently receptors involved in chemotaxis and motility, but also in c-di-GMP signalling and nitrate/nitrite-sensing. Originally discovered in the cytoplasmic chemoreceptor TlpD from Helicobacter pylori, it is often found C-terminal to the MCPsignal domain in cytoplasmic chemoreceptor proteins. The CZB domain contains a core sequence motif, Hxx[WFYL]x21-28Cx[LFMVI]Gx[WFLVI]x18-27HxxxH. The highly-conserved H-C-H-H residues of this motif are believed to coordinate zinc; mutating the latter two histidines of the motif to alanines abolishes Zn binding. This domain binds zinc with high affinity, with a Kd in the femtomolar range. Although the function of the CZB domain is not yet known, scientists have speculated that it may function as either an unknown signal input domain, based on its frequent association with signalling output domains, or as a domain that helps to stabilize protein tertiary or quaternary structure.


Pssm-ID: 316224  Cd Length: 66  Bit Score: 80.27  E-value: 2.54e-18
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 82947132   373 HMLWRKRLADMVVGREVlNPDDLADHTKCRLGKWCSTLTDESILRHPAYAALEAPHREVHRNGIDAA 439
Cdd:pfam13682   1 HLLWKNRLYKALEGGEV-DPEELADHHQCRLGKWYYGEGGERFGGLPAFKELEEPHKEVHELAAEIV 66
PRK09894 PRK09894
diguanylate cyclase; Provisional
373-435 4.87e-05

diguanylate cyclase; Provisional


Pssm-ID: 182133  Cd Length: 296  Bit Score: 45.06  E-value: 4.87e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 82947132  373 HMLWRKRLADMVVGREVLNPDDLAD--HTKCRLGKWCSTLTDESILRHPAYAALEAPHREVHRNG 435
Cdd:PRK09894  22 HYQWLVSMFRSVVARDASKPEITDNhsHGLCQFGRWIDHLGPLDNDELPYVRLLDSAHQHMHNCA 86
 
Name Accession Description Interval E-value
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
100-359 1.13e-44

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 159.37  E-value: 1.13e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132    100 AVTKAAGMMRD-VGEVDRRAQAIAVAAEQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQAIAEAVQAAA 178
Cdd:smart00283   1 DVSEAVEEIAAgAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132    179 GKVDSLAEASVQIGDIVNQIEDIASQTNLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIESLRVEM 258
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132    259 GEIVRTMQDGAGAVEHGKEVISATSDGMGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIAGLSARNVAtindV 338
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAA----M 236
                          250       260
                   ....*....|....*....|.
gi 82947132    339 VEEMDGASKGIVAALNEMAAL 359
Cdd:smart00283 237 SEEISAAAEELSGLAEELDEL 257
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
126-325 4.06e-42

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 150.47  E-value: 4.06e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132 126 EQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQAIAEAVQAAAGKVDSLAEASVQIGDIVNQIEDIASQT 205
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132 206 NLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIESLRVEMGEIVRTMQDGAGAVEHGKEVISATSDG 285
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 82947132 286 MGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIA 325
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
93-340 2.91e-38

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 145.13  E-value: 2.91e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132  93 LSVNVNEAVTKAAGMMRDVGEVDRRAQAIAVAAEQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQAIAE 172
Cdd:COG0840 143 LSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAE 222
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132 173 AVQAaagKVDSLAEASVQIGDIVNQIEDIASQTNLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIE 252
Cdd:COG0840 223 ELAE---VVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIE 299
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132 253 SLRVEMGEIVRTMQDGAGAVEHGKEVISATSDGMGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIAGLSARNV 332
Cdd:COG0840 300 EIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENA 379

                ....*...
gi 82947132 333 ATINDVVE 340
Cdd:COG0840 380 AAVEELAA 387
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
159-358 7.74e-31

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 119.09  E-value: 7.74e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132   159 AADQAIGAMQAIAEAVQAAAGKVDSLAEASVQIGDIVNQIEDIASQTNLLALNATIEAARAGEAGKGFAVVANEVKNLAN 238
Cdd:pfam00015   7 ASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAE 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132   239 QTARATVDIRARIESLRVEMGEIVRTMQDGAGAVEHGKEVISATSDGMGRLSTQVQGVSVKMAQIAGILNQQSAASAEVA 318
Cdd:pfam00015  87 RSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSAGIDQVN 166
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 82947132   319 EGVGAIAGLSARNVATindvVEEMDGASkgivAALNEMAA 358
Cdd:pfam00015 167 QAVARIDQVTQQNAAL----VEESAAAA----ETLEEQAE 198
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
126-359 1.81e-23

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 103.23  E-value: 1.81e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132  126 EQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQAIAEAVQAAAGKVDSLAEASVQIGDIVNQIEDIASQT 205
Cdd:PRK09793 292 EQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQT 371
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132  206 NLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIEslrvemgEIVRTMQDGAGAVEhgkevisATSDG 285
Cdd:PRK09793 372 NILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIE-------ESVNRVQQGSKLVN-------NAAAT 437
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 82947132  286 MGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIAGLSARNVAtindVVEEMDGASKGIVAALNEMAAL 359
Cdd:PRK09793 438 MTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQNAS----LVEEAAVATEQLANQADHLSSR 507
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
122-358 4.89e-23

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 101.95  E-value: 4.89e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132  122 AVAAEQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQaiaeavqaaagkvdSLAEASVQIGDIVNQIEDI 201
Cdd:PRK15041 306 AASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMR--------------DISTSSQKIADIISVIDGI 371
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132  202 ASQTNLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIEslrvemgeivrtmqDGAGAVEHGKEVISA 281
Cdd:PRK15041 372 AFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIE--------------DSVGKVDVGSTLVES 437
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 82947132  282 TSDGMGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIAGLSARNVAtindVVEEMDGASkgivAALNEMAA 358
Cdd:PRK15041 438 AGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAA----LVEESAAAA----AALEEQAS 506
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
122-358 3.25e-22

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 99.70  E-value: 3.25e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132  122 AVAAEQLVSSVAEIARTSKAAAEDAGAAESVAQESHGAADQAIGAMQaiaeavqaaagkvdSLAEASVQIGDIVNQIEDI 201
Cdd:PRK15048 304 AASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMH--------------EIADSSKKIADIISVIDGI 369
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82947132  202 ASQTNLLALNATIEAARAGEAGKGFAVVANEVKNLANQTARATVDIRARIEslrvemgeivrtmqDGAGAVEHGKEVISA 281
Cdd:PRK15048 370 AFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIE--------------DSVSRVDTGSVLVES 435
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 82947132  282 TSDGMGRLSTQVQGVSVKMAQIAGILNQQSAASAEVAEGVGAIAGLSARNVATINDvveemdgaSKGIVAALNEMAA 358
Cdd:PRK15048 436 AGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQE--------SAAAAAALEEQAS 504
CZB pfam13682
Chemoreceptor zinc-binding domain; The chemoreceptor zinc-binding domain (CZB) is found in ...
373-439 2.54e-18

Chemoreceptor zinc-binding domain; The chemoreceptor zinc-binding domain (CZB) is found in bacterial signal transduction proteins - most frequently receptors involved in chemotaxis and motility, but also in c-di-GMP signalling and nitrate/nitrite-sensing. Originally discovered in the cytoplasmic chemoreceptor TlpD from Helicobacter pylori, it is often found C-terminal to the MCPsignal domain in cytoplasmic chemoreceptor proteins. The CZB domain contains a core sequence motif, Hxx[WFYL]x21-28Cx[LFMVI]Gx[WFLVI]x18-27HxxxH. The highly-conserved H-C-H-H residues of this motif are believed to coordinate zinc; mutating the latter two histidines of the motif to alanines abolishes Zn binding. This domain binds zinc with high affinity, with a Kd in the femtomolar range. Although the function of the CZB domain is not yet known, scientists have speculated that it may function as either an unknown signal input domain, based on its frequent association with signalling output domains, or as a domain that helps to stabilize protein tertiary or quaternary structure.


Pssm-ID: 316224  Cd Length: 66  Bit Score: 80.27  E-value: 2.54e-18
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 82947132   373 HMLWRKRLADMVVGREVlNPDDLADHTKCRLGKWCSTLTDESILRHPAYAALEAPHREVHRNGIDAA 439
Cdd:pfam13682   1 HLLWKNRLYKALEGGEV-DPEELADHHQCRLGKWYYGEGGERFGGLPAFKELEEPHKEVHELAAEIV 66
PRK09894 PRK09894
diguanylate cyclase; Provisional
373-435 4.87e-05

diguanylate cyclase; Provisional


Pssm-ID: 182133  Cd Length: 296  Bit Score: 45.06  E-value: 4.87e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 82947132  373 HMLWRKRLADMVVGREVLNPDDLAD--HTKCRLGKWCSTLTDESILRHPAYAALEAPHREVHRNG 435
Cdd:PRK09894  22 HYQWLVSMFRSVVARDASKPEITDNhsHGLCQFGRWIDHLGPLDNDELPYVRLLDSAHQHMHNCA 86
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH