NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7297300|gb|AAF52563|]
View 

Protein Classification

Laminin_N and EGF_Lam domain-containing protein (domain architecture ID 13614451)

protein containing domains Laminin_N, EGF_Lam, COG6, and ApoLp-III_like

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Laminin_N pfam00055
Laminin N-terminal (Domain VI);
63-286 9.33e-97

Laminin N-terminal (Domain VI);


:

Pssm-ID: 333803  Cd Length: 223  Bit Score: 310.99  E-value: 9.33e-97
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300      63 IGREnrLTASSTCGLHSPERFCILSHLQD--KKCFLCDTReetkhDPYKNHRIGQIIYKTKPGTNipTWWQSENG---KE 137
Cdd:pfam00055    1 FGRE--VEASSTCGLNGPERYCKLSGLAGggKKCFICDSR-----DPYLSHPIENLTDSNNRGNE--TWWQSETGvggYN 71
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300     138 NATIQLDLEAEFHFTHLIITFTTFRPAAMYIERSFDFGQTWHIYRYFAYDCKESFPGVPTVLENIT---DVMCTSRYSNV 214
Cdd:pfam00055   72 NVTLTLDLGKEFEITYVILKFKSPRPAAMVIERSTDFGKTWQPYQYFASDCRRTFGLPEGPPRSITnedEVICTSRYSDI 151
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 7297300     215 EPSRNGEVIFRVL--PPNINVTDpYAEHVQNQLKMTNLRIQMTKLHKLGDNLLDSRLENeEKYYYGISNMVVRG 286
Cdd:pfam00055  152 SPLTGGEVIFSTLegRPSAKNFD-YSPELQDWVTATNIRIRFLRLHTLGDELLDDPTVL-RSYYYAISDISVGG 223
Mplasa_alph_rch super family cl37461
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
1228-1771 4.64e-19

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


The actual alignment was detected with superfamily member TIGR04523:

Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 93.55  E-value: 4.64e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1228 SEFSELDKKLQHIRNLLQNTSVSLVDIEKLDYETQSlrdQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQNHSRLV- 1306
Cdd:TIGR04523   33 TEEKQLEKKLKTIKNELKNKEKELKNLDKNLNKDEE---KINNSNNKIKILEQQIKDLNDKLKKNKDKINKLNSDLSKIn 109
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1307 -------QQLSK---ELKENGIQLQESNIEGALNLTRhayervsnLSTLKDEANELASNTDRNCKRVENLSNKIQAEADD 1376
Cdd:TIGR04523  110 seikndkEQKNKlevELNKLEKQKKENKKNIDKFLTE--------IKKKEKELEKLNNKYNDLKKQKEELENELNLLEKE 181
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1377 LANNNKLIEDYRAELT-----------------SLTSQIPELNNQVcgkpgdpcdslcggagcghcggflscehgakths 1439
Cdd:TIGR04523  182 KLNIQKNIDKIKNKLLklelllsnlkkkiqknkSLESQISELKKQN---------------------------------- 227
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1440 eealkvaKDAETAITSKKDQADQTIRAL--TQAKLN-ASEAYEKAKRGFEQSERYLNQTNANIKLAENLFIALNNFQE-- 1514
Cdd:TIGR04523  228 -------NQLKDNIEKKQQEINEKTTEIsnTQTQLNqLKDEQNKIKKQLSEKQKELEQNNKKIKELEKQLNQLKSEISdl 300
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1515 NKTASPSESKELAQKTLDLDLKLEpeEIETLGDQINRAVSSLKNVEAIIYRTKPDLDrvNNLQSIANATKEKADKIldsa 1594
Cdd:TIGR04523  301 NNQKEQDWNKELKSELKNQEKKLE--EIQNQISQNNKIISQLNEQISQLKKELTNSE--SENSEKQRELEEKQNEI---- 372
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1595 nsvvESLAaaDESQGKaKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEI 1674
Cdd:TIGR04523  373 ----EKLK--KENQSY-KQEIKNLESQINDLESKIQNQEKLNQQKDEQIKKLQQEKELLEKEIERLKETIIKNNSEIKDL 445
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1675 TKEAGSVKLEAmrargeaNNLQSATSATNQTLtDRASRS-----ENARERAKQLLQRASKL------TVDTNAKLKDLND 1743
Cdd:TIGR04523  446 TNQDSVKELII-------KNLDNTRESLETQL-KVLSRSinkikQNLEQKQKELKSKEKELkklneeKKELEEKVKDLTK 517
                          570       580       590
                   ....*....|....*....|....*....|..
gi 7297300    1744 LQTVYLNKNQQL----LRLQAEIGPLNKELNE 1771
Cdd:TIGR04523  518 KISSLKEKIEKLesekKEKESKISDLEDELNK 549
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1094-1142 1.05e-14

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


:

Pssm-ID: 333801  Cd Length: 49  Bit Score: 69.71  E-value: 1.05e-14
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300    1094 CNCDPIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNPNEKCQPC 1142
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
789-834 2.30e-14

Laminin-type epidermal growth factor-like domai;


:

Pssm-ID: 214543  Cd Length: 46  Bit Score: 68.49  E-value: 2.30e-14
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 7297300      789 CNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGFGPEGC 834
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYYGDGPPGC 46
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
837-885 3.37e-14

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


:

Pssm-ID: 333801  Cd Length: 49  Bit Score: 68.17  E-value: 3.37e-14
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300     837 CDCNSIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPECRVCQC 885
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
418-475 1.05e-11

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


:

Pssm-ID: 333801  Cd Length: 49  Bit Score: 60.85  E-value: 1.05e-11
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 7297300     418 CDCDPQGSSDDGiCDSlneleegaVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGC 475
Cdd:pfam00053    1 CDCNPHGSLSGT-CDP--------ETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1043-1091 7.94e-11

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


:

Pssm-ID: 333801  Cd Length: 49  Bit Score: 58.54  E-value: 7.94e-11
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300    1043 CECDFLGTNNtiAHCDRFTGQCPCLPNVQGVRCDQCAENHWKIASGEGC 1091
Cdd:pfam00053    1 CDCNPHGSLS--GTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQ 47
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
529-567 1.45e-09

Laminin-type epidermal growth factor-like domai;


:

Pssm-ID: 214543  Cd Length: 46  Bit Score: 55.01  E-value: 1.45e-09
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 7297300      529 CNCDAGGSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYY 39
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
477-526 2.14e-09

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


:

Pssm-ID: 238012  Cd Length: 50  Bit Score: 54.67  E-value: 2.14e-09
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 7297300   477 PCTCNPLGTLNNSgCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGC 526
Cdd:cd00055    1 PCDCNGHGSLSGQ-CDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQGGGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1142-1190 2.53e-08

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


:

Pssm-ID: 333801  Cd Length: 49  Bit Score: 51.60  E-value: 2.53e-08
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300    1142 CECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIGqFPHCSPCG 1190
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYG-LPSGSPQG 48
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
883-930 9.78e-08

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


:

Pssm-ID: 333801  Cd Length: 49  Bit Score: 49.68  E-value: 9.78e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 7297300     883 CQCNGHAA---TCDPIQGTCiDCQDSTTGYSCDSCLDGYYGNPLfGSEIGC 930
Cdd:pfam00053    1 CDCNPHGSlsgTCDPETGQC-LCKPGVTGRRCDRCKPGYYGLPS-GSPQGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
991-1043 5.33e-07

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


:

Pssm-ID: 333801  Cd Length: 49  Bit Score: 47.75  E-value: 5.33e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 7297300     991 CECSNNVDLydTGNCDRQTGACLkCLYQTTGDHCELCKDGFFGDALqQNCQQC 1043
Cdd:pfam00053    1 CDCNPHGSL--SGTCDPETGQCL-CKPGVTGRRCDRCKPGYYGLPS-GSPQGC 49
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
287-343 2.24e-05

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


:

Pssm-ID: 238012  Cd Length: 50  Bit Score: 43.11  E-value: 2.24e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 7297300   287 SCSCYGHASQCLPLDPafsqadnedgmVHGRCECTHNTKGMNCEECEDFFNDLPWKP 343
Cdd:cd00055    1 PCDCNGHGSLSGQCDP-----------GTGQCECKPNTTGRRCDRCAPGYYGLPSQG 46
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
932-988 1.23e-04

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


:

Pssm-ID: 238012  Cd Length: 50  Bit Score: 41.19  E-value: 1.23e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 7297300   932 PCRCPETVASGlahaDGCSLDTrnnnMLCHCQEGYSGSRCEICADNFFGNPDNGGTC 988
Cdd:cd00055    1 PCDCNGHGSLS----GQCDPGT----GQCECKPNTTGRRCDRCAPGYYGLPSQGGGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
355-406 3.13e-04

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


:

Pssm-ID: 333801  Cd Length: 49  Bit Score: 40.05  E-value: 3.13e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 7297300     355 CECNDHAV---SCHFdeavftasgfvSGGVCDnCLHNTRGQHCEECMPYFYRDPE 406
Cdd:pfam00053    1 CDCNPHGSlsgTCDP-----------ETGQCL-CKPGVTGRRCDRCKPGYYGLPS 43
 
Name Accession Description Interval E-value
Laminin_N pfam00055
Laminin N-terminal (Domain VI);
63-286 9.33e-97

Laminin N-terminal (Domain VI);


Pssm-ID: 333803  Cd Length: 223  Bit Score: 310.99  E-value: 9.33e-97
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300      63 IGREnrLTASSTCGLHSPERFCILSHLQD--KKCFLCDTReetkhDPYKNHRIGQIIYKTKPGTNipTWWQSENG---KE 137
Cdd:pfam00055    1 FGRE--VEASSTCGLNGPERYCKLSGLAGggKKCFICDSR-----DPYLSHPIENLTDSNNRGNE--TWWQSETGvggYN 71
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300     138 NATIQLDLEAEFHFTHLIITFTTFRPAAMYIERSFDFGQTWHIYRYFAYDCKESFPGVPTVLENIT---DVMCTSRYSNV 214
Cdd:pfam00055   72 NVTLTLDLGKEFEITYVILKFKSPRPAAMVIERSTDFGKTWQPYQYFASDCRRTFGLPEGPPRSITnedEVICTSRYSDI 151
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 7297300     215 EPSRNGEVIFRVL--PPNINVTDpYAEHVQNQLKMTNLRIQMTKLHKLGDNLLDSRLENeEKYYYGISNMVVRG 286
Cdd:pfam00055  152 SPLTGGEVIFSTLegRPSAKNFD-YSPELQDWVTATNIRIRFLRLHTLGDELLDDPTVL-RSYYYAISDISVGG 223
LamNT smart00136
Laminin N-terminal domain (domain VI); N-terminal domain of laminins and laminin-related ...
48-286 1.02e-96

Laminin N-terminal domain (domain VI); N-terminal domain of laminins and laminin-related protein such as Unc-6/ netrins.


Pssm-ID: 214532  Cd Length: 238  Bit Score: 311.60  E-value: 1.02e-96
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300       48 PCERSSCYPATGNLLIGREnrLTASSTCGLHSPERFCIL--SHLQDKKCFLCDTReetkhDPYKNHRIGQIIYKTKPgtN 125
Cdd:smart00136    1 AGRPRSCYPPFVNLAFGRE--VTATSTCGEPGPERYCKLvgHTEQGKKCDYCDAR-----NPRRSHPAENLTDGNNP--N 71
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300      126 IPTWWQSEN---GKENATIQLDLEAEFHFTHLIITFTTFRPAAMYIERSfDFGQTWHIYRYFAYDCKESFPGVPTVLE-- 200
Cdd:smart00136   72 NPTWWQSEPlsnGPQNVNLTLDLGKEFHVTYVILKFCSPRPSLWILERS-DFGKTWQPWQYFSSDCRRTFGRPPRGPItk 150
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300      201 -NITDVMCTSRYSNVEPSRNGEVIFRVLPPNINVTD-PYAEHVQNQLKMTNLRIQMTKLHKLGDNLLDSRLENEEKYYYG 278
Cdd:smart00136  151 gNEDEVICTSEYSDIVPLEGGEIAFSLLEGRPSATDfDNSPVLQEWVTATNIRVRLTRLRTLGDELMDDRPEVTRRYYYA 230

                    ....*...
gi 7297300      279 ISNMVVRG 286
Cdd:smart00136  231 ISDIAVGG 238
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
1228-1771 4.64e-19

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 93.55  E-value: 4.64e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1228 SEFSELDKKLQHIRNLLQNTSVSLVDIEKLDYETQSlrdQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQNHSRLV- 1306
Cdd:TIGR04523   33 TEEKQLEKKLKTIKNELKNKEKELKNLDKNLNKDEE---KINNSNNKIKILEQQIKDLNDKLKKNKDKINKLNSDLSKIn 109
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1307 -------QQLSK---ELKENGIQLQESNIEGALNLTRhayervsnLSTLKDEANELASNTDRNCKRVENLSNKIQAEADD 1376
Cdd:TIGR04523  110 seikndkEQKNKlevELNKLEKQKKENKKNIDKFLTE--------IKKKEKELEKLNNKYNDLKKQKEELENELNLLEKE 181
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1377 LANNNKLIEDYRAELT-----------------SLTSQIPELNNQVcgkpgdpcdslcggagcghcggflscehgakths 1439
Cdd:TIGR04523  182 KLNIQKNIDKIKNKLLklelllsnlkkkiqknkSLESQISELKKQN---------------------------------- 227
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1440 eealkvaKDAETAITSKKDQADQTIRAL--TQAKLN-ASEAYEKAKRGFEQSERYLNQTNANIKLAENLFIALNNFQE-- 1514
Cdd:TIGR04523  228 -------NQLKDNIEKKQQEINEKTTEIsnTQTQLNqLKDEQNKIKKQLSEKQKELEQNNKKIKELEKQLNQLKSEISdl 300
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1515 NKTASPSESKELAQKTLDLDLKLEpeEIETLGDQINRAVSSLKNVEAIIYRTKPDLDrvNNLQSIANATKEKADKIldsa 1594
Cdd:TIGR04523  301 NNQKEQDWNKELKSELKNQEKKLE--EIQNQISQNNKIISQLNEQISQLKKELTNSE--SENSEKQRELEEKQNEI---- 372
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1595 nsvvESLAaaDESQGKaKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEI 1674
Cdd:TIGR04523  373 ----EKLK--KENQSY-KQEIKNLESQINDLESKIQNQEKLNQQKDEQIKKLQQEKELLEKEIERLKETIIKNNSEIKDL 445
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1675 TKEAGSVKLEAmrargeaNNLQSATSATNQTLtDRASRS-----ENARERAKQLLQRASKL------TVDTNAKLKDLND 1743
Cdd:TIGR04523  446 TNQDSVKELII-------KNLDNTRESLETQL-KVLSRSinkikQNLEQKQKELKSKEKELkklneeKKELEEKVKDLTK 517
                          570       580       590
                   ....*....|....*....|....*....|..
gi 7297300    1744 LQTVYLNKNQQL----LRLQAEIGPLNKELNE 1771
Cdd:TIGR04523  518 KISSLKEKIEKLesekKEKESKISDLEDELNK 549
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
1229-1786 8.57e-16

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 83.27  E-value: 8.57e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1229 EFSE-LDKKLQHIRNLLQNtsvsLVDIEKLD----------YETQSLRDQLQashGRLSETEQNLDDIYNSLSlsgVELE 1297
Cdd:COG0419  144 EFDAfLKSKPKERKEILDE----LFGLEKYEklsellkeviKEAKAKIEELE---GQLSELLEDIEDLLEALE---EELK 213
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1298 SLQNHSRLVQQLSKELKENGIQLQESNIEgALNLTRHAYERV----SNLSTLKDEANELASNTDRNCKR----VENLSNK 1369
Cdd:COG0419  214 ELKKLEEIQEEQEEEELEQEIEALEERLA-ELEEEKERLEELkarlLEIESLELEALKIREEELRELERlleeLEEKIER 292
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1370 IQAEADDLANNNKL----------IEDYRAELTSLTSQIPELNNQVCGKPGDpCDSLCGGAGCGHCG---GFLSCEHGAK 1436
Cdd:COG0419  293 LEELEREIEELEEEleglralleeLEELLEKLKSLEERLEKLEEKLEKLESE-LEELAEEKNELAKLleeRLKELEERLE 371
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1437 THSEE---ALKVAKDAETAITSKKDQADQTIRALTQAKlnasEAYEKAKRGFEQSERYLNQTNANIKLAENLFIALNNFQ 1513
Cdd:COG0419  372 ELEKElekALERLKQLEEAIQELKEELAELSAALEEIQ----EELEELEKELEELERELEELEEEIKKLEEQINQLESKE 447
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1514 ENKTASPSES---------------------KELAQKTLDLDLKLEP------EEIETLGDQINRAVSSLKNVEAIIYRT 1566
Cdd:COG0419  448 LMIAELAGAGekcpvcgqelpeehekellelYELELEELEEELSREKeeaelrEEIEELEKELRELEEELIELLELEEAL 527
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1567 KPDLDRvnNLQSIANAtKEKADKILDS--ANSVVESLAAADESQGKAKDAIQQANSnIELAGQDLEKIDEETYSAEApan 1644
Cdd:COG0419  528 KEELEE--KLEKLENL-LEELEELKEKlqLQQLKEELRQLEDRLQELKELLEELRL-LRTRKEELEELRERLKELKK--- 600
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1645 ntaqQVEKLAKKVQKLQNNI-----MKNDRDAKEITKEAGSvKLEAMRARGEANNLQSAtsatnqTLTDRASRSENARER 1719
Cdd:COG0419  601 ----KLKELEERLSQLEELLqslelSEAENELEEAEEELES-ELEKLNLQAELEELLQA------ALEELEEKVEELEAE 669
                        570       580       590       600       610       620
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 7297300  1720 AKQLLQRASKLTVDTNaKLKDLNDLQTVYLNKNQQLLRLQAEIGplnkELNEHLIHIKERGSHYRQC 1786
Cdd:COG0419  670 IRRELQRIENEEQLEE-KLEELEQLEEELEQLREELEELLKKLG----EIEQLIEELESRKAELEEL 731
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1094-1142 1.05e-14

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 69.71  E-value: 1.05e-14
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300    1094 CNCDPIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNPNEKCQPC 1142
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
789-834 2.30e-14

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 68.49  E-value: 2.30e-14
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 7297300      789 CNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGFGPEGC 834
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYYGDGPPGC 46
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
837-885 3.37e-14

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 68.17  E-value: 3.37e-14
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300     837 CDCNSIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPECRVCQC 885
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
789-837 8.67e-14

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 67.01  E-value: 8.67e-14
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300     789 CNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGFGPEGCKAC 837
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
789-835 4.73e-13

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 64.68  E-value: 4.73e-13
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 7297300   789 CNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGF--GPEGCK 835
Cdd:cd00055    2 CDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLpsQGGGCQ 50
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
1093-1135 6.28e-13

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 64.68  E-value: 6.28e-13
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|...
gi 7297300  1093 SCNCDPIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNP 1135
Cdd:cd00055    1 PCDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLP 43
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
1094-1139 9.57e-13

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 63.87  E-value: 9.57e-13
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 7297300     1094 CNCDPIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNPNEKC 1139
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYYGDGPPGC 46
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
836-879 9.75e-13

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 63.91  E-value: 9.75e-13
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
gi 7297300   836 ACDCNSIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPE 879
Cdd:cd00055    1 PCDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLPS 44
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
837-880 2.26e-12

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 62.71  E-value: 2.26e-12
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 7297300      837 CDCNSIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYW--NFPEC 880
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYYgdGPPGC 46
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
418-475 1.05e-11

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 60.85  E-value: 1.05e-11
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 7297300     418 CDCDPQGSSDDGiCDSlneleegaVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGC 475
Cdd:pfam00053    1 CDCNPHGSLSGT-CDP--------ETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1043-1091 7.94e-11

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 58.54  E-value: 7.94e-11
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300    1043 CECDFLGTNNtiAHCDRFTGQCPCLPNVQGVRCDQCAENHWKIASGEGC 1091
Cdd:pfam00053    1 CDCNPHGSLS--GTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQ 47
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
1043-1091 5.50e-10

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 56.17  E-value: 5.50e-10
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*....
gi 7297300     1043 CECDFLGTNNTiaHCDRFTGQCPCLPNVQGVRCDQCAENHWKiASGEGC 1091
Cdd:smart00180    1 CDCDPGGSASG--TCDPDTGQCECKPNVTGRRCDRCAPGYYG-DGPPGC 46
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
1043-1092 1.06e-09

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 55.44  E-value: 1.06e-09
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 7297300  1043 CECDFLGTNNTiaHCDRFTGQCPCLPNVQGVRCDQCAENHWKIAS-GEGCE 1092
Cdd:cd00055    2 CDCNGHGSLSG--QCDPGTGQCECKPNTTGRRCDRCAPGYYGLPSqGGGCQ 50
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
529-567 1.45e-09

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 55.01  E-value: 1.45e-09
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 7297300      529 CNCDAGGSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYY 39
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
477-526 2.14e-09

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 54.67  E-value: 2.14e-09
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 7297300   477 PCTCNPLGTLNNSgCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGC 526
Cdd:cd00055    1 PCDCNGHGSLSGQ-CDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQGGGC 49
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
529-567 3.23e-09

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 53.90  E-value: 3.23e-09
                         10        20        30
                 ....*....|....*....|....*....|....*....
gi 7297300   529 CNCDAGGSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567
Cdd:cd00055    2 CDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYY 40
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
417-476 3.29e-09

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 53.90  E-value: 3.29e-09
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   417 PCDCDPQGSSDdGICDSLNeleegavaGACHCKAFVTGRRCNQCKDGYWNLQSdNPEGCE 476
Cdd:cd00055    1 PCDCNGHGSLS-GQCDPGT--------GQCECKPNTTGRRCDRCAPGYYGLPS-QGGGCQ 50
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
478-526 3.75e-09

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 53.92  E-value: 3.75e-09
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 7297300     478 CTCNPLGTLNnSGCVMRTGECKCKKYVTGKDCNQCMPETYGL-SESPEGC 526
Cdd:pfam00053    1 CDCNPHGSLS-GTCDPETGQCLCKPGVTGRRCDRCKPGYYGLpSGSPQGC 49
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
418-475 1.12e-08

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 52.31  E-value: 1.12e-08
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|....*...
gi 7297300      418 CDCDPQGSSDDGiCDSLNeleegavaGACHCKAFVTGRRCNQCKDGYWNlqsDNPEGC 475
Cdd:smart00180    1 CDCDPGGSASGT-CDPDT--------GQCECKPNVTGRRCDRCAPGYYG---DGPPGC 46
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1142-1190 2.53e-08

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 51.60  E-value: 2.53e-08
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300    1142 CECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIGqFPHCSPCG 1190
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYG-LPSGSPQG 48
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
1141-1189 2.84e-08

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 51.20  E-value: 2.84e-08
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 7297300  1141 PCECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIGQFPHCSPC 1189
Cdd:cd00055    1 PCDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQGGGC 49
PRK02224 PRK02224
chromosome segregation protein; Provisional
1528-1756 4.61e-08

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 58.13  E-value: 4.61e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1528 QKTLDLDLKLEPEEIET--LGDQINRAVSSLKNVEAIIyrtkpdlDRVNNLQSIANATKEKADKILDSANSVVESL---- 1601
Cdd:PRK02224  185 QRGSLDQLKAQIEEKEEkdLHERLNGLESELAELDEEI-------ERYEEQREQARETRDEADEVLEEHEERREELetle 257
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1602 AAADESQGK----------AKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDA 1671
Cdd:PRK02224  258 AEIEDLRETiaeterereeLAEEVRDLRERLEELEEERDDLLAEAGLDDADAEAVEARREELEDRDEELRDRLEECRVAA 337
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1672 KEITKEAGSV-----KLE--AMRARGEANNLQSATSATNQTLTDRASRSENARERAKQLLQRASKLTVD----------- 1733
Cdd:PRK02224  338 QAHNEEAESLredadDLEerAEELREEAAELESELEEAREAVEDRREEIEELEEEIEELRERFGDAPVDlgnaedfleel 417
                         250       260       270
                  ....*....|....*....|....*....|..
gi 7297300   1734 ------TNAKLKDLN-DLQTV--YLNKNQQLL 1756
Cdd:PRK02224  418 reerdeLREREAELEaTLRTAreRVEEAEALL 449
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
883-930 9.78e-08

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 49.68  E-value: 9.78e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 7297300     883 CQCNGHAA---TCDPIQGTCiDCQDSTTGYSCDSCLDGYYGNPLfGSEIGC 930
Cdd:pfam00053    1 CDCNPHGSlsgTCDPETGQC-LCKPGVTGRRCDRCKPGYYGLPS-GSPQGC 49
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
883-931 1.47e-07

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 49.27  E-value: 1.47e-07
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 7297300   883 CQCNGHAA---TCDPIQGTCIdCQDSTTGYSCDSCLDGYYGNPLFGSeiGCR 931
Cdd:cd00055    2 CDCNGHGSlsgQCDPGTGQCE-CKPNTTGRRCDRCAPGYYGLPSQGG--GCQ 50
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
1142-1186 3.10e-07

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 48.08  E-value: 3.10e-07
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 7297300     1142 CECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIG-QFPHC 1186
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYYGdGPPGC 46
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
478-526 3.19e-07

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 48.08  E-value: 3.19e-07
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*....
gi 7297300      478 CTCNPLGTLNNSgCVMRTGECKCKKYVTGKDCNQCMPETYGlsESPEGC 526
Cdd:smart00180    1 CDCDPGGSASGT-CDPDTGQCECKPNVTGRRCDRCAPGYYG--DGPPGC 46
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
991-1043 5.33e-07

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 47.75  E-value: 5.33e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 7297300     991 CECSNNVDLydTGNCDRQTGACLkCLYQTTGDHCELCKDGFFGDALqQNCQQC 1043
Cdd:pfam00053    1 CDCNPHGSL--SGTCDPETGQCL-CKPGVTGRRCDRCKPGYYGLPS-GSPQGC 49
Cast pfam10174
RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part ...
1213-1723 2.79e-06

RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion. The C-terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). The family also contains four coiled-coil domains.


Pssm-ID: 313412 [Multi-domain]  Cd Length: 763  Bit Score: 52.25  E-value: 2.79e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1213 RAKEIKQVGAtgaYTSEFSELDKKLQHIRNllqntsvslvDIEKLDYETQSLRDQLQASHGRLSETEQNLDDIYNSLSLS 1292
Cdd:pfam10174  267 REEEIKQMEV---YKSHSKFMKNKIDQLKQ----------ELSKKETELLALQTKLETLNNQFSDSKQHIEVLKESLTAK 333
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1293 GVELESLQNHsrlVQQLSKELKENGIQLQESniegalnlTRHAYERVSNLSTLKDEANELASNTDRNCKRVENLSNKIQA 1372
Cdd:pfam10174  334 EQRAAILQTE---VDALRLRLEEKESFLNKK--------TKQLQDLTEEKSTLAGEIRDLKDMLDVKERKINVLQKKIEN 402
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1373 EADDLANNNKLIEDYRAELTSLTSqipelnnqvcgkpgDPCDSlcggagcghcggflsceHGAKTHSEEALKvakDAETA 1452
Cdd:pfam10174  403 LQEQLRDKDKQLSNLKDRVKSLQT--------------DSSNT-----------------DTALTTLEEALA---EKERI 448
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1453 ITSKKDQADQtiraLTQAKLNASEAYEKAKRGFEQSeryLNQTNANIKLAENLFIALNNfQENKTASPSESKELAQKTLD 1532
Cdd:pfam10174  449 IERLKEQRER----EEREKLDEVDSYKKELKDLKEK---VSLLQGDLTERETSLLDLKE-HASSLASSGLKKDSKLKSLE 520
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1533 LDLKLEPEEIETLGDQINRAVSSlknveAIIYRTKPDL-DRVNNLQSIANATKEKADKILDSANSVVESLAAADESQGKA 1611
Cdd:pfam10174  521 IAIEQKKEECNKLENQLKKAHSA-----AVEARANPEFsDRIKQLEKEVSYYKDEASKAQAEVDRLLEILKEVENEKNDK 595
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1612 KDAIQQANSNIELAGQDLEKideetysaEAPANNTAQQVEKlAKKVQKLQNNIMKND---RDAKEITKEAGSVKLEamRA 1688
Cdd:pfam10174  596 DKKIAELESLTSRQMKDQTK--------KVANLKHGQQLEK-KKNAQLLEEARRREDsldDNSQHLQLEELLNAME--KT 664
                          490       500       510
                   ....*....|....*....|....*....|....*.
gi 7297300    1689 RGEANNLQSATSATNQTLTDRASRSENAR-ERAKQL 1723
Cdd:pfam10174  665 KQELESTKARLSSTQQSLAEKEGHLTNLRaERRKQL 700
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
991-1041 4.02e-06

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 45.42  E-value: 4.02e-06
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 7297300   991 CECSNNVDLydTGNCDRQTGACLkCLYQTTGDHCELCKDGFFGDALQ-QNCQ 1041
Cdd:cd00055    2 CDCNGHGSL--SGQCDPGTGQCE-CKPNTTGRRCDRCAPGYYGLPSQgGGCQ 50
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
529-567 4.80e-06

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 45.06  E-value: 4.80e-06
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 7297300     529 CNCDAGGSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYY 39
ApoLp-III_like cd13769
Apolipophorin-III and similar insect proteins; Exchangeable apolipoproteins play vital roles ...
1545-1702 1.15e-05

Apolipophorin-III and similar insect proteins; Exchangeable apolipoproteins play vital roles in the transport of lipids and lipoprotein metabolism. Apolipophorin III (apoLp-III) assists in the loading of diacylglycerol, generated from triacylglycerol stores in the fat body through the action of adipokinetic hormone, into lipophorin, the hemolymph lipoprotein. ApoLp-III increases the lipid carrying capacity of lipophorin by covering the expanding hydrophobic surface resulting from diacylglycerol uptake. It plays a critical role in the transport of lipids during insect flight, and may also play a role in defense mechanisms and innate immunity.


Pssm-ID: 259842 [Multi-domain]  Cd Length: 158  Bit Score: 46.93  E-value: 1.15e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1545 LGDQINRAVSSLKNVEAIIYRTKPDldrvNNLQSIANATKEKADKILDSANSVVESLA-AADESQGKAKDAIQQANSNIE 1623
Cdd:cd13769    3 LSELIQKAQEAINNLAQQVQKQLGL----QNPEEVVNTLKEQSDNFANNLQEVSSSLKeEAKKKQGEVEEAWNEFKTKLS 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1624 LAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKE----ITKEAGSVKLEAmrargeANNLQ-SA 1698
Cdd:cd13769   79 ETVPELRKSLPVEEKAQELQAKLQSGLQTLVTESQKLAKAISENSQKAQEelqkATKQAYDIAVEA------AQNLQnQL 152

                 ....
gi 7297300  1699 TSAT 1702
Cdd:cd13769  153 QTAT 156
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
287-343 2.24e-05

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 43.11  E-value: 2.24e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 7297300   287 SCSCYGHASQCLPLDPafsqadnedgmVHGRCECTHNTKGMNCEECEDFFNDLPWKP 343
Cdd:cd00055    1 PCDCNGHGSLSGQCDP-----------GTGQCECKPNTTGRRCDRCAPGYYGLPSQG 46
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
1438-1662 6.44e-05

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 46.51  E-value: 6.44e-05
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300     1438 HSEEALKVAKDAETAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERyLNQTNANIK-LAE--NLfIALNnfqe 1514
Cdd:smart00283   40 NADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSAVEELEESSDE-IGEIVSVIDdIADqtNL-LALN---- 113
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300     1515 nktAS----------------PSESKELAQKTLDldlklEPEEIETLgdqINRAVSSLKNVEAIIYRTKpdlDRVNNLQS 1578
Cdd:smart00283  114 ---AAieaarageagrgfavvADEVRKLAERSAE-----SAKEIESL---IKEIQEETNEAVAAMEESS---SEVEEGVE 179
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300     1579 IANATKEKADKILDSANSV---VESLAAADESQgkaKDAIQQANSNIElagqDLEKIDEETysaEAPANNTAQQVEKLAK 1655
Cdd:smart00283  180 LVEETGDALEEIVDSVEEIadlVQEIAAATDEQ---AAGSEEVNAAID----EIAQVTQET---AAMSEEISAAAEELSG 249

                    ....*..
gi 7297300     1656 KVQKLQN 1662
Cdd:smart00283  250 LAEELDE 256
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
932-988 1.23e-04

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 41.19  E-value: 1.23e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 7297300   932 PCRCPETVASGlahaDGCSLDTrnnnMLCHCQEGYSGSRCEICADNFFGNPDNGGTC 988
Cdd:cd00055    1 PCDCNGHGSLS----GQCDPGT----GQCECKPNTTGRRCDRCAPGYYGLPSQGGGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
933-988 1.62e-04

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 40.82  E-value: 1.62e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 7297300     933 CRCPETVASGlahaDGCSLDTrnnnMLCHCQEGYSGSRCEICADNFFGNP-DNGGTC 988
Cdd:pfam00053    1 CDCNPHGSLS----GTCDPET----GQCLCKPGVTGRRCDRCKPGYYGLPsGSPQGC 49
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
991-1034 1.89e-04

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 40.37  E-value: 1.89e-04
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....
gi 7297300      991 CECsnNVDLYDTGNCDRQTGACLkCLYQTTGDHCELCKDGFFGD 1034
Cdd:smart00180    1 CDC--DPGGSASGTCDPDTGQCE-CKPNVTGRRCDRCAPGYYGD 41
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
355-406 3.13e-04

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 40.05  E-value: 3.13e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 7297300     355 CECNDHAV---SCHFdeavftasgfvSGGVCDnCLHNTRGQHCEECMPYFYRDPE 406
Cdd:pfam00053    1 CDCNPHGSlsgTCDP-----------ETGQCL-CKPGVTGRRCDRCKPGYYGLPS 43
MARTX_Nterm NF012221
MARTX multifunctional-autoprocessing repeats-in-toxin holotoxin N-terminal region; This model ...
1448-1702 3.86e-04

MARTX multifunctional-autoprocessing repeats-in-toxin holotoxin N-terminal region; This model describes the N-terminal 1900 amino acids of MARTX family multifunctional-autoprocessing repeats-in-toxin holotoxins, which contain both repeat regions that facilitate their entry into eukaryotic target cells, and multiple effector domains.


Pssm-ID: 333741 [Multi-domain]  Cd Length: 1848  Bit Score: 45.21  E-value: 3.86e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1448 DAETAITSKKDQADQTIRALTQAKLNASEAYEKAkrgfeQSEryLNQTNANiklaenlfiALN-NFQENKTASPSES--- 1523
Cdd:NF012221 1555 DAAQNALADKERAEADRQRLEQEKQQQLAAISGS-----QSQ--LESTDQN---------ALEtNGQAQRDAILEESrav 1618
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1524 -KELAQKTLDLD-LKLEPEEIETLGDQ--INRAVSSLKNVEAiiyrtkpDLDRVNNLQS--IANATKEKADKILDSANSV 1597
Cdd:NF012221 1619 tKELTTLAQGLDaLDSQATYAGESGDQwrNPFAGGLLDRVQE-------QLDDAKKISGkqLADAKQRHVDNQQKVKDAV 1691
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1598 VES---LAAADESQGKAKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNImkndrdAKEI 1674
Cdd:NF012221 1692 AKSeagVAQGEQNQANAEQDIDDAKADAEKRKDDALAKQNEAQQAESDANAAANDAQSRGEQDASAAENK------ANQA 1765
                         250       260
                  ....*....|....*....|....*...
gi 7297300   1675 TKEAGSVKLEAmrarGEANNLQSATSAT 1702
Cdd:NF012221 1766 QADAKGAKQDE----SDKPNRQGAAGSG 1789
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
355-407 5.75e-04

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 39.26  E-value: 5.75e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 7297300   355 CECNDHA---VSCHFDeavftasgfvsGGVCDnCLHNTRGQHCEECMPYFYRDPEQ 407
Cdd:cd00055    2 CDCNGHGslsGQCDPG-----------TGQCE-CKPNTTGRRCDRCAPGYYGLPSQ 45
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
288-346 1.50e-03

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 38.12  E-value: 1.50e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 7297300     288 CSCYGHASQCLPLDPafsqadnedgmVHGRCECTHNTKGMNCEECEDFFNDLPWKPAFG 346
Cdd:pfam00053    1 CDCNPHGSLSGTCDP-----------ETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQG 48
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
960-985 8.54e-03

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 35.75  E-value: 8.54e-03
                            10        20
                    ....*....|....*....|....*.
gi 7297300      960 CHCQEGYSGSRCEICADNFFGNPDNG 985
Cdd:smart00180   20 CECKPNVTGRRCDRCAPGYYGDGPPG 45
 
Name Accession Description Interval E-value
Laminin_N pfam00055
Laminin N-terminal (Domain VI);
63-286 9.33e-97

Laminin N-terminal (Domain VI);


Pssm-ID: 333803  Cd Length: 223  Bit Score: 310.99  E-value: 9.33e-97
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300      63 IGREnrLTASSTCGLHSPERFCILSHLQD--KKCFLCDTReetkhDPYKNHRIGQIIYKTKPGTNipTWWQSENG---KE 137
Cdd:pfam00055    1 FGRE--VEASSTCGLNGPERYCKLSGLAGggKKCFICDSR-----DPYLSHPIENLTDSNNRGNE--TWWQSETGvggYN 71
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300     138 NATIQLDLEAEFHFTHLIITFTTFRPAAMYIERSFDFGQTWHIYRYFAYDCKESFPGVPTVLENIT---DVMCTSRYSNV 214
Cdd:pfam00055   72 NVTLTLDLGKEFEITYVILKFKSPRPAAMVIERSTDFGKTWQPYQYFASDCRRTFGLPEGPPRSITnedEVICTSRYSDI 151
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 7297300     215 EPSRNGEVIFRVL--PPNINVTDpYAEHVQNQLKMTNLRIQMTKLHKLGDNLLDSRLENeEKYYYGISNMVVRG 286
Cdd:pfam00055  152 SPLTGGEVIFSTLegRPSAKNFD-YSPELQDWVTATNIRIRFLRLHTLGDELLDDPTVL-RSYYYAISDISVGG 223
LamNT smart00136
Laminin N-terminal domain (domain VI); N-terminal domain of laminins and laminin-related ...
48-286 1.02e-96

Laminin N-terminal domain (domain VI); N-terminal domain of laminins and laminin-related protein such as Unc-6/ netrins.


Pssm-ID: 214532  Cd Length: 238  Bit Score: 311.60  E-value: 1.02e-96
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300       48 PCERSSCYPATGNLLIGREnrLTASSTCGLHSPERFCIL--SHLQDKKCFLCDTReetkhDPYKNHRIGQIIYKTKPgtN 125
Cdd:smart00136    1 AGRPRSCYPPFVNLAFGRE--VTATSTCGEPGPERYCKLvgHTEQGKKCDYCDAR-----NPRRSHPAENLTDGNNP--N 71
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300      126 IPTWWQSEN---GKENATIQLDLEAEFHFTHLIITFTTFRPAAMYIERSfDFGQTWHIYRYFAYDCKESFPGVPTVLE-- 200
Cdd:smart00136   72 NPTWWQSEPlsnGPQNVNLTLDLGKEFHVTYVILKFCSPRPSLWILERS-DFGKTWQPWQYFSSDCRRTFGRPPRGPItk 150
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300      201 -NITDVMCTSRYSNVEPSRNGEVIFRVLPPNINVTD-PYAEHVQNQLKMTNLRIQMTKLHKLGDNLLDSRLENEEKYYYG 278
Cdd:smart00136  151 gNEDEVICTSEYSDIVPLEGGEIAFSLLEGRPSATDfDNSPVLQEWVTATNIRVRLTRLRTLGDELMDDRPEVTRRYYYA 230

                    ....*...
gi 7297300      279 ISNMVVRG 286
Cdd:smart00136  231 ISDIAVGG 238
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
1228-1771 4.64e-19

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 93.55  E-value: 4.64e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1228 SEFSELDKKLQHIRNLLQNTSVSLVDIEKLDYETQSlrdQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQNHSRLV- 1306
Cdd:TIGR04523   33 TEEKQLEKKLKTIKNELKNKEKELKNLDKNLNKDEE---KINNSNNKIKILEQQIKDLNDKLKKNKDKINKLNSDLSKIn 109
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1307 -------QQLSK---ELKENGIQLQESNIEGALNLTRhayervsnLSTLKDEANELASNTDRNCKRVENLSNKIQAEADD 1376
Cdd:TIGR04523  110 seikndkEQKNKlevELNKLEKQKKENKKNIDKFLTE--------IKKKEKELEKLNNKYNDLKKQKEELENELNLLEKE 181
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1377 LANNNKLIEDYRAELT-----------------SLTSQIPELNNQVcgkpgdpcdslcggagcghcggflscehgakths 1439
Cdd:TIGR04523  182 KLNIQKNIDKIKNKLLklelllsnlkkkiqknkSLESQISELKKQN---------------------------------- 227
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1440 eealkvaKDAETAITSKKDQADQTIRAL--TQAKLN-ASEAYEKAKRGFEQSERYLNQTNANIKLAENLFIALNNFQE-- 1514
Cdd:TIGR04523  228 -------NQLKDNIEKKQQEINEKTTEIsnTQTQLNqLKDEQNKIKKQLSEKQKELEQNNKKIKELEKQLNQLKSEISdl 300
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1515 NKTASPSESKELAQKTLDLDLKLEpeEIETLGDQINRAVSSLKNVEAIIYRTKPDLDrvNNLQSIANATKEKADKIldsa 1594
Cdd:TIGR04523  301 NNQKEQDWNKELKSELKNQEKKLE--EIQNQISQNNKIISQLNEQISQLKKELTNSE--SENSEKQRELEEKQNEI---- 372
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1595 nsvvESLAaaDESQGKaKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEI 1674
Cdd:TIGR04523  373 ----EKLK--KENQSY-KQEIKNLESQINDLESKIQNQEKLNQQKDEQIKKLQQEKELLEKEIERLKETIIKNNSEIKDL 445
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1675 TKEAGSVKLEAmrargeaNNLQSATSATNQTLtDRASRS-----ENARERAKQLLQRASKL------TVDTNAKLKDLND 1743
Cdd:TIGR04523  446 TNQDSVKELII-------KNLDNTRESLETQL-KVLSRSinkikQNLEQKQKELKSKEKELkklneeKKELEEKVKDLTK 517
                          570       580       590
                   ....*....|....*....|....*....|..
gi 7297300    1744 LQTVYLNKNQQL----LRLQAEIGPLNKELNE 1771
Cdd:TIGR04523  518 KISSLKEKIEKLesekKEKESKISDLEDELNK 549
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
1229-1786 8.57e-16

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 83.27  E-value: 8.57e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1229 EFSE-LDKKLQHIRNLLQNtsvsLVDIEKLD----------YETQSLRDQLQashGRLSETEQNLDDIYNSLSlsgVELE 1297
Cdd:COG0419  144 EFDAfLKSKPKERKEILDE----LFGLEKYEklsellkeviKEAKAKIEELE---GQLSELLEDIEDLLEALE---EELK 213
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1298 SLQNHSRLVQQLSKELKENGIQLQESNIEgALNLTRHAYERV----SNLSTLKDEANELASNTDRNCKR----VENLSNK 1369
Cdd:COG0419  214 ELKKLEEIQEEQEEEELEQEIEALEERLA-ELEEEKERLEELkarlLEIESLELEALKIREEELRELERlleeLEEKIER 292
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1370 IQAEADDLANNNKL----------IEDYRAELTSLTSQIPELNNQVCGKPGDpCDSLCGGAGCGHCG---GFLSCEHGAK 1436
Cdd:COG0419  293 LEELEREIEELEEEleglralleeLEELLEKLKSLEERLEKLEEKLEKLESE-LEELAEEKNELAKLleeRLKELEERLE 371
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1437 THSEE---ALKVAKDAETAITSKKDQADQTIRALTQAKlnasEAYEKAKRGFEQSERYLNQTNANIKLAENLFIALNNFQ 1513
Cdd:COG0419  372 ELEKElekALERLKQLEEAIQELKEELAELSAALEEIQ----EELEELEKELEELERELEELEEEIKKLEEQINQLESKE 447
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1514 ENKTASPSES---------------------KELAQKTLDLDLKLEP------EEIETLGDQINRAVSSLKNVEAIIYRT 1566
Cdd:COG0419  448 LMIAELAGAGekcpvcgqelpeehekellelYELELEELEEELSREKeeaelrEEIEELEKELRELEEELIELLELEEAL 527
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1567 KPDLDRvnNLQSIANAtKEKADKILDS--ANSVVESLAAADESQGKAKDAIQQANSnIELAGQDLEKIDEETYSAEApan 1644
Cdd:COG0419  528 KEELEE--KLEKLENL-LEELEELKEKlqLQQLKEELRQLEDRLQELKELLEELRL-LRTRKEELEELRERLKELKK--- 600
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1645 ntaqQVEKLAKKVQKLQNNI-----MKNDRDAKEITKEAGSvKLEAMRARGEANNLQSAtsatnqTLTDRASRSENARER 1719
Cdd:COG0419  601 ----KLKELEERLSQLEELLqslelSEAENELEEAEEELES-ELEKLNLQAELEELLQA------ALEELEEKVEELEAE 669
                        570       580       590       600       610       620
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 7297300  1720 AKQLLQRASKLTVDTNaKLKDLNDLQTVYLNKNQQLLRLQAEIGplnkELNEHLIHIKERGSHYRQC 1786
Cdd:COG0419  670 IRRELQRIENEEQLEE-KLEELEQLEEELEQLREELEELLKKLG----EIEQLIEELESRKAELEEL 731
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
1228-1781 1.10e-15

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 82.89  E-value: 1.10e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1228 SEFSELDKKLQHIRNLLQNTSvslvdiekldyETQSLRDQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQNHSRLVQ 1307
Cdd:COG0419  274 EELRELERLLEELEEKIERLE-----------ELEREIEELEEELEGLRALLEELEELLEKLKSLEERLEKLEEKLEKLE 342
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1308 QLSKELKENGIQLqESNIEGALNLTRHAYERVS-----NLSTLKDEANELASNTDRN---CKRVENLSNKIQAEADDLAN 1379
Cdd:COG0419  343 SELEELAEEKNEL-AKLLEERLKELEERLEELEkelekALERLKQLEEAIQELKEELaelSAALEEIQEELEELEKELEE 421
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1380 NNKLIEDYRAELTSLTSQI-----PELNNQVCGKPGDPCDslcggagcghcggFLSCEHgaKTHSEEALKVAKDAETAIT 1454
Cdd:COG0419  422 LERELEELEEEIKKLEEQInqlesKELMIAELAGAGEKCP-------------VCGQEL--PEEHEKELLELYELELEEL 486
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1455 SKKDQADQTIRALTQAKlnasEAYEKAKRGFEQSERYLNQTNANIKlaENLFIALNNFqenktaspsesKELAQKTLDLD 1534
Cdd:COG0419  487 EEELSREKEEAELREEI----EELEKELRELEEELIELLELEEALK--EELEEKLEKL-----------ENLLEELEELK 549
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1535 LKLEPEEIETLGDQINRAVSSLKNVEAiiyrtkpDLDRVNNLQSIANATKEKADKILDSANSVVESLAA--ADESQGKAK 1612
Cdd:COG0419  550 EKLQLQQLKEELRQLEDRLQELKELLE-------ELRLLRTRKEELEELRERLKELKKKLKELEERLSQleELLQSLELS 622
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1613 DAIQQANSNIELAGQDLEKIDEETYSAEApannTAQQVEKLAKKVQKLQNNIMKNDRDAKEITK--------EAGSVKLE 1684
Cdd:COG0419  623 EAENELEEAEEELESELEKLNLQAELEEL----LQAALEELEEKVEELEAEIRRELQRIENEEQleekleelEQLEEELE 698
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1685 AMRARGEaNNLQSATSATNQ--TLTDRASRSENARERAKQLLQRASKLTVDtNAKLKDL--------NDLQTVYLNKNQQ 1754
Cdd:COG0419  699 QLREELE-ELLKKLGEIEQLieELESRKAELEELKKELEKLEKALELLEEL-REKLGKAglradilrNLLAQIEAEANEI 776
                        570       580
                 ....*....|....*....|....*..
gi 7297300  1755 LLRLQaeigplnkELNEHLIHIKERGS 1781
Cdd:COG0419  777 LSKLS--------LNRYDLRRLTIRKD 795
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
1199-1782 2.52e-15

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 81.73  E-value: 2.52e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1199 ILSALEDATTATILRAKEIKQvgatgaytsEFSELDKKLQHIRNLLQNTSVSLVD-IEKLDYETQSLRDQLQashgRLSE 1277
Cdd:COG0419  229 ELEQEIEALEERLAELEEEKE---------RLEELKARLLEIESLELEALKIREEeLRELERLLEELEEKIE----RLEE 295
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1278 TEQNLDDIYNSLSLSGVELES----LQNHSRLVQQLSK------ELKENGIQLQESNIEGALNLTRHAYERVSNLSTLKD 1347
Cdd:COG0419  296 LEREIEELEEELEGLRALLEEleelLEKLKSLEERLEKleekleKLESELEELAEEKNELAKLLEERLKELEERLEELEK 375
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1348 EA-NELASNTDR-------------NCKRVENLSNKIQAEADDLANNNKLIEDYRAELTSLTSQI-----PELNNQVCGK 1408
Cdd:COG0419  376 ELeKALERLKQLeeaiqelkeelaeLSAALEEIQEELEELEKELEELERELEELEEEIKKLEEQInqlesKELMIAELAG 455
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1409 PGDPCDslcggagcghcggFLSCEHgaKTHSEEALKVAKDAETAITSKKDQADQTIRALTQAKlnasEAYEKAKRGFEQS 1488
Cdd:COG0419  456 AGEKCP-------------VCGQEL--PEEHEKELLELYELELEELEEELSREKEEAELREEI----EELEKELRELEEE 516
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1489 ERYLNQTNANIKlaENLFIALNNFqenktaspsesKELAQKTLDLDLKLEPEEIETLGDQINRAVSSLKNVEAiiyrtkp 1568
Cdd:COG0419  517 LIELLELEEALK--EELEEKLEKL-----------ENLLEELEELKEKLQLQQLKEELRQLEDRLQELKELLE------- 576
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1569 DLDRVNNLQSIANATKEKADKILDSANSVVESLAA--ADESQGKAKDAIQQANSNIELAGQDLEKIDEETYSAEApannT 1646
Cdd:COG0419  577 ELRLLRTRKEELEELRERLKELKKKLKELEERLSQleELLQSLELSEAENELEEAEEELESELEKLNLQAELEEL----L 652
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1647 AQQVEKLAKKVQKLQNNIMKNDRDAKEITK--------EAGSVKLEAMRARGEaNNLQSATSATNQ--TLTDRASRSENA 1716
Cdd:COG0419  653 QAALEELEEKVEELEAEIRRELQRIENEEQleekleelEQLEEELEQLREELE-ELLKKLGEIEQLieELESRKAELEEL 731
                        570       580       590       600       610       620
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7297300  1717 RERAKQLLQRASKLTVDtNAKLKDlndlqtvylnKNQQLLRLQAEIGPLNKELNEHLIHIKERGSH 1782
Cdd:COG0419  732 KKELEKLEKALELLEEL-REKLGK----------AGLRADILRNLLAQIEAEANEILSKLSLNRYD 786
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1094-1142 1.05e-14

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 69.71  E-value: 1.05e-14
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300    1094 CNCDPIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNPNEKCQPC 1142
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
789-834 2.30e-14

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 68.49  E-value: 2.30e-14
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 7297300      789 CNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGFGPEGC 834
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYYGDGPPGC 46
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
837-885 3.37e-14

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 68.17  E-value: 3.37e-14
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300     837 CDCNSIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPECRVCQC 885
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
789-837 8.67e-14

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 67.01  E-value: 8.67e-14
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300     789 CNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGFGPEGCKAC 837
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1200-1785 1.32e-13

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 76.29  E-value: 1.32e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1200 LSALEDATTATILRAKEIKQVGATGAYTSEFSELDKKLQHIRNLLQntsvslvDIEKLDYETQSLRDQLQASHGRLSETE 1279
Cdd:COG1196  222 LRELELALLLAKLKELRKELEELEEELSRLEEELEELQEELEEAEK-------EIEELKSELEELREELEELQEELLELK 294
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1280 QNLDDIYNSLSLSGVELESLQNHSRLVQQLSKELKENgIQLQESNIEGALNLTRHAYERVSNLSTLKDEANELAsntDRN 1359
Cdd:COG1196  295 EEIEELEGEISLLRERLEELENELEELEERLEELKEK-IEALKEELEERETLLEELEQLLAELEEAKEELEEKL---SAL 370
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1360 CKRVENLSNKIQAEADDL-----ANNNKL------IEDYRAELTSLTSQIPELNNQVCGKPGDPCDSLCGGAGCGHCGGF 1428
Cdd:COG1196  371 LEELEELFEALREELAELeaelaEIRNELeelkreIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEE 450
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1429 LScehGAKTHSEEALKVAKDAETAITSKKDQADQTIRALtQAKLNASEAYEKAKRGFEQSERYLNQTNANIK--LAENL- 1505
Cdd:COG1196  451 LE---EQLEELRDRLKELERELAELQEELQRLEKELSSL-EARLDRLEAEQRASQGVRAVLEALESGLPGVYgpVAELIk 526
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1506 ------------------FIALNNFQENKTA----------------------SPSESKELAQKTLDLDLKLE--PEEIE 1543
Cdd:COG1196  527 vkekyetaleaalgnrlqAVVVENEEVAKKAieflkenkagratflpldrikpLRSLKSDAAPGFLGLASDLIdfDPKYE 606
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1544 TLGDQINRA---VSSLKNVEAIIYRTKPDLdRVNNLQ--------SIANATKEKA------------DKILDSANSVVES 1600
Cdd:COG1196  607 PAVRFVLGDtlvVDDLEQARRLARKLRIKY-RIVTLDgdlvepsgSITGGSRNKRsslaqkrelkelEEELAELEAQLEK 685
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1601 ----LAAADESQGKAKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITK 1676
Cdd:COG1196  686 leeeLKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEE 765
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1677 EAGSVKLEAMR-------ARGEANNLQSATSATNQTLTDRASRSENARERAKQLLQRASKL----------TVDTNAKLK 1739
Cdd:COG1196  766 ELESLEEALAKlkeeieeLEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLeqeieeleeeIEELEEKLD 845
                        650       660       670       680       690
                 ....*....|....*....|....*....|....*....|....*....|
gi 7297300  1740 DLND----LQTVYLNKNQQLLRLQAEIGPLNKELNEHLIHIKERGSHYRQ 1785
Cdd:COG1196  846 ELEEeleeLEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRE 895
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
1205-1563 2.18e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 75.48  E-value: 2.18e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1205 DATTATIL-RAKEIKQVGAT-GAYTSEFSELDKKLQHIRNLLQNTSVSLVDIEKLDYETQSLRDQLQASHGRLSETEQNL 1282
Cdd:TIGR02168  666 AKTNSSILeRRREIEELEEKiEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQL 745
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1283 DDIYNSLSLSGVEL--ESLQNHSRL--VQQLSKELKENGIQLQES--NIEGALNLTRHAYERVSN-LSTLKDEANELAS- 1354
Cdd:TIGR02168  746 EERIAQLSKELTELeaEIEELEERLeeAEEELAEAEAEIEELEAQieQLKEELKALREALDELRAeLTLLNEEAANLREr 825
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1355 ------NTDRNCKRVENLSNKIQAEADDLANNNKLIEDYRAELTSLTSQIPELNNQvcgkpgdpcdslcggagcghcggf 1428
Cdd:TIGR02168  826 leslerRIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNE------------------------ 881
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1429 lscehgaKTHSEEALKVAKDAETAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYLNQTNAniKLAENLFIA 1508
Cdd:TIGR02168  882 -------RASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLAQLELRLEGLEVRIDNLQE--RLSEEYSLT 952
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7297300    1509 LNNFQENKTASPSESKELAQKTLDLDLKLE---------PEEIE-------TLGDQINRAVSSLKNVEAII 1563
Cdd:TIGR02168  953 LEEAEALENKIEDDEEEARRRLKRLENKIKelgpvnlaaIEEYEelkerydFLTAQKEDLTEAKETLEEAI 1023
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
789-835 4.73e-13

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 64.68  E-value: 4.73e-13
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 7297300   789 CNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGF--GPEGCK 835
Cdd:cd00055    2 CDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLpsQGGGCQ 50
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
1093-1135 6.28e-13

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 64.68  E-value: 6.28e-13
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|...
gi 7297300  1093 SCNCDPIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNP 1135
Cdd:cd00055    1 PCDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLP 43
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
1094-1139 9.57e-13

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 63.87  E-value: 9.57e-13
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 7297300     1094 CNCDPIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNPNEKC 1139
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYYGDGPPGC 46
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
836-879 9.75e-13

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 63.91  E-value: 9.75e-13
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
gi 7297300   836 ACDCNSIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPE 879
Cdd:cd00055    1 PCDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLPS 44
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
837-880 2.26e-12

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 62.71  E-value: 2.26e-12
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 7297300      837 CDCNSIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYW--NFPEC 880
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYYgdGPPGC 46
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
1228-1778 2.68e-12

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 71.59  E-value: 2.68e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1228 SEFSELDKKLQH-----------IRNLLQNTSVSLVDIEKLDYETQSLRDQLQASHGRLSETEQNLDDIYNSLSLSGVEL 1296
Cdd:TIGR04523  124 VELNKLEKQKKEnkknidkflteIKKKEKELEKLNNKYNDLKKQKEELENELNLLEKEKLNIQKNIDKIKNKLLKLELLL 203
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1297 ESL----QNHSRLVQQLSkELKENGIQLQESNIEgalnLTRHAYERVSNLSTLKDEANELASNTDRNCKRvenLSNKIQa 1372
Cdd:TIGR04523  204 SNLkkkiQKNKSLESQIS-ELKKQNNQLKDNIEK----KQQEINEKTTEISNTQTQLNQLKDEQNKIKKQ---LSEKQK- 274
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1373 eadDLANNNKLIEDYRAELTSLTSQIPELNNQvcgkpgdpcdslcggagcghcggflscehgaktHSEEALKVAKDaetA 1452
Cdd:TIGR04523  275 ---ELEQNNKKIKELEKQLNQLKSEISDLNNQ---------------------------------KEQDWNKELKS---E 315
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1453 ITSKKDQADQTIRALTQAKLNASEayekakrgfeqseryLNQTNANIKlaenlfialnnfqenKTASPSES------KEL 1526
Cdd:TIGR04523  316 LKNQEKKLEEIQNQISQNNKIISQ---------------LNEQISQLK---------------KELTNSESensekqREL 365
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1527 AQKTldldlklepEEIETLGDQINRAVSSLKNVEAiiyrTKPDLDrvNNLQSIANATKEKADKI--LDSANSVVEslaaa 1604
Cdd:TIGR04523  366 EEKQ---------NEIEKLKKENQSYKQEIKNLES----QINDLE--SKIQNQEKLNQQKDEQIkkLQQEKELLE----- 425
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1605 dESQGKAKDAIQQANSNIElagqDLEkidEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKEagsvkLE 1684
Cdd:TIGR04523  426 -KEIERLKETIIKNNSEIK----DLT---NQDSVKELIIKNLDNTRESLETQLKVLSRSINKIKQNLEQKQKE-----LK 492
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1685 amRARGEANNLQSATSATNQTLTDRASRSENARERAKQLLQRASKLtvdtNAKLKDLND-------------LQTVYLNK 1751
Cdd:TIGR04523  493 --SKEKELKKLNEEKKELEEKVKDLTKKISSLKEKIEKLESEKKEK----ESKISDLEDelnkddfelkkenLEKEIDEK 566
                          570       580       590
                   ....*....|....*....|....*....|
gi 7297300    1752 NQQLLRLQAEIGPL---NKELNEhLIHIKE 1778
Cdd:TIGR04523  567 NKEIEELKQTQKSLkkkQEEKQE-LIDQKE 595
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
1227-1695 2.75e-12

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 71.59  E-value: 2.75e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1227 TSEFSELDKKLQHIRNLLQNTSVSLVDIEKldyetqslrdQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQNHSrlV 1306
Cdd:TIGR04523  238 QQEINEKTTEISNTQTQLNQLKDEQNKIKK----------QLSEKQKELEQNNKKIKELEKQLNQLKSEISDLNNQK--E 305
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1307 QQLSKELKEN--GIQLQESNIEGALNltrhayERVSNLSTLKDEANELasNTDRNCKRVENLSNKIQAEA--DDLANNNK 1382
Cdd:TIGR04523  306 QDWNKELKSElkNQEKKLEEIQNQIS------QNNKIISQLNEQISQL--KKELTNSESENSEKQRELEEkqNEIEKLKK 377
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1383 LIEDYRAELTSLTSQIPELNNQVcgkpgdpcdslcggagcgHCGGFLSCEHGAKTHSEEALKVAKDAE-TAITSKKDQAD 1461
Cdd:TIGR04523  378 ENQSYKQEIKNLESQINDLESKI------------------QNQEKLNQQKDEQIKKLQQEKELLEKEiERLKETIIKNN 439
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1462 QTIRALTqaklnaSEAYEKaKRGFEQSERYLNQTNANIKLAENLFIALNNFQENKTaspsesKELAQKTLDLD-LKLEPE 1540
Cdd:TIGR04523  440 SEIKDLT------NQDSVK-ELIIKNLDNTRESLETQLKVLSRSINKIKQNLEQKQ------KELKSKEKELKkLNEEKK 506
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1541 EIETLGDQINRAVSSLKNVEAIIYRTKPDLDR--------VNNLQSiaNATKEKADKILDSANSVVESL----AAADESQ 1608
Cdd:TIGR04523  507 ELEEKVKDLTKKISSLKEKIEKLESEKKEKESkisdledeLNKDDF--ELKKENLEKEIDEKNKEIEELkqtqKSLKKKQ 584
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1609 GKAKDAIQQANSNIelagQDL-EKIDEETYSAEapanNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKEAGSVKLEAMR 1687
Cdd:TIGR04523  585 EEKQELIDQKEKEK----KDLiKEIEEKEKKIS----SLEKELEKAKKENEKLSSIIKNIKSKKNKLKQEVKQIKETIKE 656

                   ....*...
gi 7297300    1688 ARGEANNL 1695
Cdd:TIGR04523  657 IRNKWPEI 664
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
1203-1772 2.99e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 72.01  E-value: 2.99e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1203 LEDAttATILRAKEIKQvgatgaytsefsELDKKLQHIR-NLLQntsvsLVDI-EKLDYETQSLrdQLQASHG-RLSETE 1279
Cdd:TIGR02168  161 FEEA--AGISKYKERRK------------ETERKLERTReNLDR-----LEDIlNELERQLKSL--ERQAEKAeRYKELK 219
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1280 QNLDDIynSLSLSGVELESLQNH-SRLVQQLSK-ELKENGIQLQESNIEGALNLTRHAYERVSN--------LSTLKDEA 1349
Cdd:TIGR02168  220 AELREL--ELALLVLRLEELREElEELQEELKEaEEELEELTAELQELEEKLEELRLEVSELEEeieelqkeLYALANEI 297
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1350 NELASNTDRNCKRVENLSNKIQAEADDLANNNKLIEDYRAELTSLTSQIPELNNQVCGKPGDpcdslcGGAGCGHCGGFL 1429
Cdd:TIGR02168  298 SRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAE------LEELEAELEELE 371
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1430 SCEHGAKTHSEEA-----------------LKVAKDAETAITSKKDQADQTIRALTQAKLNAS----------------- 1475
Cdd:TIGR02168  372 SRLEELEEQLETLrskvaqlelqiaslnneIERLEARLERLEDRRERLQQEIEELLKKLEEAElkelqaeleeleeelee 451
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1476 ---------EAYEKAKRGFEQSERYLNQTNANIKLAENLFIALNNFQENKTASPSESKELAQKTLDLDL-------KLEP 1539
Cdd:TIGR02168  452 lqeelerleEALEELREELEEAEQALDAAERELAQLQARLDSLERLQENLEGFSEGVKALLKNQSGLSGilgvlseLISV 531
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1540 EE-----IET-LGDQIN-----------RAVSSLKNVEA------IIYRTKPDLDRVNNLQSIANA------------TK 1584
Cdd:TIGR02168  532 DEgyeaaIEAaLGGRLQavvvenlnaakKAIAFLKQNELgrvtflPLDSIKGTEIQGNDREILKNIegflgvakdlvkFD 611
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1585 EKADKILDSANS---VVESLAAADESQGKakdaIQQANSNIELAG------------------------QDLEKIDEETY 1637
Cdd:TIGR02168  612 PKLRKALSYLLGgvlVVDDLDNALELAKK----LRPGYRIVTLDGdlvrpggvitggsaktnssilerrREIEELEEKIE 687
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1638 SAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKEAGSVKLEAMRARGEANNLQsatsatnQTLTDRASRSENAR 1717
Cdd:TIGR02168  688 ELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLE-------ERIAQLSKELTELE 760
                          650       660       670       680       690
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 7297300    1718 ERAKQLLQRASKLTVDTNAKLKDLNDLQTVYLNKNQQLLRLQAEIGPLNKELNEH 1772
Cdd:TIGR02168  761 AEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLL 815
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1212-1779 3.06e-12

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 72.05  E-value: 3.06e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1212 LRAKEIKQVGATGAYTSEFSELDKKLQHIRNLLQNTSVSLVDIEKLDYETQSLRDQLQASHG--------RLSETEQNLD 1283
Cdd:COG1196  314 LENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEelfealreELAELEAELA 393
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1284 DIYNSLSLSGVELESLQnhsRLVQQLSKELKENGIQLQEsnIEGALNLTRHAYErvsnlsTLKDEANELASNTDRNCKRV 1363
Cdd:COG1196  394 EIRNELEELKREIESLE---ERLERLSERLEDLKEELKE--LEAELEELQTELE------ELNEELEELEEQLEELRDRL 462
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1364 ENLSNKIQAEADDLANNNKLIEDYRAELTSLTSQIPELNNQvcgkpgdpcdslcggagCGHCGGFLSCEHGAKTHSEEAL 1443
Cdd:COG1196  463 KELERELAELQEELQRLEKELSSLEARLDRLEAEQRASQGV-----------------RAVLEALESGLPGVYGPVAELI 525
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1444 KVAKDAETAI------------TSKKDQADQTIRALTQAKL---------------NASEAYEKAKRGF--------EQS 1488
Cdd:COG1196  526 KVKEKYETALeaalgnrlqavvVENEEVAKKAIEFLKENKAgratflpldrikplrSLKSDAAPGFLGLasdlidfdPKY 605
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1489 ERYLNQTNANIKLAENLFIALNNFQENKT--------------------ASPSESKELAQKTLDLDLKlepEEIETLGDQ 1548
Cdd:COG1196  606 EPAVRFVLGDTLVVDDLEQARRLARKLRIkyrivtldgdlvepsgsitgGSRNKRSSLAQKRELKELE---EELAELEAQ 682
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1549 INRAVSSLKNVEAIIYRTKPDLDRVNNLQSIANATKEKADKILDSA----NSVVESLAAADESQGKAKDAIQQANSNIEL 1624
Cdd:COG1196  683 LEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALeeelEQLQSRLEELEEELEELEEELEELQERLEE 762
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1625 AGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKEAGSVKLEAMRARGEANNLQSATSATN- 1703
Cdd:COG1196  763 LEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEe 842
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7297300  1704 --QTLTDRASRSENARERAKQLLQRASKLTVDTNAKLKDLNDLQTVYLNKNQQLLRLQAEIGPLNKELNEHLIHIKER 1779
Cdd:COG1196  843 klDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAK 920
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
1440-1778 4.19e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 71.24  E-value: 4.19e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1440 EEALKVAKDAETAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYLNQTNANIKLAENLfIALNNFQENKTAS 1519
Cdd:TIGR02168  697 EKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAE-IEELEERLEEAEE 775
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1520 psESKELAQKTLDLDlklepEEIETLGDQINRAVSSLKNVEAIIYRTKpdlDRVNNLQS-IANATKEKADKIlDSANSVV 1598
Cdd:TIGR02168  776 --ELAEAEAEIEELE-----AQIEQLKEELKALREALDELRAELTLLN---EEAANLRErLESLERRIAATE-RRLEDLE 844
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1599 ESLAAADESQGKAKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKEA 1678
Cdd:TIGR02168  845 EQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKL 924
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1679 GSVKLEAMRARGEANNLQSATSATNQTLTDRASRSENARERAKQLLQRaskltvdtnaKLKDLndlqtvylnkNQQLlrl 1758
Cdd:TIGR02168  925 AQLELRLEGLEVRIDNLQERLSEEYSLTLEEAEALENKIEDDEEEARR----------RLKRL----------ENKI--- 981
                          330       340
                   ....*....|....*....|....*..
gi 7297300    1759 qAEIGPLN-------KELNEHLIHIKE 1778
Cdd:TIGR02168  982 -KELGPVNlaaieeyEELKERYDFLTA 1007
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1225-1621 5.63e-12

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 70.90  E-value: 5.63e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1225 AYTSEFSELDKKLQHIRNLLQNTSVslvDIEKLDYETQSLRDQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQNHSR 1304
Cdd:COG1196  678 ELEAQLEKLEEELKSLKNELRSLED---LLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELE 754
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1305 LVQQLSKELKE--NGIQLQESNIE----------GALNLTRHAYERVsnLSTLKDEANELASNTDRNCKRVENLSNKIQA 1372
Cdd:COG1196  755 ELQERLEELEEelESLEEALAKLKeeieeleekrQALQEELEELEEE--LEEAERRLDALERELESLEQRRERLEQEIEE 832
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1373 EADDLANNNKLIEDYRAELTSLTSQIPELNNQvcgkpgdpcdslcggagcghcggflscehgakthSEEALKVAKDAETA 1452
Cdd:COG1196  833 LEEEIEELEEKLDELEEELEELEKELEELKEE----------------------------------LEELEAEKEELEDE 878
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1453 I---TSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYLNQtnaniklaenLFIALNNFQENKTaspSESKELAQK 1529
Cdd:COG1196  879 LkelEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLER----------LEVELPELEEELE---EEYEDTLET 945
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1530 TLDLDLKLEPEEIETLGDqIN-RAVSSLKNVEAiiyrtkpdldRVNNLqsiaNATKEKADKILDSANSVVESLaaadESQ 1608
Cdd:COG1196  946 ELEREIERLEEEIEALGP-VNlRAIEEYEEVEE----------RYEEL----KSQREDLEEAKEKLLEVIEEL----DKE 1006
                        410
                 ....*....|....*
gi 7297300  1609 GKA--KDAIQQANSN 1621
Cdd:COG1196 1007 KRErfKETFDKINEN 1021
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
418-475 1.05e-11

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 60.85  E-value: 1.05e-11
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 7297300     418 CDCDPQGSSDDGiCDSlneleegaVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGC 475
Cdd:pfam00053    1 CDCNPHGSLSGT-CDP--------ETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQGC 49
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
1226-1777 1.32e-11

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 69.66  E-value: 1.32e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1226 YTSEFSELDKKLQHIRNLLQNTSVSLVDIEKLDYETQSLRDQLQashgRLSETEQNLDDIYNSLSLSGVELES-LQNHSR 1304
Cdd:TIGR04523  178 LEKEKLNIQKNIDKIKNKLLKLELLLSNLKKKIQKNKSLESQIS----ELKKQNNQLKDNIEKKQQEINEKTTeISNTQT 253
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1305 LVQQLSKELKENGIQLQESNIEgalnltrhaYERVSN-LSTLKDEANELASN-TDRNCKRVENLSNKIQaeaDDLANNNK 1382
Cdd:TIGR04523  254 QLNQLKDEQNKIKKQLSEKQKE---------LEQNNKkIKELEKQLNQLKSEiSDLNNQKEQDWNKELK---SELKNQEK 321
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1383 LIEDYRAELTSLTSQIPELNNQVcgkpgdpcDSLCGGagcghcggflscehgaKTHSEEAlKVAKDAEtaITSKKDQAdQ 1462
Cdd:TIGR04523  322 KLEEIQNQISQNNKIISQLNEQI--------SQLKKE----------------LTNSESE-NSEKQRE--LEEKQNEI-E 373
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1463 TIRALTQAKLNASEAYEKAKRGFEQseRYLNQTnaniKLAENLFIALNNFQENKTASPSESKELAQKTLDLDlklepEEI 1542
Cdd:TIGR04523  374 KLKKENQSYKQEIKNLESQINDLES--KIQNQE----KLNQQKDEQIKKLQQEKELLEKEIERLKETIIKNN-----SEI 442
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1543 ETLGDQInravSSLKNVeaiiyrtkpdldrVNNLQSIANATKEKADKILDSANSVVESLaaadesqgkakdaiQQANSNI 1622
Cdd:TIGR04523  443 KDLTNQD----SVKELI-------------IKNLDNTRESLETQLKVLSRSINKIKQNL--------------EQKQKEL 491
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1623 ELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKEagsvkLEAMRARGEANNLQSATSAT 1702
Cdd:TIGR04523  492 KSKEKELKKLNEEKKELEEKVKDLTKKISSLKEKIEKLESEKKEKESKISDLEDE-----LNKDDFELKKENLEKEIDEK 566
                          490       500       510       520       530       540       550
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 7297300    1703 NQTLtdrasrsENARERAKQLLQRASKLTVDTNAKLKDLNDLQTVYLNKNQQLLRLQAEIGPLNKElNEHLIHIK 1777
Cdd:TIGR04523  567 NKEI-------EELKQTQKSLKKKQEEKQELIDQKEKEKKDLIKEIEEKEKKISSLEKELEKAKKE-NEKLSSII 633
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
1228-1785 2.43e-11

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 68.93  E-value: 2.43e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1228 SEFSELDKKLQHIRNLLQNTSVSL----VDIEKLDYETQSLRDQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQ-NH 1302
Cdd:TIGR02168  274 LEVSELEEEIEELQKELYALANEIsrleQQKQILRERLANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKeEL 353
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1303 SRLVQQLSKELK-----ENGIQLQESNIE---GALNLTRHAYERVSN-LSTLKDEANELASNTDRNCKRVENL-----SN 1368
Cdd:TIGR02168  354 ESLEAELEELEAeleelESRLEELEEQLEtlrSKVAQLELQIASLNNeIERLEARLERLEDRRERLQQEIEELlkkleEA 433
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1369 KIQAEADDLANNNKLIED-------YRAELTSLTSQIPELNNQVCGKPGD------PCDSLCGGAGCghcggFLSCEHGA 1435
Cdd:TIGR02168  434 ELKELQAELEELEEELEElqeelerLEEALEELREELEEAEQALDAAERElaqlqaRLDSLERLQEN-----LEGFSEGV 508
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1436 KT---HSE----------EALKVAKDAETAI------------TSKKDQADQTIRALTQAklnaseayEKAKRGF----E 1486
Cdd:TIGR02168  509 KAllkNQSglsgilgvlsELISVDEGYEAAIeaalggrlqavvVENLNAAKKAIAFLKQN--------ELGRVTFlpldS 580
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1487 QSERYLNQTNANIKLAENLF--IALNNFQENKTASPSESKELAQ----KTLD--LDL--KLEPEE-IETL-GDQINRavs 1554
Cdd:TIGR02168  581 IKGTEIQGNDREILKNIEGFlgVAKDLVKFDPKLRKALSYLLGGvlvvDDLDnaLELakKLRPGYrIVTLdGDLVRP--- 657
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1555 slknvEAIIY--RTKPDLDRVNNLQSIANATKEKADkildsansVVESLAAADESQGKAKDAIQQANSNIELAGQDLEKI 1632
Cdd:TIGR02168  658 -----GGVITggSAKTNSSILERRREIEELEEKIEE--------LEEKIAELEKALAELRKELEELEEELEQLRKELEEL 724
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1633 DEETYSAEAPANNTAQQVEKLAKKVQKLQNN--------------IMKNDRDAKEITKEAGSVKLEAMRARGEANNLQSA 1698
Cdd:TIGR02168  725 SRQISALRKDLARLEAEVEQLEERIAQLSKElteleaeieeleerLEEAEEELAEAEAEIEELEAQIEQLKEELKALREA 804
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1699 TSATNQTLTDRASRSENARERAKQLLQRAS---KLTVDTNAKLKDLNDLQTVYlnkNQQLLRLQAEIGPLNKELNEHLih 1775
Cdd:TIGR02168  805 LDELRAELTLLNEEAANLRERLESLERRIAateRRLEDLEEQIEELSEDIESL---AAEIEELEELIEELESELEALL-- 879
                          650
                   ....*....|
gi 7297300    1776 iKERGSHYRQ 1785
Cdd:TIGR02168  880 -NERASLEEA 888
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1043-1091 7.94e-11

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 58.54  E-value: 7.94e-11
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300    1043 CECDFLGTNNtiAHCDRFTGQCPCLPNVQGVRCDQCAENHWKIASGEGC 1091
Cdd:pfam00053    1 CDCNPHGSLS--GTCDPETGQCLCKPGVTGRRCDRCKPGYYGLPSGSPQ 47
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
1228-1677 1.03e-10

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 66.58  E-value: 1.03e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1228 SEFSELDKKLQHIRN-LLQNTSV------SLVDIEK----LDYETQSLRDQLQASHGRL----SETEQNLDDIYNsLSLS 1292
Cdd:TIGR04523  314 SELKNQEKKLEEIQNqISQNNKIisqlneQISQLKKeltnSESENSEKQRELEEKQNEIeklkKENQSYKQEIKN-LESQ 392
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1293 GVELES-LQNHSRLVQQLSKELK--ENGIQLQESNIEGALNLTRHAYERVSNL----STLKDEANELASNTDRNCKRVEN 1365
Cdd:TIGR04523  393 INDLESkIQNQEKLNQQKDEQIKklQQEKELLEKEIERLKETIIKNNSEIKDLtnqdSVKELIIKNLDNTRESLETQLKV 472
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1366 LSNKIQAEADDLANNNKLIEDYRAELTSLTSQIPELNNQVcgkpgdpcdslcggagcghcgGFLSCEHGAKTHSEEALKV 1445
Cdd:TIGR04523  473 LSRSINKIKQNLEQKQKELKSKEKELKKLNEEKKELEEKV---------------------KDLTKKISSLKEKIEKLES 531
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1446 AK-DAETAITSKKDQADQTIRALTQAKLnaseayEKAKRGFEQSERYLNQTNANIKlaenlfiaLNNFQENKTAspsesK 1524
Cdd:TIGR04523  532 EKkEKESKISDLEDELNKDDFELKKENL------EKEIDEKNKEIEELKQTQKSLK--------KKQEEKQELI-----D 592
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1525 ELAQKTLDLDLKLEPEE--IETLGDQINRAVSSLKNVEAIIyrtkpdldrvNNLQSIANATKEKADKILDSANSVVESLA 1602
Cdd:TIGR04523  593 QKEKEKKDLIKEIEEKEkkISSLEKELEKAKKENEKLSSII----------KNIKSKKNKLKQEVKQIKETIKEIRNKWP 662
                          410       420       430       440       450       460       470
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 7297300    1603 AADEsqgKAKDAIQQANSNIELAGQDLEK--IDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKE 1677
Cdd:TIGR04523  663 EIIK---KIKESKTKIDDIIELMKDWLKElsLHYKKYITRMIRIKDLPKLEEKYKEIEKELKKLDEFSKELENIIKN 736
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1229-1773 1.29e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 66.66  E-value: 1.29e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1229 EFSELDKKLQHIRNLLqntsvslvdiekLDYETQSLRDQLQASHGRLSETEQNLDDIYnslslsgvelESLQNHSRLVQQ 1308
Cdd:COG1196  214 RYQELKAELRELELAL------------LLAKLKELRKELEELEEELSRLEEELEELQ----------EELEEAEKEIEE 271
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1309 LSKELKEngIQLQESNIEGALNLTRHAYERV-SNLSTLKDEANELASNTDRNCKRVENLSNKIQAEADDLANNNKLIEDY 1387
Cdd:COG1196  272 LKSELEE--LREELEELQEELLELKEEIEELeGEISLLRERLEELENELEELEERLEELKEKIEALKEELEERETLLEEL 349
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1388 RAELTSLTSQIPELNNQvcgkpgdpcdslcggagcghCGGFLSCEHGAKTHSEEALKVAKDAETAITSKKDQADQTIRAL 1467
Cdd:COG1196  350 EQLLAELEEAKEELEEK--------------------LSALLEELEELFEALREELAELEAELAEIRNELEELKREIESL 409
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1468 TQAKLNASEAYEKAKRGFEQSERYLNQTNANIKLAENLFIALNNFQENKTASPSE-SKELAQKTLDL-DLKLEPEEIETL 1545
Cdd:COG1196  410 EERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKElERELAELQEELqRLEKELSSLEAR 489
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1546 GDQINRAVSSLKNVEAIIYRTK----------PDLDRV-------------NNLQSIANATKEKA--------------- 1587
Cdd:COG1196  490 LDRLEAEQRASQGVRAVLEALEsglpgvygpvAELIKVkekyetaleaalgNRLQAVVVENEEVAkkaieflkenkagra 569
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1588 -----DKILDSANS----------------------------------VVESLAAADESQGKAKDAI------------- 1615
Cdd:COG1196  570 tflplDRIKPLRSLksdaapgflglasdlidfdpkyepavrfvlgdtlVVDDLEQARRLARKLRIKYrivtldgdlveps 649
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1616 ------QQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKEAGSVKLEAMRAR 1689
Cdd:COG1196  650 gsitggSRNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALE 729
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1690 GEANNLQS-------ATSATNQTLTDRASRSENARERAKQLLQRASKLTVDTNAKLKDLNDLQTVYLNKNQQLLRLQAEI 1762
Cdd:COG1196  730 EELEQLQSrleeleeELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRL 809
                        650
                 ....*....|.
gi 7297300  1763 GPLNKELNEHL 1773
Cdd:COG1196  810 DALERELESLE 820
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
1043-1091 5.50e-10

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 56.17  E-value: 5.50e-10
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*....
gi 7297300     1043 CECDFLGTNNTiaHCDRFTGQCPCLPNVQGVRCDQCAENHWKiASGEGC 1091
Cdd:smart00180    1 CDCDPGGSASG--TCDPDTGQCECKPNVTGRRCDRCAPGYYG-DGPPGC 46
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
1043-1092 1.06e-09

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 55.44  E-value: 1.06e-09
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 7297300  1043 CECDFLGTNNTiaHCDRFTGQCPCLPNVQGVRCDQCAENHWKIAS-GEGCE 1092
Cdd:cd00055    2 CDCNGHGSLSG--QCDPGTGQCECKPNTTGRRCDRCAPGYYGLPSqGGGCQ 50
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1286-1678 1.34e-09

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 63.19  E-value: 1.34e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1286 YNSLSLSGVELESLQNHsrlVQQLSKELKENGIQLQESNIEgalnlTRHAYERVSNLSTLKDEANELASNTDRNCKRVEN 1365
Cdd:COG1196  659 KRSSLAQKRELKELEEE---LAELEAQLEKLEEELKSLKNE-----LRSLEDLLEELRRQLEELERQLEELKRELAALEE 730
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1366 LSNKIQAeadDLANNNKLIEDYRAELTSLTSQIPELnnqvcgkpgdpcdslcggagcghcggflscehgakthsEEALKV 1445
Cdd:COG1196  731 ELEQLQS---RLEELEEELEELEEELEELQERLEEL--------------------------------------EEELES 769
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1446 AKDAETAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYLNQTNANIKLAENlfiALNNFQENKtaspsESKE 1525
Cdd:COG1196  770 LEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQ---EIEELEEEI-----EELE 841
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1526 LAQKTLDLDLKLEPEEIETLGDQINRAVSSLKNVEAIIYRTKpdlDRVNNLQSIANATKEKADKILDSANSVVESLAAAD 1605
Cdd:COG1196  842 EKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELE---EEKEELEEELRELESELAELKEEIEKLRERLEELE 918
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1606 ESQGKAKDAIQQANSNIELAGQD---------LEKIDEETySAEAPANNTA---------------QQVEKLAKKVQKLQ 1661
Cdd:COG1196  919 AKLERLEVELPELEEELEEEYEDtletelereIERLEEEI-EALGPVNLRAieeyeeveeryeelkSQREDLEEAKEKLL 997
                        410
                 ....*....|....*..
gi 7297300  1662 NNIMKNDRDAKEITKEA 1678
Cdd:COG1196  998 EVIEELDKEKRERFKET 1014
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
529-567 1.45e-09

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 55.01  E-value: 1.45e-09
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 7297300      529 CNCDAGGSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYY 39
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
477-526 2.14e-09

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 54.67  E-value: 2.14e-09
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 7297300   477 PCTCNPLGTLNNSgCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGC 526
Cdd:cd00055    1 PCDCNGHGSLSGQ-CDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQGGGC 49
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
529-567 3.23e-09

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 53.90  E-value: 3.23e-09
                         10        20        30
                 ....*....|....*....|....*....|....*....
gi 7297300   529 CNCDAGGSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567
Cdd:cd00055    2 CDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYY 40
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
417-476 3.29e-09

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 53.90  E-value: 3.29e-09
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   417 PCDCDPQGSSDdGICDSLNeleegavaGACHCKAFVTGRRCNQCKDGYWNLQSdNPEGCE 476
Cdd:cd00055    1 PCDCNGHGSLS-GQCDPGT--------GQCECKPNTTGRRCDRCAPGYYGLPS-QGGGCQ 50
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
478-526 3.75e-09

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 53.92  E-value: 3.75e-09
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 7297300     478 CTCNPLGTLNnSGCVMRTGECKCKKYVTGKDCNQCMPETYGL-SESPEGC 526
Cdd:pfam00053    1 CDCNPHGSLS-GTCDPETGQCLCKPGVTGRRCDRCKPGYYGLpSGSPQGC 49
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
418-475 1.12e-08

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 52.31  E-value: 1.12e-08
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|....*...
gi 7297300      418 CDCDPQGSSDDGiCDSLNeleegavaGACHCKAFVTGRRCNQCKDGYWNlqsDNPEGC 475
Cdd:smart00180    1 CDCDPGGSASGT-CDPDT--------GQCECKPNVTGRRCDRCAPGYYG---DGPPGC 46
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
1200-1404 2.41e-08

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 58.93  E-value: 2.41e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1200 LSALEDATTATILRAKEIKQVGAtgaytsEFSELDKKLQHIRNLLQNTSVslvDIEKLDYETQSLRDQLQASHGRLSETE 1279
Cdd:TIGR02169  708 SQELSDASRKIGEIEKEIEQLEQ------EEEKLKERLEELEEDLSSLEQ---EIENVKSELKELEARIEELEEDLHKLE 778
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1280 QNLDDIYNSLSLSGVEleSLQNHSRlvqQLSKELKENGIQLQEsnIEGALN--LTRHAYERvSNLSTLKDEANELASNTD 1357
Cdd:TIGR02169  779 EALNDLEARLSHSRIP--EIQAELS---KLEEEVSRIEARLRE--IEQKLNrlTLEKEYLE-KEIQELQEQRIDLKEQIK 850
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*..
gi 7297300    1358 RNCKRVENLSNKIQAEADDLANNNKLIEDYRAELTSLTSQIPELNNQ 1404
Cdd:TIGR02169  851 SIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDELEAQ 897
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1142-1190 2.53e-08

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 51.60  E-value: 2.53e-08
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 7297300    1142 CECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIGqFPHCSPCG 1190
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYYG-LPSGSPQG 48
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
1141-1189 2.84e-08

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 51.20  E-value: 2.84e-08
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 7297300  1141 PCECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIGQFPHCSPC 1189
Cdd:cd00055    1 PCDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQGGGC 49
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1486-1785 3.16e-08

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 58.57  E-value: 3.16e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1486 EQSERYLNQTNANIKLAENLFIALNNFQEnktaSPSESKELAQKTLDLDLKLEPEEIETLGDQINRAVSSLKNVEAIIYR 1565
Cdd:COG1196  175 EEAERKLERTEENLERLEDLLEELEKQLE----KLERQAEKAERYQELKAELRELELALLLAKLKELRKELEELEEELSR 250
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1566 TKPDLDRVNNLQSIANATKEKADKILDSANsvvESLAAADESQGKAKDAIQQANSNIELAG----------QDLEKIDEE 1635
Cdd:COG1196  251 LEEELEELQEELEEAEKEIEELKSELEELR---EELEELQEELLELKEEIEELEGEISLLRerleelenelEELEERLEE 327
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1636 TysaEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEItKEAGSVKLEAMRARGEAnnLQSATSATNQTLTDRASRSEN 1715
Cdd:COG1196  328 L---KEKIEALKEELEERETLLEELEQLLAELEEAKEEL-EEKLSALLEELEELFEA--LREELAELEAELAEIRNELEE 401
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1716 ARERAKQLLQRASKLTVDTNAKLKDLNDLQTVYLNKNQQLLRLQAEIGPLNKELNEHLIHIKERGSHYRQ 1785
Cdd:COG1196  402 LKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAE 471
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
1452-1743 3.35e-08

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 57.69  E-value: 3.35e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1452 AITSKKDQADQTIRALTQAKLNASEAYEKAKrgFEQSERYLNQTNANIKLAENLFIALNNFQENKTAS-PSESKELAQKT 1530
Cdd:COG0840   25 KLKKLIDELGKLLLSLNLILDDAASAEAAAL--KAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDlLEVVERIAAGD 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1531 LDLDLKLE-PEEIETLGDQINRAVSSLknvEAIIYRTKPDLDRVNN-LQSIANATKEKADKILDSANSVVESLAAADESQ 1608
Cdd:COG0840  103 LTKRIDESsNDEFGQLAKSFNEMILNL---RQIIDAVQDNAEALSGaSEEIAASATELSARADQQAESLEEVASAIEELS 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1609 gkakDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITK------------ 1676
Cdd:COG0840  180 ----ETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEITSvinsiaeqtnll 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1677 --EAGSvklEAMRArGE---------------ANNLQSATSATNQTLTDRASRSENARERAKQLLQRAS---KLTVDTNA 1736
Cdd:COG0840  256 alNAAI---EAARA-GEagrgfavvadevrklAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSegvKLVEETGS 331

                 ....*..
gi 7297300  1737 KLKDLND 1743
Cdd:COG0840  332 SLGEIAA 338
PRK02224 PRK02224
chromosome segregation protein; Provisional
1528-1756 4.61e-08

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 58.13  E-value: 4.61e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1528 QKTLDLDLKLEPEEIET--LGDQINRAVSSLKNVEAIIyrtkpdlDRVNNLQSIANATKEKADKILDSANSVVESL---- 1601
Cdd:PRK02224  185 QRGSLDQLKAQIEEKEEkdLHERLNGLESELAELDEEI-------ERYEEQREQARETRDEADEVLEEHEERREELetle 257
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1602 AAADESQGK----------AKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDA 1671
Cdd:PRK02224  258 AEIEDLRETiaeterereeLAEEVRDLRERLEELEEERDDLLAEAGLDDADAEAVEARREELEDRDEELRDRLEECRVAA 337
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1672 KEITKEAGSV-----KLE--AMRARGEANNLQSATSATNQTLTDRASRSENARERAKQLLQRASKLTVD----------- 1733
Cdd:PRK02224  338 QAHNEEAESLredadDLEerAEELREEAAELESELEEAREAVEDRREEIEELEEEIEELRERFGDAPVDlgnaedfleel 417
                         250       260       270
                  ....*....|....*....|....*....|..
gi 7297300   1734 ------TNAKLKDLN-DLQTV--YLNKNQQLL 1756
Cdd:PRK02224  418 reerdeLREREAELEaTLRTAreRVEEAEALL 449
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1273-1656 4.67e-08

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 58.19  E-value: 4.67e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1273 GRLSETEQNLD---DIYNSLSLsgvELESLQNHSRLV---QQLSKELKEngiqlqesnIEGALNLTRHaYERVSNLSTLK 1346
Cdd:COG1196  179 RKLERTEENLErleDLLEELEK---QLEKLERQAEKAeryQELKAELRE---------LELALLLAKL-KELRKELEELE 245
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1347 DEANELASNTDRNCKRVENLSNKIQAEADDLANNNKLIEDYRAELTSLTSQIPELNNQVcgkpgdpcdslcggagcghcg 1426
Cdd:COG1196  246 EELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEI--------------------- 304
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1427 gflscEHGAKT--HSEEALKVAKDAETAITSKKDQADQTIRALTQ--AKLNASEAYEKAKRgfEQSERYLNqtnANIKLA 1502
Cdd:COG1196  305 -----SLLRERleELENELEELEERLEELKEKIEALKEELEERETllEELEQLLAELEEAK--EELEEKLS---ALLEEL 374
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1503 ENLFIALNNfqenktaspsESKELAQKTLDLDlklepEEIETLGDQINRAVSSLKN----VEAIIYRTKPDLDRVNNLQS 1578
Cdd:COG1196  375 EELFEALRE----------ELAELEAELAEIR-----NELEELKREIESLEERLERlserLEDLKEELKELEAELEELQT 439
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7297300  1579 IANATKEKADKILDSANSVVESLAAADESQGKAKDAIQQANSNIELAGQDLEKIdeetySAEAPANNTAQQVEKLAKK 1656
Cdd:COG1196  440 ELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKELSSLEARLDRL-----EAEQRASQGVRAVLEALES 512
PRK02224 PRK02224
chromosome segregation protein; Provisional
1240-1779 9.16e-08

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 56.97  E-value: 9.16e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1240 IRNLLQNTSVSLVDIEKL--DYETQSLRDQLQASHGRLSETEQNLDDiYNSLSLSGVEL-----ESLQNHSRLVQQLSkE 1312
Cdd:PRK02224  178 VERVLSDQRGSLDQLKAQieEKEEKDLHERLNGLESELAELDEEIER-YEEQREQARETrdeadEVLEEHEERREELE-T 255
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1313 LKENGIQLQESnIEGAL----NLTRHAYERVSNLSTLKDEANELASNTDRNCKRVENLSNKIQAEADDLANNNKLIEDYR 1388
Cdd:PRK02224  256 LEAEIEDLRET-IAETErereELAEEVRDLRERLEELEEERDDLLAEAGLDDADAEAVEARREELEDRDEELRDRLEECR 334
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1389 AELTSLTSQIPELNNQVcgkpgdpcDSLcggagcghcggflscEHGAKTHSEEALKVAKDAETAITSKKDQADQtIRALT 1468
Cdd:PRK02224  335 VAAQAHNEEAESLREDA--------DDL---------------EERAEELREEAAELESELEEAREAVEDRREE-IEELE 390
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1469 QAKLNASEAYEKAKRGFEQSERYL-----NQTNANIKLAE---NLFIALNNFQENKT-------------------ASPS 1521
Cdd:PRK02224  391 EEIEELRERFGDAPVDLGNAEDFLeelreERDELREREAEleaTLRTARERVEEAEAlleagkcpecgqpvegsphVETI 470
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1522 ESKELAQKTLDLDLKLEPEEIETLGDQINRAvSSLKNVEAIIYRTKPDLDRVNNLQSIANAT-KEKADKILDSANSVVES 1600
Cdd:PRK02224  471 EEDRERVEELEAELEDLEEEVEEVEERLERA-EDLVEAEDRIERLEERREDLEELIAERRETiEEKRERAEELRERAAEL 549
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1601 LAAADESQGKAKDAIQQANSNIELAG---QDLEKIDEETYSAE------APANNTAQQVEKLAKKVQKLQNnimKND--R 1669
Cdd:PRK02224  550 EAEAEEKREAAAEAEEEAEEAREEVAelnSKLAELKERIESLErirtllAAIADAEDEIERLREKREALAE---LNDerR 626
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1670 DakeitkeagsvKLEAMRARgeannlqsatsatNQTLtdRASRSENARERAKQLLQRASKLTVDTNAKLKDLNDLQTvyl 1749
Cdd:PRK02224  627 E-----------RLAEKRER-------------KREL--EAEFDEARIEEAREDKERAEEYLEQVEEKLDELREERD--- 677
                         570       580       590
                  ....*....|....*....|....*....|
gi 7297300   1750 nknqqllRLQAEIGPLNKELNEhLIHIKER 1779
Cdd:PRK02224  678 -------DLQAEIGAVENELEE-LEELRER 699
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
883-930 9.78e-08

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 49.68  E-value: 9.78e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 7297300     883 CQCNGHAA---TCDPIQGTCiDCQDSTTGYSCDSCLDGYYGNPLfGSEIGC 930
Cdd:pfam00053    1 CDCNPHGSlsgTCDPETGQC-LCKPGVTGRRCDRCKPGYYGLPS-GSPQGC 49
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
883-931 1.47e-07

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 49.27  E-value: 1.47e-07
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 7297300   883 CQCNGHAA---TCDPIQGTCIdCQDSTTGYSCDSCLDGYYGNPLFGSeiGCR 931
Cdd:cd00055    2 CDCNGHGSlsgQCDPGTGQCE-CKPNTTGRRCDRCAPGYYGLPSQGG--GCQ 50
rad50 TIGR00606
rad50; All proteins in this family for which functions are known are involvedin recombination, ...
1227-1781 1.94e-07

rad50; All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).


Pssm-ID: 129694 [Multi-domain]  Cd Length: 1311  Bit Score: 56.21  E-value: 1.94e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1227 TSEFSELDKKLQHIRNLLQNTSVSLVDIEKLDYETQSLRDQLQASHGRLSE-TEQNLDDIYNSLSLSG-----------V 1294
Cdd:TIGR00606  247 LDPLKNRLKEIEHNLSKIMKLDNEIKALKSRKKQMEKDNSELELKMEKVFQgTDEQLNDLYHNHQRTVrekerelvdcqR 326
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1295 ELESLQNHSRLVQQLSKEL--KENGIQLQESNIEgaLNLTRHAYERVSNLSTLKDEANELASNTDRNCKRVENLsnKIQA 1372
Cdd:TIGR00606  327 ELEKLNKERRLLNQEKTELlvEQGRLQLQADRHQ--EHIRARDSLIQSLATRLELDGFERGPFSERQIKNFHTL--VIER 402
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1373 EADDLANNNKLIEDYRAELTSLTSQIPELNNQVCGKpgdpcdslcggagcghcggflscehgAKTHSEEALKVAKdaeta 1452
Cdd:TIGR00606  403 QEDEAKTAAQLCADLQSKERLKQEQADEIRDEKKGL--------------------------GRTIELKKEILEK----- 451
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1453 itsKKDQADQTIRALTQAKLNASEAYEKakrgfeqsERYLNQTNANIKLAENlfialNNFQENKTAspsESKELAQKTLD 1532
Cdd:TIGR00606  452 ---KQEELKFVIKELQQLEGSSDRILEL--------DQELRKAERELSKAEK-----NSLTETLKK---EVKSLQNEKAD 512
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1533 LDLKLEPEEIETlgDQINRAVSSLKNVEAIIyRTKPDLDrvnnlqsianatkEKADKILDSANSVVESLAAADESQGKAK 1612
Cdd:TIGR00606  513 LDRKLRKLDQEM--EQLNHHTTTRTQMEMLT-KDKMDKD-------------EQIRKIKSRHSDELTSLLGYFPNKKQLE 576
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1613 DAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMkndrdaKEITKEAGSVKLEAMRARGEA 1692
Cdd:TIGR00606  577 DWLHSKSKEINQTRDRLAKLNKELASLEQNKNHINNELESKEEQLSSYEDKLF------DVCGSQDEESDLERLKEEIEK 650
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1693 NNLQSATSATNQTLTDR-ASRSENARERAKQLLQRASKltvdTNAKLKDL-NDLQTVYLNKNQQLLRLQAEIGPLNKELN 1770
Cdd:TIGR00606  651 SSKQRAMLAGATAVYSQfITQLTDENQSCCPVCQRVFQ----TEAELQEFiSDLQSKLRLAPDKLKSTESELKKKEKRRD 726
                          570
                   ....*....|.
gi 7297300    1771 EHLIHIKERGS 1781
Cdd:TIGR00606  727 EMLGLAPGRQS 737
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
1521-1771 2.29e-07

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 55.84  E-value: 2.29e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1521 SESKELAQKTLDLDLKLEPEEIETLGDQINRAVSSLKNVEAIIYRTKPDLDRVNNLQSIANATKEKADKILDSANSVVES 1600
Cdd:TIGR02169  204 RREREKAERYQALLKEKREYEGYELLKEKEALERQKEAIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELNKKIKD 283
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1601 LAAADESQGKAKDA-----IQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQ------NNIMKNDR 1669
Cdd:TIGR02169  284 LGEEEQLRVKEKIGeleaeIASLERSIAEKERELEDAEERLAKLEAEIDKLLAEIEELEREIEEERkrrdklTEEYAELK 363
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1670 D--------AKEITKEAGSVKLEAMRAR-------GEANNLQSATSATNQTLTDRASRSENARERAKQLLQRASKLTVDT 1734
Cdd:TIGR02169  364 EeledlraeLEEVDKEFAETRDELKDYRekleklkREINELKRELDRLQEELQRLSEELADLNAAIAGIEAKINELEEEK 443
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|.
gi 7297300    1735 NAK--------------LKDLNDLQTVYLNKNQQLLRLQAEIGPLNKELNE 1771
Cdd:TIGR02169  444 EDKaleikkqewkleqlAADLSKYEQELYDLKEEYDRVEKELSKLQRELAE 494
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
1142-1186 3.10e-07

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 48.08  E-value: 3.10e-07
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 7297300     1142 CECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIG-QFPHC 1186
Cdd:smart00180    1 CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYYGdGPPGC 46
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
478-526 3.19e-07

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 48.08  E-value: 3.19e-07
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*....
gi 7297300      478 CTCNPLGTLNNSgCVMRTGECKCKKYVTGKDCNQCMPETYGlsESPEGC 526
Cdd:smart00180    1 CDCDPGGSASGT-CDPDTGQCECKPNVTGRRCDRCAPGYYG--DGPPGC 46
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
991-1043 5.33e-07

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 47.75  E-value: 5.33e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 7297300     991 CECSNNVDLydTGNCDRQTGACLkCLYQTTGDHCELCKDGFFGDALqQNCQQC 1043
Cdd:pfam00053    1 CDCNPHGSL--SGTCDPETGQCL-CKPGVTGRRCDRCKPGYYGLPS-GSPQGC 49
PRK02224 PRK02224
chromosome segregation protein; Provisional
1228-1606 9.74e-07

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 53.89  E-value: 9.74e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1228 SEFSELDKKLQHIRNLLQNTSVslvDIEKLDYETQSLRDQLQASHGRLSETEqnlddiynslslsgVELESLQNHSRLVQ 1307
Cdd:PRK02224  384 EEIEELEEEIEELRERFGDAPV---DLGNAEDFLEELREERDELREREAELE--------------ATLRTARERVEEAE 446
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1308 QLSKELK--ENGIQLQESNIEGALNLTRhayERVSNLSTLKDEANELASNTDRNCKRVENLSnKIQAEADDLANN----N 1381
Cdd:PRK02224  447 ALLEAGKcpECGQPVEGSPHVETIEEDR---ERVEELEAELEDLEEEVEEVEERLERAEDLV-EAEDRIERLEERredlE 522
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1382 KLIEDYRAELTSLTSQIPELNNQVcgkpgdpcDSLcggagcghcggflscEHGAKTHSEEALKVAKDAETA------ITS 1455
Cdd:PRK02224  523 ELIAERRETIEEKRERAEELRERA--------AEL---------------EAEAEEKREAAAEAEEEAEEAreevaeLNS 579
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1456 KKDQADQTIRALT--QAKLNASEAYEkakrgfEQSERyLNQTNANikLAEnlfiaLNNFQENKTASPSESKElaqktlDL 1533
Cdd:PRK02224  580 KLAELKERIESLEriRTLLAAIADAE------DEIER-LREKREA--LAE-----LNDERRERLAEKRERKR------EL 639
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 7297300   1534 DLKLEPEEIETLGDQINRAVSSLKNVEaiiyrtkPDLDrvnnlqsianATKEKADKILDSANSVVESLAAADE 1606
Cdd:PRK02224  640 EAEFDEARIEEAREDKERAEEYLEQVE-------EKLD----------ELREERDDLQAEIGAVENELEELEE 695
TelA COG3853
Uncharacterized conserved protein YaaN involved in tellurite resistance [Defense mechanisms];
1439-1782 9.85e-07

Uncharacterized conserved protein YaaN involved in tellurite resistance [Defense mechanisms];


Pssm-ID: 226371  Cd Length: 386  Bit Score: 52.77  E-value: 9.85e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1439 SEEALKVAKDAE----TAITSKKDQADQTIRALTQAKLNA--SEAYEKAKrgfEQSERYLNQ------TNANIKLAENLF 1506
Cdd:COG3853   27 NSEIVQKEKKAErdlqLENTKKADELAKQIDVSNQQSLLDfgAEAQEKAA---AFSNRMLNEvkitdvGDLGKMLEQLMF 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1507 IaLNnfQENKTASPSESKELAQKTLdLDLKLEPEEI----ETLGDQINRAVSSLKNVEAIIYRTKPDLDR--VNNLQSIA 1580
Cdd:COG3853  104 I-LK--RFDPDELPSDKKGFLTKIF-GRSKSSIQEIfskyQTIGAQIDRIIESLSKGKDELTRDNKMLELlyEKNREYFE 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1581 NATKEKAdkildSANSVVESLAAADESQGKAKDA-----IQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQV----- 1650
Cdd:COG3853  180 HLEKYIA-----AGELKDEELETEIIPELKTKAEsgnqmDVQQVNELTLFINRLEQRVYDLLLARMVALQTAPQIrliqr 254
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1651 --EKLAKKVQKLQNNimkndrdAKEITKEAGSVKLEAMRARGEANNLQSATSATNQTLTdraSRSENARERAKQLLQRAS 1728
Cdd:COG3853  255 nnQELIEKIQSAIIT-------TIPIWKNQVAIALTLKRQKKVLKAQQAVNETTNELLL---SNAEMLKENSIEIAKQAE 324
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 7297300  1729 KLTVDtnakLKDLNDLQTVYLNKNQQLLRLQ-----------AEIGPLNKELNEHLIHIKERGSH 1782
Cdd:COG3853  325 RPTID----IETLKKTQQSVVAAIEETSQIQeegrkkradtiRELDKLEEEIKKKLILLKQNISQ 385
COG5022 COG5022
Myosin heavy chain [General function prediction only];
1227-1770 1.19e-06

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 53.54  E-value: 1.19e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1227 TSEFSELDKKLQHIRNLLQNTSVSLVDIEKL-DYETQSLRDQLQASHGRLSETEQNLDDIYNSLSLSGVEL-ESLQNHSR 1304
Cdd:COG5022  917 SDLIENLEFKTELIARLKKLLNNIDLEEGPSiEYVKLPELNKLHEVESKLKETSEEYEDLLKKSTILVREGnKANSELKN 996
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1305 LVQQLSKELKENGIqLQESniegalnltrhayerVSNLSTLKDEANELASNTDRNCKRVENLSnkIQAEADDLANNNKLi 1384
Cdd:COG5022  997 FKKELAELSKQYGA-LQES---------------TKQLKELPVEVAELQSASKIISSESTELS--ILKPLQKLKGLLLL- 1057
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1385 edyraELTSLTSQIPELNNQvcgKPGDPCDSLCggagcghcggflscehgakthsEEALKVAKDAETAITSKKDQADQTI 1464
Cdd:COG5022 1058 -----ENNQLQARYKALKLR---RENSLLDDKQ----------------------LYQLESTENLLKTINVKDLEVTNRN 1107
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1465 RALTQAKLNASEAYEKAKRGFEQSERYLNQTNANIK-----------LAENLFIALNNFQENKTASP---SESKELAQKT 1530
Cdd:COG5022 1108 LVKPANVLQFIVAQMIKLNLLQEISKFLSQLVNTLEpvfqklsvlqlELDGLFWEANLEALPSPPPFaalSEKRLYQSAL 1187
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1531 LDLDLKLEPEEIETLGDQInravsslknvEAIIYRTKPDLdrvnnlqsianatkEKADKILDSAnsvVESLAAADESQgK 1610
Cdd:COG5022 1188 YDEKSKLSSSEVNDLKNEL----------IALFSKIFSGW--------------PRGDKLKKLI---SEGWVPTEYST-S 1239
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1611 AKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNImkNDRDAKEITKEAGSVKLEamraRG 1690
Cdd:COG5022 1240 LKGFNNLNKKFDTPASMSNEKLLSLLNSIDNLLSSYKLEEEVLPATINSLLQYI--NVGLFNALRTKASSLRWK----SA 1313
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1691 EANNLqsatsatNQTLTD---RASRSENARERAKQLLQRASKLTVDtnakLKDLNDLQTV----YLNKNQQLLRLQAEIG 1763
Cdd:COG5022 1314 TEVNY-------NSEELDdwcREFEISDVDEELEELIQAVKVLQLL----KDDLNKLDELldacYSLNPAEIQNLKSRYD 1382

                 ....*..
gi 7297300  1764 PLNKELN 1770
Cdd:COG5022 1383 PADKENN 1389
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
1485-1774 1.60e-06

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 53.10  E-value: 1.60e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1485 FEQSERYLNQTNANIKLAE----NLFIALNNFQENKTASPSESKELAQKTLDLDLKLEPEEietlgDQINRAVSSLKNVE 1560
Cdd:TIGR04523   35 EKQLEKKLKTIKNELKNKEkelkNLDKNLNKDEEKINNSNNKIKILEQQIKDLNDKLKKNK-----DKINKLNSDLSKIN 109
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1561 AIIyrtKPDLDRVNNLQS-IANATKEK--ADKILDSANSVVESLAA-ADESQGKAKDAIQQansnIELAGQDLEKIDEET 1636
Cdd:TIGR04523  110 SEI---KNDKEQKNKLEVeLNKLEKQKkeNKKNIDKFLTEIKKKEKeLEKLNNKYNDLKKQ----KEELENELNLLEKEK 182
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1637 YSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEIT---KEAGSVKLEAMRARGEANNLQSATSATNQTLTDRASRS 1713
Cdd:TIGR04523  183 LNIQKNIDKIKNKLLKLELLLSNLKKKIQKNKSLESQISelkKQNNQLKDNIEKKQQEINEKTTEISNTQTQLNQLKDEQ 262
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7297300    1714 ENAReraKQLLQRASKLTvDTNAKLKDLNDlqtvylnknqQLLRLQAEIGPLNKELNEHLI 1774
Cdd:TIGR04523  263 NKIK---KQLSEKQKELE-QNNKKIKELEK----------QLNQLKSEISDLNNQKEQDWN 309
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
1567-1771 1.98e-06

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 52.33  E-value: 1.98e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1567 KPDLDRVNNLQSIANATKEKADKILDSANSvveSLAAADESQGKAKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNT 1646
Cdd:COG4372   80 RPQLRALRTELGTAQGEKRAAETEREAARS---ELQKARQEREAVRQELAAARQNLAKAQQELARLTKQAQDLQTRLKTL 156
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1647 AQQVEKLAKKVQKLQNNIMKNDRDAKEITKEAGSVKLEAMRARGEANNLQSATSATNQTLTDRASRSENARERAKQLLQR 1726
Cdd:COG4372  157 AEQRRQLEAQAQSLQASQKQLQASATQLKSQVLDLKLRSAQIEQEAQNLATRANAAQARTEELARRAAAAQQTAQAIQQR 236
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 7297300  1727 ASKLT-VDTNAKLKDlNDLQTvylnKNQQLLRLQAEIGPLNKELNE 1771
Cdd:COG4372  237 DAQISqKAQQIAARA-EQIRE----RERQLQRLETAQARLEQEVAQ 277
PTZ00121 PTZ00121
MAEBL; Provisional
1435-1761 2.33e-06

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 52.84  E-value: 2.33e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1435 AKTHSEEALKVAKDAETAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYLNQTNANIKLAEnlfialnnfqE 1514
Cdd:PTZ00121 1334 AKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKKADAAKKKAEEKKKADEAKKKAEE----------D 1403
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1515 NKTASPSESKELAQKTLDlDLKLEPEEIETLGDQINRAVSSLKNVEAiiYRTKPDLDRVNNLQSIANaTKEKADKILDSA 1594
Cdd:PTZ00121 1404 KKKADELKKAAAAKKKAD-EAKKKAEEKKKADEAKKKAEEAKKADEA--KKKAEEAKKAEEAKKKAE-EAKKADEAKKKA 1479
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1595 nsvvESLAAADESQGKAKDAIQQANSnIELAGQDLEKIDEETYSAEAPANNTAQQVEKlAKKVQKLqnnimkndRDAKEI 1674
Cdd:PTZ00121 1480 ----EEAKKADEAKKKAEEAKKKADE-AKKAAEAKKKADEAKKAEEAKKADEAKKAEE-AKKADEA--------KKAEEK 1545
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1675 TKEAGSVKLEAMRARGEANNLQSATsatnqtltdRASRSENARERAKQLLQRASKLTVDTNAKLKDLNDLQTVYLNKNQQ 1754
Cdd:PTZ00121 1546 KKADELKKAEELKKAEEKKKAEEAK---------KAEEDKNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAE 1616

                  ....*..
gi 7297300   1755 LLRLQAE 1761
Cdd:PTZ00121 1617 EAKIKAE 1623
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
1451-1731 2.68e-06

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 51.53  E-value: 2.68e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1451 TAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQ-SERYLNQTNANIKLAENLFIALNNFQENKTASpSESKELAQK 1529
Cdd:COG0840  120 KSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATElSARADQQAESLEEVASAIEELSETVKEVAFNA-KEAAALASE 198
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1530 TLDLdlklepeeIETLGDQINRAVSSLKNVEAIIYRTKPDL-DRVNNLQSIANATKEKADKI-LDSANSVVESlAAADEs 1607
Cdd:COG0840  199 ASQV--------AEEGGEEVRQAVEQMQEIAEELAEVVKKLsESSQEIEEITSVINSIAEQTnLLALNAAIEA-ARAGE- 268
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1608 QGKA---------KDAIQQANSNIELAGQdLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKE- 1677
Cdd:COG0840  269 AGRGfavvadevrKLAERSADSAKEIGLL-IEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLi 347
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 7297300  1678 ---AGSVKLEAMRARGEANNLQSATSATNQTltdrASRSENARERAKQLLQRASKLT 1731
Cdd:COG0840  348 seiAAATEEQTAVLEEINASIEELDDVTQEN----AAAVEELAAASEELKELAEKLL 400
Cast pfam10174
RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part ...
1213-1723 2.79e-06

RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion. The C-terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). The family also contains four coiled-coil domains.


Pssm-ID: 313412 [Multi-domain]  Cd Length: 763  Bit Score: 52.25  E-value: 2.79e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1213 RAKEIKQVGAtgaYTSEFSELDKKLQHIRNllqntsvslvDIEKLDYETQSLRDQLQASHGRLSETEQNLDDIYNSLSLS 1292
Cdd:pfam10174  267 REEEIKQMEV---YKSHSKFMKNKIDQLKQ----------ELSKKETELLALQTKLETLNNQFSDSKQHIEVLKESLTAK 333
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1293 GVELESLQNHsrlVQQLSKELKENGIQLQESniegalnlTRHAYERVSNLSTLKDEANELASNTDRNCKRVENLSNKIQA 1372
Cdd:pfam10174  334 EQRAAILQTE---VDALRLRLEEKESFLNKK--------TKQLQDLTEEKSTLAGEIRDLKDMLDVKERKINVLQKKIEN 402
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1373 EADDLANNNKLIEDYRAELTSLTSqipelnnqvcgkpgDPCDSlcggagcghcggflsceHGAKTHSEEALKvakDAETA 1452
Cdd:pfam10174  403 LQEQLRDKDKQLSNLKDRVKSLQT--------------DSSNT-----------------DTALTTLEEALA---EKERI 448
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1453 ITSKKDQADQtiraLTQAKLNASEAYEKAKRGFEQSeryLNQTNANIKLAENLFIALNNfQENKTASPSESKELAQKTLD 1532
Cdd:pfam10174  449 IERLKEQRER----EEREKLDEVDSYKKELKDLKEK---VSLLQGDLTERETSLLDLKE-HASSLASSGLKKDSKLKSLE 520
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1533 LDLKLEPEEIETLGDQINRAVSSlknveAIIYRTKPDL-DRVNNLQSIANATKEKADKILDSANSVVESLAAADESQGKA 1611
Cdd:pfam10174  521 IAIEQKKEECNKLENQLKKAHSA-----AVEARANPEFsDRIKQLEKEVSYYKDEASKAQAEVDRLLEILKEVENEKNDK 595
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1612 KDAIQQANSNIELAGQDLEKideetysaEAPANNTAQQVEKlAKKVQKLQNNIMKND---RDAKEITKEAGSVKLEamRA 1688
Cdd:pfam10174  596 DKKIAELESLTSRQMKDQTK--------KVANLKHGQQLEK-KKNAQLLEEARRREDsldDNSQHLQLEELLNAME--KT 664
                          490       500       510
                   ....*....|....*....|....*....|....*.
gi 7297300    1689 RGEANNLQSATSATNQTLTDRASRSENAR-ERAKQL 1723
Cdd:pfam10174  665 KQELESTKARLSSTQQSLAEKEGHLTNLRaERRKQL 700
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
1503-1771 2.86e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 52.38  E-value: 2.86e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1503 ENLFIALNNFQENKTASPSESKELAQKTLDLDLKLE--PEEIETLGDQINRAVSSLKNVEAIIYRTKpdldrvnnlQSIA 1580
Cdd:TIGR02169  684 EGLKRELSSLQSELRRIENRLDELSQELSDASRKIGeiEKEIEQLEQEEEKLKERLEELEEDLSSLE---------QEIE 754
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1581 NATKEKADkildsansVVESLAAADESQGKAKDAIQQ-----ANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEK--- 1652
Cdd:TIGR02169  755 NVKSELKE--------LEARIEELEEDLHKLEEALNDlearlSHSRIPEIQAELSKLEEEVSRIEARLREIEQKLNRltl 826
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1653 ----LAKKVQKLQNNI--MKNDRDAKEITKEAGSVKLEAMRArgEANNLQSATSATNQTLTDRASRSENARERAKQLLQR 1726
Cdd:TIGR02169  827 ekeyLEKEIQELQEQRidLKEQIKSIEKEIENLNGKKEELEE--ELEELEAALRDLESRLGDLKKERDELEAQLRELERK 904
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*
gi 7297300    1727 ASKLTVDTNAKLKDLNDLQTVYLNKNQQLlrlqAEIGPLNKELNE 1771
Cdd:TIGR02169  905 IEELEAQIEKKRKRLSELKAKLEALEEEL----SEIEDPKGEDEE 945
PRK03918 PRK03918
chromosome segregation protein; Provisional
1212-1773 3.11e-06

chromosome segregation protein; Provisional


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 51.99  E-value: 3.11e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1212 LRAKEIKQVGATGAYTSEFSELDKKLQHIRNLLQNTSVSLVDIEKLDYETQSLRDQLQASHGRLSETEQNLDDI------ 1285
Cdd:PRK03918  212 ISSELPELREELEKLEKEVKELEELKEEIEELEKELESLEGSKRKLEEKIRELEERIEELKKEIEELEEKVKELkelkek 291
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1286 ---YNSLS---------LSGVE--LESLQNHSRLVQQLSKELKENGIQLQEsnIEGALNLTRHAYERVSNLSTLKDEANE 1351
Cdd:PRK03918  292 aeeYIKLSefyeeyldeLREIEkrLSRLEEEINGIEERIKELEEKEERLEE--LKKKLKELEKRLEELEERHELYEEAKA 369
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1352 LASNTDRNCKRVENLS-NKIQAEADDLANNNKLIEDYRAELT----SLTSQIPELNNQ------------VCGKPgdpcd 1414
Cdd:PRK03918  370 KKEELERLKKRLTGLTpEKLEKELEELEKAKEEIEEEISKITarigELKKEIKELKKAieelkkakgkcpVCGRE----- 444
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1415 slcggagcghcggfLSCEHGAKTHSEEALKVAKdaetaITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYlnq 1494
Cdd:PRK03918  445 --------------LTEEHRKELLEEYTAELKR-----IEKELKEIEEKERKLRKELRELEKVLKKESELIKLKELA--- 502
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1495 tnaniKLAENLFIALNNFQENKTaspSESKELAQKTLDLDLKLEpEEIETLGDQINRAvSSLKNVEAIIYRTKPDLDRvn 1574
Cdd:PRK03918  503 -----EQLKELEEKLKKYNLEEL---EKKAEEYEKLKEKLIKLK-GEIKSLKKELEKL-EELKKKLAELEKKLDELEE-- 570
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1575 NLQSIANATKEKADKILDSANSVVESLAAADESQGKAKDAIQQansnIELAGQDLEKIDEETYSAEAPANNTAQQVEKLA 1654
Cdd:PRK03918  571 ELAELLKELEELGFESVEELEERLKELEPFYNEYLELKDAEKE----LEREEKELKKLEEELDKAFEELAETEKRLEELR 646
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300   1655 KKVQKLQNNImkNDRDAKEITKEAGSVKLEAMRARGEANNLQSATSATNQTLTDRASRSENARERAKQL--LQRASKLTV 1732
Cdd:PRK03918  647 KELEELEKKY--SEEEYEELREEYLELSRELAGLRAELEELEKRREEIKKTLEKLKEELEEREKAKKELekLEKALERVE 724
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|.
gi 7297300   1733 DTNAKLKDLndlqtvylnKNQQLLRLQAEIGPLNKELNEHL 1773
Cdd:PRK03918  725 ELREKVKKY---------KALLKERALSKVGEIASEIFEEL 756
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
1231-1673 3.85e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 51.99  E-value: 3.85e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1231 SELDKKLQHIRNLLQNTSVSlvdIEKLDYETQSLRDQLQashgRLsETEQNLDDIYNSLSLSGVELE------------- 1297
Cdd:TIGR02169  166 AEFDRKKEKALEELEEVEEN---IERLDLIIDEKRQQLE----RL-RREREKAERYQALLKEKREYEgyellkekealer 237
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1298 SLQNHSRLVQQLSKELKENGIQLQESN--IEGALNLTRHAYERVSNLS-----TLKDEANELASNTdRNCKRVENLSNKI 1370
Cdd:TIGR02169  238 QKEAIERQLASLEEELEKLTEEISELEkrLEEIEQLLEELNKKIKDLGeeeqlRVKEKIGELEAEI-ASLERSIAEKERE 316
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1371 QAEADD-LANNNKLIEDYRAELTSLTSQIPELNNQVcgkpgdpcDSLcggagcghcggflscehgakthsEEALKVAKDA 1449
Cdd:TIGR02169  317 LEDAEErLAKLEAEIDKLLAEIEELEREIEEERKRR--------DKL-----------------------TEEYAELKEE 365
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1450 ETAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYLNQTnanIKLAENLFIALNNFQENKTASPSESKELAQK 1529
Cdd:TIGR02169  366 LEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDRL---QEELQRLSEELADLNAAIAGIEAKINELEEE 442
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1530 TLDLDlklepEEIETLGDQINRAVSSLKNVEAIIYRTKPDLDRVNNLQSianatkeKADKILDSANSvveSLAAADESQG 1609
Cdd:TIGR02169  443 KEDKA-----LEIKKQEWKLEQLAADLSKYEQELYDLKEEYDRVEKELS-------KLQRELAEAEA---QARASEERVR 507
                          410       420       430       440       450       460
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7297300    1610 KAKDAIQQANSNIE-LAGQ--DLEKIDEETYSA-EAPANNtaqqveklakkvqKLQNNIMKNDRDAKE 1673
Cdd:TIGR02169  508 GGRAVEEVLKASIQgVHGTvaQLGSVGERYATAiEVAAGN-------------RLNNVVVEDDAVAKE 562
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
991-1041 4.02e-06

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 45.42  E-value: 4.02e-06
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 7297300   991 CECSNNVDLydTGNCDRQTGACLkCLYQTTGDHCELCKDGFFGDALQ-QNCQ 1041
Cdd:cd00055    2 CDCNGHGSL--SGQCDPGTGQCE-CKPNTTGRRCDRCAPGYYGLPSQgGGCQ 50
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
529-567 4.80e-06

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 333801  Cd Length: 49  Bit Score: 45.06  E-value: 4.80e-06
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 7297300     529 CNCDAGGSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567
Cdd:pfam00053    1 CDCNPHGSLSGTCDPETGQCLCKPGVTGRRCDRCKPGYY 39
7TMR-HDED pfam07697
7TM-HD extracellular; This entry represents the extracellular domain of the 7TM-HD (7TM ...
1460-1687 7.37e-06

7TM-HD extracellular; This entry represents the extracellular domain of the 7TM-HD (7TM Receptors with HD hydrolase).


Pssm-ID: 336770  Cd Length: 218  Bit Score: 48.86  E-value: 7.37e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1460 ADQTIRA----------LTQAKlnASEAYEKAKRGFEQSERYLNQTNANIklaENLFIALNNFQENKTASPSESKELAQK 1529
Cdd:pfam07697    6 APQDIKAprdievedeeATEEK--REEAAESVPPVYDLDPEVTEEIRDRL---ENLFDSIDEVRAAENSEEDLAEKIEEL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1530 TLDLDLKLEPEEIETL----GDQINRAVSSLKNVEAIIYRTKPDLDRVNNLQSIANATKEKADKILDSANSVVESLAaad 1605
Cdd:pfam07697   81 KEALPFYLSDEELEALlnlsDEDLQELEDAILQILERILSQGIREDELEEAREAVAEQLKNALQLSSELRELASKLL--- 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1606 esqgkakDAIQQANSnielagqdleKIDEETysaeapannTAQQVEKLAKKVQKLQNNIMKNDRDAKE---ITKEAgSVK 1682
Cdd:pfam07697  158 -------SSVLRPNL----------VYDEEA---------TEELREEAAEAVEPVMVKIKKGEVIVREgevVTEEQ-YEK 210

                   ....*
gi 7297300    1683 LEAMR 1687
Cdd:pfam07697  211 LEALG 215
MscS_porin pfam12795
Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part ...
1231-1405 8.09e-06

Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part of the turgor-driven solute efflux system that protects bacteria from lysis in the event of osmotic shock. The MscS protein alone is sufficient to form a functional mechanosensitive channel gated directly by tension in the lipid bilayer. The MscS proteins are heptamers of three transmembrane subunits with seven converging M3 domains, and this MscS_porin is towards the N-terminal of the molecules. The high concentration of negative charges at the extracellular entrance of the pore helps select the cations for efflux.


Pssm-ID: 338492 [Multi-domain]  Cd Length: 235  Bit Score: 48.81  E-value: 8.09e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1231 SELDKKLQhirNLLQNTSVSLVDIEKLDYETQSLRDQLQASHGRLSETEQNLD-----------DIYNSLSLSgvELESl 1299
Cdd:pfam12795   12 EAAQKALL---QDLQQALNLLDKIDESKARAEQLQKAIDDAPAELRELRQELAalqakaeaapkEILASLSLE--ELEQ- 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1300 qnhsRLVQQLSkELKENGIQLQESNIEgaLNLTRHAYERVSN-LSTLKDEANELASNTDRNCKRVENLS----NKIQAEA 1374
Cdd:pfam12795   86 ----RLLQTSS-QLQELQRQLAQLNSQ--LVELQTRPERAQQqLTEARQRLQEIRNRLNGTAAPGTPLSqaqrTALQAEL 158
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|..
gi 7297300    1375 D-----------DLANNNKLIEDYRAELTSLTSQIPELNNQV 1405
Cdd:pfam12795  159 AaleaqidmleqELLSNNNRQDLLRLQRDLLTLRIQRLEQQL 200
ApoLp-III_like cd13769
Apolipophorin-III and similar insect proteins; Exchangeable apolipoproteins play vital roles ...
1545-1702 1.15e-05

Apolipophorin-III and similar insect proteins; Exchangeable apolipoproteins play vital roles in the transport of lipids and lipoprotein metabolism. Apolipophorin III (apoLp-III) assists in the loading of diacylglycerol, generated from triacylglycerol stores in the fat body through the action of adipokinetic hormone, into lipophorin, the hemolymph lipoprotein. ApoLp-III increases the lipid carrying capacity of lipophorin by covering the expanding hydrophobic surface resulting from diacylglycerol uptake. It plays a critical role in the transport of lipids during insect flight, and may also play a role in defense mechanisms and innate immunity.


Pssm-ID: 259842 [Multi-domain]  Cd Length: 158  Bit Score: 46.93  E-value: 1.15e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1545 LGDQINRAVSSLKNVEAIIYRTKPDldrvNNLQSIANATKEKADKILDSANSVVESLA-AADESQGKAKDAIQQANSNIE 1623
Cdd:cd13769    3 LSELIQKAQEAINNLAQQVQKQLGL----QNPEEVVNTLKEQSDNFANNLQEVSSSLKeEAKKKQGEVEEAWNEFKTKLS 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1624 LAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKE----ITKEAGSVKLEAmrargeANNLQ-SA 1698
Cdd:cd13769   79 ETVPELRKSLPVEEKAQELQAKLQSGLQTLVTESQKLAKAISENSQKAQEelqkATKQAYDIAVEA------AQNLQnQL 152

                 ....
gi 7297300  1699 TSAT 1702
Cdd:cd13769  153 QTAT 156
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
1234-1771 1.30e-05

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 307627 [Multi-domain]  Cd Length: 1081  Bit Score: 50.17  E-value: 1.30e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1234 DKKLQHIRNLLQNTSVSLVDIEK----LDYETQSLRDQLQAS----------HGRLSETEQNLDDIYNSLSlSGVELES- 1298
Cdd:pfam01576   11 EEELQKVKEKQQKAESELKELEKkqqqLNEEKNALQEQLQAEtelcaeaeemRARLAARKQELEEILHDLE-SRLEEEEe 89
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1299 ----LQNHSRLVQQLSKELKEngiQLQESniEGA---LNLtrhayERVSNLSTLKDEANELASNTDRNckrvenlsNKIQ 1371
Cdd:pfam01576   90 raqqLQNEKKKMQQNIQDLEE---QLDEE--EAArqkLQL-----EKVTTEAKIKKLEEDILVLEDQN--------NKLS 151
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1372 AEAddlannnKLIEDYRAELTSltsqipelnnqvcgkpgdpcdslcggagcghcggflscehgakTHSEEALKVakdaeT 1451
Cdd:pfam01576  152 KER-------KLLEERISEFTS-------------------------------------------NLAEEEEKS-----K 176
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1452 AITSKKDQADQTIraltqaklnaSEAYEKAKRGfEQSERYLnqtnaniklaenlfialnnfQENKTASPSESKELAQKTL 1531
Cdd:pfam01576  177 SLNKLKNKHEAMI----------SDLEDRLKKE-EKGRQEL--------------------EKNKRKLEGESTELQEQIA 225
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1532 DLDLKLEP---------EEIETLGDQI-------NRAVSSLKNVEAIIYRTKPDLDRvnnlqsiANATKEKADKILDSAN 1595
Cdd:pfam01576  226 ELQAQIEElraqlakkeEELQAALARLeeeaaakNAAQKKLRELEAQISELQEDLES-------ERAARNKAEKQRRDLG 298
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1596 SVVESLAAADESQGKAKDAIQQANSNIELAGQDLEK-IDEETYSAEAPANNT----AQQVEKLAKKVQKLQNNimkndRD 1670
Cdd:pfam01576  299 EELEALKTELEDTLDSTAAQQELRSKREQEVTQLKKtLEEETRSHEAQLQEMrqkhNQALEELNEQLEQAKRN-----KV 373
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1671 AKEITKEAgsvkLEAmrargEANNLQsatsATNQTLTDRASRSENARERAKQLLQRASKLTVDTNAKLKDLNDlqtvyln 1750
Cdd:pfam01576  374 SLEKAKQA----LES-----ENNELQ----IELKTLQQAKQDSEHRRKKAESQLQELQAKLSESERQRAELAE------- 433
                          570       580
                   ....*....|....*....|.
gi 7297300    1751 knqQLLRLQAEIGPLNKELNE 1771
Cdd:pfam01576  434 ---KLSKLQAELESVSSLLSE 451
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
1439-1773 1.58e-05

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 314924 [Multi-domain]  Cd Length: 1201  Bit Score: 49.70  E-value: 1.58e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1439 SEEALKVAKD-AETAITSKKDQADQTIRALTQAKL---NASEAYEKAKRGFEQSERYLNQtnaniklaenLFIALNNFQE 1514
Cdd:pfam12128  602 SEEELRARLQvAEEALQSARAKQKQAEEQLVQANAeleEAQRAETEARTALKNARLTLGR----------LQNEQQSLKD 671
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1515 NKTASPSESKELAQKTLDldlKLEpEEIETLGDQINRAVSSLKNVeaiiYRTKpDLDRVNNLQSIANATKEKADKIldsa 1594
Cdd:pfam12128  672 KLELAIAERKQQAETQLR---QLD-AQLKQLLEQQKAMLEALKDD----FREL-RTERKAKWQVVEGELDNQLALL---- 738
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1595 nsvvESLAAADESQGKAK-DAIQQANSNiELAGQDlekIDEETysaeapanntaqqVEKLAKKVQKLQNNIMKNDRDAKE 1673
Cdd:pfam12128  739 ----KAAIEAARTQAKARlKALKEAYDR-ELASLG---VDPET-------------VKELKRKIEELERTIERIRVRRPE 797
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300    1674 ITK----------EAGSVKLEAMRARGEANNLQSATSATNQTLTDRASRSENARERAKQLLQRASKLTVDTNAKLKDLND 1743
Cdd:pfam12128  798 VREyrawlqetwlLRDSLREERPALATQVEELESAAEDLQQDLTRLIADTKLERAQLEQERKALEKQLVQLDENLRGLRD 877
                          330       340       350
                   ....*....|....*....|....*....|
gi 7297300    1744 LQTvYLNKnqqlLRLQAEIGPLNKELNEHL 1773
Cdd:pfam12128  878 EMR-QLAE----LKEPADANQAEGSISERL 902
CwlO1 COG3883
Uncharacterized N-terminal domain of peptidoglycan hydrolase CwlO [Function unknown];
1449-1658 1.92e-05

Uncharacterized N-terminal domain of peptidoglycan hydrolase CwlO [Function unknown];


Pssm-ID: 226400 [Multi-domain]  Cd Length: 265  Bit Score: 48.18  E-value: 1.92e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7297300  1449 AETAiTSKKDQADQTIRALTQAKLNA-----------SEA