NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7949045|ref|NP_058030|]
View 

histone H2A.Z isoform 1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
H2A super family cl25693
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
6-121 3.15e-62

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


The actual alignment was detected with superfamily member PLN00154:

Pssm-ID: 330514  Cd Length: 136  Bit Score: 190.16  E-value: 3.15e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045     6 AGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPR 85
Cdd:PLN00154  17 AAAKKDKDKKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRITPR 96
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 7949045    86 HLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK 121
Cdd:PLN00154  97 HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK 132
 
Name Accession Description Interval E-value
PLN00154 PLN00154
histone H2A; Provisional
6-121 3.15e-62

histone H2A; Provisional


Pssm-ID: 177756  Cd Length: 136  Bit Score: 190.16  E-value: 3.15e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045     6 AGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPR 85
Cdd:PLN00154  17 AAAKKDKDKKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRITPR 96
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 7949045    86 HLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK 121
Cdd:PLN00154  97 HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK 132
H2A cd00074
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
8-122 4.90e-59

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


Pssm-ID: 238029  Cd Length: 115  Bit Score: 181.38  E-value: 4.90e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045    8 KDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTShGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHL 87
Cdd:cd00074   1 KGGGKKKSKKRSRSARAGLQFPVGRIHRYLKKGRYA-ERVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKKRITPRHL 79
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 7949045   88 QLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 122
Cdd:cd00074  80 QLAVRNDEELNKLLKgVTIASGGVLPNIHKVLLPKK 115
H2A smart00414
Histone 2A;
19-124 8.50e-57

Histone 2A;


Pssm-ID: 197711  Cd Length: 106  Bit Score: 175.21  E-value: 8.50e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045      19 SRSQRAGLQFPVGRIHRHLKSRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELD 98
Cdd:smart00414   1 SRSARAGLQFPVGRIHRLLRKGTYAK-RVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKRRITPRHLQLAIRNDEELN 79
                           90       100
                   ....*....|....*....|....*..
gi 7949045      99 SLIKA-TIAGGGVIPHIHKSLIGKKGQ 124
Cdd:smart00414  80 KLLKGvTIAQGGVLPNIHKVLLPKKTG 106
HTA1 COG5262
Histone H2A [Chromatin structure and dynamics];
1-122 9.00e-43

Histone H2A [Chromatin structure and dynamics];


Pssm-ID: 227587  Cd Length: 132  Bit Score: 140.38  E-value: 9.00e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045    1 MAGGKAGKDSGKakTKAVSRSQRAGLQFPVGRIHRHLKsRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 80
Cdd:COG5262   2 VSGGKGGKAADA--RVSQSRSAKAGLIFPVGRVKRLLK-KGNYRMRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKK 78
                        90       100       110       120
                ....*....|....*....|....*....|....*....|...
gi 7949045   81 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 122
Cdd:COG5262  79 RIIPRHLQLAIRNDEELNKLLGdVTIAQGGVLPNINPGLLPKS 121
Histone pfam00125
Core histone H2A/H2B/H3/H4;
5-94 4.03e-17

Core histone H2A/H2B/H3/H4;


Pssm-ID: 306605  Cd Length: 127  Bit Score: 73.22  E-value: 4.03e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045      5 KAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 84
Cdd:pfam00125  38 RPGTVALKEIRKYQKSTDLLIYKLPFARVVREIVKSSKTDLRISADAVVALQEALEDYLVELFEDANLLAKHAKRVTITP 117
                          90
                  ....*....|
gi 7949045     85 RHLQLAIRGD 94
Cdd:pfam00125 118 KDIQLARRLR 127
 
Name Accession Description Interval E-value
PLN00154 PLN00154
histone H2A; Provisional
6-121 3.15e-62

histone H2A; Provisional


Pssm-ID: 177756  Cd Length: 136  Bit Score: 190.16  E-value: 3.15e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045     6 AGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPR 85
Cdd:PLN00154  17 AAAKKDKDKKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRITPR 96
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 7949045    86 HLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK 121
Cdd:PLN00154  97 HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK 132
PTZ00017 PTZ00017
histone H2A; Provisional
3-128 6.27e-61

histone H2A; Provisional


Pssm-ID: 185399  Cd Length: 134  Bit Score: 186.87  E-value: 6.27e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045     3 GGKAGKDSGKAKT-KAVSRSQRAGLQFPVGRIHRHLKSRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKR 81
Cdd:PTZ00017   2 GGKGKTGGGKAGKkKPVSRSAKAGLQFPVGRVHRYLKKGRYAK-RVGAGAPVYLAAVLEYLTAEVLELAGNAAKDNKKKR 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 7949045    82 ITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKKGQQKTV 128
Cdd:PTZ00017  81 ITPRHIQLAIRNDEELNKLLaGVTIASGGVLPNIHKVLLPKKSKPKQG 128
H2A cd00074
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
8-122 4.90e-59

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


Pssm-ID: 238029  Cd Length: 115  Bit Score: 181.38  E-value: 4.90e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045    8 KDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTShGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHL 87
Cdd:cd00074   1 KGGGKKKSKKRSRSARAGLQFPVGRIHRYLKKGRYA-ERVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKKRITPRHL 79
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 7949045   88 QLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 122
Cdd:cd00074  80 QLAVRNDEELNKLLKgVTIASGGVLPNIHKVLLPKK 115
H2A smart00414
Histone 2A;
19-124 8.50e-57

Histone 2A;


Pssm-ID: 197711  Cd Length: 106  Bit Score: 175.21  E-value: 8.50e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045      19 SRSQRAGLQFPVGRIHRHLKSRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELD 98
Cdd:smart00414   1 SRSARAGLQFPVGRIHRLLRKGTYAK-RVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKRRITPRHLQLAIRNDEELN 79
                           90       100
                   ....*....|....*....|....*..
gi 7949045      99 SLIKA-TIAGGGVIPHIHKSLIGKKGQ 124
Cdd:smart00414  80 KLLKGvTIAQGGVLPNIHKVLLPKKTG 106
HTA1 COG5262
Histone H2A [Chromatin structure and dynamics];
1-122 9.00e-43

Histone H2A [Chromatin structure and dynamics];


Pssm-ID: 227587  Cd Length: 132  Bit Score: 140.38  E-value: 9.00e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045    1 MAGGKAGKDSGKakTKAVSRSQRAGLQFPVGRIHRHLKsRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 80
Cdd:COG5262   2 VSGGKGGKAADA--RVSQSRSAKAGLIFPVGRVKRLLK-KGNYRMRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKK 78
                        90       100       110       120
                ....*....|....*....|....*....|....*....|...
gi 7949045   81 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 122
Cdd:COG5262  79 RIIPRHLQLAIRNDEELNKLLGdVTIAQGGVLPNINPGLLPKS 121
PLN00157 PLN00157
histone H2A; Provisional
3-127 7.36e-41

histone H2A; Provisional


Pssm-ID: 177758  Cd Length: 132  Bit Score: 135.36  E-value: 7.36e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045     3 GGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 82
Cdd:PLN00157   2 SGRGKRKGGGGGKKATSRSAKAGLQFPVGRIARYLKAGKYAT-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRI 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 7949045    83 TPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQKT 127
Cdd:PLN00157  81 VPRHIQLAVRNDEELSKLLGgVTIAAGGVLPNIHSVLLPKKSGKSK 126
PLN00156 PLN00156
histone H2AX; Provisional
1-125 6.05e-39

histone H2AX; Provisional


Pssm-ID: 215080  Cd Length: 139  Bit Score: 130.47  E-value: 6.05e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045     1 MAGGKAGKDSGKAK-TKAVSRSQRAGLQFPVGRIHRHLKSRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKV 79
Cdd:PLN00156   2 AGSGTTKGGRGKPKaTKSVSRSSKAGLQFPVGRIARFLKAGKYAE-RVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKK 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 7949045    80 KRITPRHLQLAIRGDEELDSLIKA-TIAGGGVIPHIHKSLIGKKGQQ 125
Cdd:PLN00156  81 NRIVPRHIQLAVRNDEELSKLLGSvTIAAGGVLPNIHQTLLPKKVGK 127
PLN00153 PLN00153
histone H2A; Provisional
1-122 4.03e-34

histone H2A; Provisional


Pssm-ID: 165721  Cd Length: 129  Bit Score: 117.90  E-value: 4.03e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045     1 MAGGKAGKDSGKaktKAVSRSQRAGLQFPVGRIHRHLKSRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 80
Cdd:PLN00153   1 MAGRGKGKTSGK---KAVSRSAKAGLQFPVGRIARYLKKGKYAE-RIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKN 76
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 7949045    81 RITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 122
Cdd:PLN00153  77 RIVPRHIQLAIRNDEELGKLLgEVTIASGGVLPNIHAVLLPKK 119
PTZ00252 PTZ00252
histone H2A; Provisional
12-126 4.31e-21

histone H2A; Provisional


Pssm-ID: 240330  Cd Length: 134  Bit Score: 84.24  E-value: 4.31e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045    12 KAKTKAVSRSQRAGLQFPVGRIHRHLKsRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNAS--KDLKVKRITPRHLQL 89
Cdd:PTZ00252  10 KASKSGSGRSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAAaqQAKKPKRLTPRTVTL 88
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 7949045    90 AIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGK-KGQQK 126
Cdd:PTZ00252  89 AVRHDDDLGSLLKnVTLSRGGVMPSLNKALAKKhKSGKK 127
Histone pfam00125
Core histone H2A/H2B/H3/H4;
5-94 4.03e-17

Core histone H2A/H2B/H3/H4;


Pssm-ID: 306605  Cd Length: 127  Bit Score: 73.22  E-value: 4.03e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7949045      5 KAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 84
Cdd:pfam00125  38 RPGTVALKEIRKYQKSTDLLIYKLPFARVVREIVKSSKTDLRISADAVVALQEALEDYLVELFEDANLLAKHAKRVTITP 117
                          90
                  ....*....|
gi 7949045     85 RHLQLAIRGD 94
Cdd:pfam00125 118 KDIQLARRLR 127
PLN00155 PLN00155
histone H2A; Provisional
1-62 1.07e-11

histone H2A; Provisional


Pssm-ID: 165723  Cd Length: 58  Bit Score: 57.02  E-value: 1.07e-11
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7949045     1 MAGGKAGKDSGKaktKAVSRSQRAGLQFPVGRIHRHLKSRTTSHgRVGATAAVYSAAILEYL 62
Cdd:PLN00155   1 MAGRGKGKTSGK---KAVSRSAKAGLQFPVGRIARYLKKGKYAE-RIGAGAPVYLAAVLEYL 58
Histone_H2A_C pfam16211
C-terminus of histone H2A;
95-127 2.99e-09

C-terminus of histone H2A;


Pssm-ID: 318451  Cd Length: 34  Bit Score: 49.74  E-value: 2.99e-09
                          10        20        30
                  ....*....|....*....|....*....|....
gi 7949045     95 EELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQKT 127
Cdd:pfam16211   1 EELNKLLGgVTIAQGGVLPNIHAVLLPKKTKKKK 34
BUR6 COG5247
Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription];
27-100 4.77e-05

Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription];


Pssm-ID: 227572  Cd Length: 113  Bit Score: 39.56  E-value: 4.77e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 7949045   27 QFPVGRIHRHLKSrTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL 100
Cdd:COG5247  23 RFPIARLKKIMQL-DEDIGKVGQSTPVIASKALEMFLTEIVGLSLKEARKKSSKRMTSEFLKRATESDEKFDFL 95
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH