NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|71998231|ref|NP_496721|]
View 

Carnitine Palmitoyl Transferase [Caenorhabditis elegans]

Protein Classification

carnitine O-palmitoyltransferase 1 (domain architecture ID 11243103)

carnitine O-palmitoyltransferase 1 catalyzes the conversion from Palmitoyl-CoA and L-carnitine to CoA and L-palmitoylcarnitine

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Carn_acyltransf pfam00755
Choline/Carnitine o-acyltransferase;
172-762 0e+00

Choline/Carnitine o-acyltransferase;


:

Pssm-ID: 307070  Cd Length: 571  Bit Score: 690.43  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   172 LPRLPLPNLDDTVRKHLLSMKPILSDEEFQELEFLSERFRKGVGRRLQRYLTLKSWFSSNYVTDWWEEFVYMRQRSPIMI 251
Cdd:pfam00755   1 LPRLPVPPLEDTLDRYLESVKPLLDEEEYERTEKLVEEFLKGGGPKLQERLLERAKASKNWLSDWWLDYAYLEYRDPLVL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   252 NSNYYGFDTLNEHP-TQNQASRAANLTYTSLQFRRMVDRQEVSPFsispRTKVPFCTMQYERLFNTCRVPGEEVDRLL-- 328
Cdd:pfam00755  81 NSNYFFVLPGDPDPpTRNQQERAANLIHSALEFKRLLRRETLPPE----VLGGPLCMSQYKRLFNTTRIPGKERDTLTlq 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   329 HWDDAKHIAVYCRGVWFKLIVH--NGKRLLEACELQVQYDAILAHTHEPSEGEMHLASLTAGERADWAKTRRAHFRSGVN 406
Cdd:pfam00755 157 DGPDSRHIVVLRKGQFYKVDVLsdDGGRLLSPAELEAQLQRILDSDSDKTPPGPPVGALTTENRDTWAKAREELLKDPTN 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   407 KTSLNDIERAAFVVILDDEEthydpQDPSKLDHWAHNLLHGKaHDRWFDKSFNLIISKNGHVGINTEHSWGDAAVMAHFT 486
Cdd:pfam00755 237 AESLEAIESALFVVCLDDAS-----PEPTDEEELARQLLHGG-TNRWFDKSLQLIVTKNGRAGFNGEHSPADGTPVLRLN 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   487 EWSLLQDIVFIGYDENGRCKGEPKEKltPERLKWEIPAPALDQIRKSMEVANALIADVEMSLLVWTDYGKGFAKKLKVSP 566
Cdd:pfam00755 311 DYVLTDIIEKPAVDPNESAPSSPAPS--PEKLEFNLDDELKEAIEEAKTRFDKLISDLDLHVLEFTDYGKNFIKKFKLSP 388
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   567 DAFLQMTLQYTYFKNQNKFSLTYEASMTRLFREGRTETVRSCTVQSSDFVRSMLDASKTPQDR-LQLLRKACDKHQELYR 645
Cdd:pfam00755 389 DAFIQMALQLAYYRLYGKFAATYESASTRKFRHGRTETIRSVTPESVAFVKAMTDPSASDEEKvLELLRAAVKAHVKLTK 468
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   646 DAMCGQGVDRHLFALYVIKRYLEEESP--FFDNIFPP--TYLLSTSQTPMNqceadakglsnevrlrlITAGGGFGPVAD 721
Cdd:pfam00755 469 EAATGQGVDRHLFGLKLLAKELGLPLPelFTDPAYAKsnHWVLSTSQLPSP-----------------AFRGGGFGPVVP 531
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|.
gi 71998231   722 RGYGVSYIVaGEDTLSFHISSKRSADNTSSREFREELKRSL 762
Cdd:pfam00755 532 DGYGIGYNI-GDDSISFCISSKKSCPETDAERFAKALEEAL 571
CPT_N pfam16484
Carnitine O-palmitoyltransferase N-terminus; This domain is found at the N-terminus of ...
1-46 4.86e-18

Carnitine O-palmitoyltransferase N-terminus; This domain is found at the N-terminus of carnitine O-palmitoyltransferases. It functions as a regulatory domain and is linked to the catalytic domain (pfam00755) via two transmembrane regions.


:

Pssm-ID: 318644  Cd Length: 46  Bit Score: 80.35  E-value: 4.86e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 71998231     1 MAEARSAAALSFAVTHDGVSVSYDQELLRDIWHGISRSYKRRTGRF 46
Cdd:pfam16484   1 MAEAHQAVAFQFTVTPDGIDVQLSHEALKEIYLSGVRSWKKRLIRF 46
 
Name Accession Description Interval E-value
Carn_acyltransf pfam00755
Choline/Carnitine o-acyltransferase;
172-762 0e+00

Choline/Carnitine o-acyltransferase;


Pssm-ID: 307070  Cd Length: 571  Bit Score: 690.43  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   172 LPRLPLPNLDDTVRKHLLSMKPILSDEEFQELEFLSERFRKGVGRRLQRYLTLKSWFSSNYVTDWWEEFVYMRQRSPIMI 251
Cdd:pfam00755   1 LPRLPVPPLEDTLDRYLESVKPLLDEEEYERTEKLVEEFLKGGGPKLQERLLERAKASKNWLSDWWLDYAYLEYRDPLVL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   252 NSNYYGFDTLNEHP-TQNQASRAANLTYTSLQFRRMVDRQEVSPFsispRTKVPFCTMQYERLFNTCRVPGEEVDRLL-- 328
Cdd:pfam00755  81 NSNYFFVLPGDPDPpTRNQQERAANLIHSALEFKRLLRRETLPPE----VLGGPLCMSQYKRLFNTTRIPGKERDTLTlq 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   329 HWDDAKHIAVYCRGVWFKLIVH--NGKRLLEACELQVQYDAILAHTHEPSEGEMHLASLTAGERADWAKTRRAHFRSGVN 406
Cdd:pfam00755 157 DGPDSRHIVVLRKGQFYKVDVLsdDGGRLLSPAELEAQLQRILDSDSDKTPPGPPVGALTTENRDTWAKAREELLKDPTN 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   407 KTSLNDIERAAFVVILDDEEthydpQDPSKLDHWAHNLLHGKaHDRWFDKSFNLIISKNGHVGINTEHSWGDAAVMAHFT 486
Cdd:pfam00755 237 AESLEAIESALFVVCLDDAS-----PEPTDEEELARQLLHGG-TNRWFDKSLQLIVTKNGRAGFNGEHSPADGTPVLRLN 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   487 EWSLLQDIVFIGYDENGRCKGEPKEKltPERLKWEIPAPALDQIRKSMEVANALIADVEMSLLVWTDYGKGFAKKLKVSP 566
Cdd:pfam00755 311 DYVLTDIIEKPAVDPNESAPSSPAPS--PEKLEFNLDDELKEAIEEAKTRFDKLISDLDLHVLEFTDYGKNFIKKFKLSP 388
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   567 DAFLQMTLQYTYFKNQNKFSLTYEASMTRLFREGRTETVRSCTVQSSDFVRSMLDASKTPQDR-LQLLRKACDKHQELYR 645
Cdd:pfam00755 389 DAFIQMALQLAYYRLYGKFAATYESASTRKFRHGRTETIRSVTPESVAFVKAMTDPSASDEEKvLELLRAAVKAHVKLTK 468
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   646 DAMCGQGVDRHLFALYVIKRYLEEESP--FFDNIFPP--TYLLSTSQTPMNqceadakglsnevrlrlITAGGGFGPVAD 721
Cdd:pfam00755 469 EAATGQGVDRHLFGLKLLAKELGLPLPelFTDPAYAKsnHWVLSTSQLPSP-----------------AFRGGGFGPVVP 531
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|.
gi 71998231   722 RGYGVSYIVaGEDTLSFHISSKRSADNTSSREFREELKRSL 762
Cdd:pfam00755 532 DGYGIGYNI-GDDSISFCISSKKSCPETDAERFAKALEEAL 571
CPT_N pfam16484
Carnitine O-palmitoyltransferase N-terminus; This domain is found at the N-terminus of ...
1-46 4.86e-18

Carnitine O-palmitoyltransferase N-terminus; This domain is found at the N-terminus of carnitine O-palmitoyltransferases. It functions as a regulatory domain and is linked to the catalytic domain (pfam00755) via two transmembrane regions.


Pssm-ID: 318644  Cd Length: 46  Bit Score: 80.35  E-value: 4.86e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 71998231     1 MAEARSAAALSFAVTHDGVSVSYDQELLRDIWHGISRSYKRRTGRF 46
Cdd:pfam16484   1 MAEAHQAVAFQFTVTPDGIDVQLSHEALKEIYLSGVRSWKKRLIRF 46
COG4047 COG4047
N-glycosylase/DNA lyase [Replication, recombination and repair];
197-258 2.36e-03

N-glycosylase/DNA lyase [Replication, recombination and repair];


Pssm-ID: 226533  Cd Length: 243  Bit Score: 40.19  E-value: 2.36e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 71998231 197 DEEFQELEFLSERFRKGVGRRLQRYLTLKSWFSSNYVTDWWEEFV-YMRQRSPIMINSNYYGF 258
Cdd:COG4047  23 DPQYKAVSYLSKGIGSTKFVRLAIANALVSYQLTGKGEEWWWEFAkYFRGREVRDIYRAYKEF 85
 
Name Accession Description Interval E-value
Carn_acyltransf pfam00755
Choline/Carnitine o-acyltransferase;
172-762 0e+00

Choline/Carnitine o-acyltransferase;


Pssm-ID: 307070  Cd Length: 571  Bit Score: 690.43  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   172 LPRLPLPNLDDTVRKHLLSMKPILSDEEFQELEFLSERFRKGVGRRLQRYLTLKSWFSSNYVTDWWEEFVYMRQRSPIMI 251
Cdd:pfam00755   1 LPRLPVPPLEDTLDRYLESVKPLLDEEEYERTEKLVEEFLKGGGPKLQERLLERAKASKNWLSDWWLDYAYLEYRDPLVL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   252 NSNYYGFDTLNEHP-TQNQASRAANLTYTSLQFRRMVDRQEVSPFsispRTKVPFCTMQYERLFNTCRVPGEEVDRLL-- 328
Cdd:pfam00755  81 NSNYFFVLPGDPDPpTRNQQERAANLIHSALEFKRLLRRETLPPE----VLGGPLCMSQYKRLFNTTRIPGKERDTLTlq 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   329 HWDDAKHIAVYCRGVWFKLIVH--NGKRLLEACELQVQYDAILAHTHEPSEGEMHLASLTAGERADWAKTRRAHFRSGVN 406
Cdd:pfam00755 157 DGPDSRHIVVLRKGQFYKVDVLsdDGGRLLSPAELEAQLQRILDSDSDKTPPGPPVGALTTENRDTWAKAREELLKDPTN 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   407 KTSLNDIERAAFVVILDDEEthydpQDPSKLDHWAHNLLHGKaHDRWFDKSFNLIISKNGHVGINTEHSWGDAAVMAHFT 486
Cdd:pfam00755 237 AESLEAIESALFVVCLDDAS-----PEPTDEEELARQLLHGG-TNRWFDKSLQLIVTKNGRAGFNGEHSPADGTPVLRLN 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   487 EWSLLQDIVFIGYDENGRCKGEPKEKltPERLKWEIPAPALDQIRKSMEVANALIADVEMSLLVWTDYGKGFAKKLKVSP 566
Cdd:pfam00755 311 DYVLTDIIEKPAVDPNESAPSSPAPS--PEKLEFNLDDELKEAIEEAKTRFDKLISDLDLHVLEFTDYGKNFIKKFKLSP 388
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   567 DAFLQMTLQYTYFKNQNKFSLTYEASMTRLFREGRTETVRSCTVQSSDFVRSMLDASKTPQDR-LQLLRKACDKHQELYR 645
Cdd:pfam00755 389 DAFIQMALQLAYYRLYGKFAATYESASTRKFRHGRTETIRSVTPESVAFVKAMTDPSASDEEKvLELLRAAVKAHVKLTK 468
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71998231   646 DAMCGQGVDRHLFALYVIKRYLEEESP--FFDNIFPP--TYLLSTSQTPMNqceadakglsnevrlrlITAGGGFGPVAD 721
Cdd:pfam00755 469 EAATGQGVDRHLFGLKLLAKELGLPLPelFTDPAYAKsnHWVLSTSQLPSP-----------------AFRGGGFGPVVP 531
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|.
gi 71998231   722 RGYGVSYIVaGEDTLSFHISSKRSADNTSSREFREELKRSL 762
Cdd:pfam00755 532 DGYGIGYNI-GDDSISFCISSKKSCPETDAERFAKALEEAL 571
CPT_N pfam16484
Carnitine O-palmitoyltransferase N-terminus; This domain is found at the N-terminus of ...
1-46 4.86e-18

Carnitine O-palmitoyltransferase N-terminus; This domain is found at the N-terminus of carnitine O-palmitoyltransferases. It functions as a regulatory domain and is linked to the catalytic domain (pfam00755) via two transmembrane regions.


Pssm-ID: 318644  Cd Length: 46  Bit Score: 80.35  E-value: 4.86e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 71998231     1 MAEARSAAALSFAVTHDGVSVSYDQELLRDIWHGISRSYKRRTGRF 46
Cdd:pfam16484   1 MAEAHQAVAFQFTVTPDGIDVQLSHEALKEIYLSGVRSWKKRLIRF 46
COG4047 COG4047
N-glycosylase/DNA lyase [Replication, recombination and repair];
197-258 2.36e-03

N-glycosylase/DNA lyase [Replication, recombination and repair];


Pssm-ID: 226533  Cd Length: 243  Bit Score: 40.19  E-value: 2.36e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 71998231 197 DEEFQELEFLSERFRKGVGRRLQRYLTLKSWFSSNYVTDWWEEFV-YMRQRSPIMINSNYYGF 258
Cdd:COG4047  23 DPQYKAVSYLSKGIGSTKFVRLAIANALVSYQLTGKGEEWWWEFAkYFRGREVRDIYRAYKEF 85
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH