NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|71984544|ref|NP_001021255|]
View 

Ribosomal Protein, Large subunit [Caenorhabditis elegans]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ribosomal_L3 super family cl00324
Ribosomal protein L3;
1-349 0e+00

Ribosomal protein L3;


The actual alignment was detected with superfamily member PTZ00103:

Pssm-ID: 320904  Cd Length: 390  Bit Score: 568.18  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544    1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDVDKPGSKVNKKEVVEAVTIVE 80
Cdd:PTZ00103   1 MSHRKFEHPRHGSLGFLPRKRCRRHRGRIRSFPKDDPTQPPHLTAFMGYKAGMTHIVRDVDRPGSKLHKKEVVEAVTIIE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   81 TPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYSNWAKSKKKAFTKYAKKWQDEdgkKLIEADFAKLKKYCSSI 160
Cdd:PTZ00103  81 APPMVVVGIVGYRETPRGLRALTTVWAHHLSDEFRRRFYKNWYKSKKKAFTKYKKFAATK---KAEERTLKRIKKYCSVI 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  161 RVIAHTQ------------------------------------------------MIDTIGVTRGHGFKGVTSRWHTKKL 192
Cdd:PTZ00103 158 RVIAHTQpsklplgqkkahvmeiqvnggsvaekvdfaksllekevpvdsvfqqneMIDVIGVTKGHGFEGVVKRWGVTRL 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  193 PRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGKSalteEGKNNGSTEFDLTQKTITPMGGFPRY 272
Cdd:PTZ00103 238 PRKTHRGLRKVACIGAWHPARVQYTVPRAGQHGYHHRTELNKKIYRIGVA----EDPNNATTEADLTEKTITPMGGFPHY 313
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 71984544  273 GIVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTGHGRFQTTAEKRAFMGKLKRDFLAEA 349
Cdd:PTZ00103 314 GTVRNDFLMLKGCVVGPKKRVITLRKSLVPQTSRKALEKITLKFIDTSSKIGHGRFQTKEEKAKFYGPLKKDRIRRE 390
 
Name Accession Description Interval E-value
PTZ00103 PTZ00103
60S ribosomal protein L3; Provisional
1-349 0e+00

60S ribosomal protein L3; Provisional


Pssm-ID: 240267  Cd Length: 390  Bit Score: 568.18  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544    1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDVDKPGSKVNKKEVVEAVTIVE 80
Cdd:PTZ00103   1 MSHRKFEHPRHGSLGFLPRKRCRRHRGRIRSFPKDDPTQPPHLTAFMGYKAGMTHIVRDVDRPGSKLHKKEVVEAVTIIE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   81 TPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYSNWAKSKKKAFTKYAKKWQDEdgkKLIEADFAKLKKYCSSI 160
Cdd:PTZ00103  81 APPMVVVGIVGYRETPRGLRALTTVWAHHLSDEFRRRFYKNWYKSKKKAFTKYKKFAATK---KAEERTLKRIKKYCSVI 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  161 RVIAHTQ------------------------------------------------MIDTIGVTRGHGFKGVTSRWHTKKL 192
Cdd:PTZ00103 158 RVIAHTQpsklplgqkkahvmeiqvnggsvaekvdfaksllekevpvdsvfqqneMIDVIGVTKGHGFEGVVKRWGVTRL 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  193 PRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGKSalteEGKNNGSTEFDLTQKTITPMGGFPRY 272
Cdd:PTZ00103 238 PRKTHRGLRKVACIGAWHPARVQYTVPRAGQHGYHHRTELNKKIYRIGVA----EDPNNATTEADLTEKTITPMGGFPHY 313
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 71984544  273 GIVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTGHGRFQTTAEKRAFMGKLKRDFLAEA 349
Cdd:PTZ00103 314 GTVRNDFLMLKGCVVGPKKRVITLRKSLVPQTSRKALEKITLKFIDTSSKIGHGRFQTKEEKAKFYGPLKKDRIRRE 390
Ribosomal_L3 pfam00297
Ribosomal protein L3;
1-324 7.71e-169

Ribosomal protein L3;


Pssm-ID: 306746  Cd Length: 369  Bit Score: 479.42  E-value: 7.71e-169
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544     1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDVDKPGSKVNKKEVVEAVTIVE 80
Cdd:pfam00297   1 MSHRKFEAPRHGSLGFLPRKRAGRHRGKVKSFPKDDTSKPVHLTGFLGYKAGMTHIVRDLDKPGSKEHKKETVEAVTVVE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544    81 TPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYSNWAKSKKKAFTKYAKKWQDEDGKKLIEADFAKLKKYCSSI 160
Cdd:pfam00297  81 TPPMVIVGVVGYVETPRGLRPLTTVWAQHLSEEVKRRFYKNWYKSKKKAFTKYSKKYEGADGKKLIEADLEYIKKYCSVI 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   161 RVIAHTQ-------------------------------------------------MIDTIGVTRGHGFKGVTSRWHTKK 191
Cdd:pfam00297 161 RVITHTQigktpglfqkkahlmeiqvnggtiaekvnfareafektvavaavfrqgeMIDVIGVTKGKGFQGVTKRWGVKK 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   192 LPRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGksalTEEGKNNGSTEFDLTQKTITPMGGFPR 271
Cdd:pfam00297 241 LPRKTHRGLRKVACIGAWHPARVWPTVARAGQMGYHHRTELNKKIYRIG----TGDDGKNASTEFDLTEKTITPMGGFVH 316
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|...
gi 71984544   272 YGIVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTG 324
Cdd:pfam00297 317 YGEVKHDFIMVKGSVPGPKKRLVTLRKSLLPQTSRRALEEVPLKFIDTASKFG 369
L3_arch TIGR03626
ribosomal protein uL3, archaeal form; This model describes exclusively the archaeal class of ...
7-322 8.02e-76

ribosomal protein uL3, archaeal form; This model describes exclusively the archaeal class of ribosomal protein L3. A separate model (TIGR03625) describes the bacterial/organelle form, and both belong to pfam00297. Eukaryotic proteins are excluded from this model. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 274685  Cd Length: 330  Bit Score: 240.31  E-value: 8.02e-76
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544     7 SAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKskPIHLTAFLGYKAGMTHIVRDVDKPGSKVNKKEVVEAVTIVETPPMVI 86
Cdd:TIGR03626   1 HRPRRGSLAFSPRKRAKRIVPRIRSWPEVDG--EPKLQGFAGYKAGMTHVIMVDDRKNSPTEGKEISVPVTVLEAPPLRV 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544    87 AGVTGYVDTPQGPRALTTIWAEHLSEEARRRFysnwakskkKAFTKYAKKWQDEDGKKLIEADFaklkkycSSIRVIAHT 166
Cdd:TIGR03626  79 AAIRAYGKDPYGLKVLTEVWANNLDKELSRKI---------TLPKNYDVEEKLEKIEELLENDA-------DDVRLIVHT 142
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   167 Q-------------------------------------------------MIDTIGVTRGHGFKGVTSRWHTKKLPRKT- 196
Cdd:TIGR03626 143 QpklvtgvpkkkpeimeirigggsveerfeyalsilgkeisvsdvfkegqLVDVIAVTKGKGFQGVVKRWGVKLLPRKHk 222
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   197 -HKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGksaltEEGknngstefdltqKTITPMGGFPRYGIV 275
Cdd:TIGR03626 223 rRKGGRHIGTLGPWTPSRVRWTVPQAGQMGYHQRTEYNKRILKIG-----EDG------------DEITPKGGFVNYGLV 285
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*..
gi 71984544   276 NQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKINlkWIDTSSK 322
Cdd:TIGR03626 286 RNDYVLIKGSVPGPSKRLIRLRDAIRPPKPPEGAPEIT--YISLESK 330
RplC COG0087
Ribosomal protein L3 [Translation, ribosomal structure and biogenesis];
43-308 7.94e-41

Ribosomal protein L3 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223165  Cd Length: 218  Bit Score: 145.03  E-value: 7.94e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  43 LTAFLGYKAGMTHIVRDvdkpgskvnkKEVVEAVTIVETPPMVIAGVTGYVDtpQGPRAlTTIWAEHlseearRRFYS-- 120
Cdd:COG0087   1 MLGFLGYKVGMTHVFDE----------RGISVPVTVIEVPPNVVVQVKTYET--DGYRA-VQVGAGD------RKAKRvn 61
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544 121 -------NWAKSKKKAFTKyakKWQDEDGKKLIEADFAKLKKycssIRVIAHTQMIDTIGVTRGHGFKGVTSRWHTKKLP 193
Cdd:COG0087  62 kplvghfAKAGVKPKRHLA---EFRVGGGDVAEKFEVGQEIT----VDVFKEGELVDVTGVTKGKGFQGVMKRWGFKGGP 134
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544 194 RKTHKGL--RKVACIG-AWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGksalteegknngstefdltqktitpmggfp 270
Cdd:COG0087 135 ASHGSSLshRRPGSIGqRQTPGRVFKGKKMAGHMGNERVTVQNLEVVKVD------------------------------ 184
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 71984544 271 rygiVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVA 308
Cdd:COG0087 185 ----VENNLILVKGAVPGAKKRLVVVRPAVKAKKKTSA 218
 
Name Accession Description Interval E-value
PTZ00103 PTZ00103
60S ribosomal protein L3; Provisional
1-349 0e+00

60S ribosomal protein L3; Provisional


Pssm-ID: 240267  Cd Length: 390  Bit Score: 568.18  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544    1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDVDKPGSKVNKKEVVEAVTIVE 80
Cdd:PTZ00103   1 MSHRKFEHPRHGSLGFLPRKRCRRHRGRIRSFPKDDPTQPPHLTAFMGYKAGMTHIVRDVDRPGSKLHKKEVVEAVTIIE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   81 TPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYSNWAKSKKKAFTKYAKKWQDEdgkKLIEADFAKLKKYCSSI 160
Cdd:PTZ00103  81 APPMVVVGIVGYRETPRGLRALTTVWAHHLSDEFRRRFYKNWYKSKKKAFTKYKKFAATK---KAEERTLKRIKKYCSVI 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  161 RVIAHTQ------------------------------------------------MIDTIGVTRGHGFKGVTSRWHTKKL 192
Cdd:PTZ00103 158 RVIAHTQpsklplgqkkahvmeiqvnggsvaekvdfaksllekevpvdsvfqqneMIDVIGVTKGHGFEGVVKRWGVTRL 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  193 PRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGKSalteEGKNNGSTEFDLTQKTITPMGGFPRY 272
Cdd:PTZ00103 238 PRKTHRGLRKVACIGAWHPARVQYTVPRAGQHGYHHRTELNKKIYRIGVA----EDPNNATTEADLTEKTITPMGGFPHY 313
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 71984544  273 GIVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTGHGRFQTTAEKRAFMGKLKRDFLAEA 349
Cdd:PTZ00103 314 GTVRNDFLMLKGCVVGPKKRVITLRKSLVPQTSRKALEKITLKFIDTSSKIGHGRFQTKEEKAKFYGPLKKDRIRRE 390
Ribosomal_L3 pfam00297
Ribosomal protein L3;
1-324 7.71e-169

Ribosomal protein L3;


Pssm-ID: 306746  Cd Length: 369  Bit Score: 479.42  E-value: 7.71e-169
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544     1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDVDKPGSKVNKKEVVEAVTIVE 80
Cdd:pfam00297   1 MSHRKFEAPRHGSLGFLPRKRAGRHRGKVKSFPKDDTSKPVHLTGFLGYKAGMTHIVRDLDKPGSKEHKKETVEAVTVVE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544    81 TPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYSNWAKSKKKAFTKYAKKWQDEDGKKLIEADFAKLKKYCSSI 160
Cdd:pfam00297  81 TPPMVIVGVVGYVETPRGLRPLTTVWAQHLSEEVKRRFYKNWYKSKKKAFTKYSKKYEGADGKKLIEADLEYIKKYCSVI 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   161 RVIAHTQ-------------------------------------------------MIDTIGVTRGHGFKGVTSRWHTKK 191
Cdd:pfam00297 161 RVITHTQigktpglfqkkahlmeiqvnggtiaekvnfareafektvavaavfrqgeMIDVIGVTKGKGFQGVTKRWGVKK 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   192 LPRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGksalTEEGKNNGSTEFDLTQKTITPMGGFPR 271
Cdd:pfam00297 241 LPRKTHRGLRKVACIGAWHPARVWPTVARAGQMGYHHRTELNKKIYRIG----TGDDGKNASTEFDLTEKTITPMGGFVH 316
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|...
gi 71984544   272 YGIVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTG 324
Cdd:pfam00297 317 YGEVKHDFIMVKGSVPGPKKRLVTLRKSLLPQTSRRALEEVPLKFIDTASKFG 369
rpl3p PRK04231
50S ribosomal protein L3P; Reviewed
3-324 5.17e-81

50S ribosomal protein L3P; Reviewed


Pssm-ID: 235260  Cd Length: 337  Bit Score: 253.62  E-value: 5.17e-81
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544    3 HRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDkSKPIhLTAFLGYKAGMTHIVRDVDKPGSKVNKKEVVEAVTIVETP 82
Cdd:PRK04231   1 MRKIHRPRRGSLAFSPRKRAKSIVPRIRSWPEID-GEPK-LLGFAGYKAGMTHVIMIDDRPNSPTEGKEIFVPVTVLETP 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   83 PMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYSNWAKSKKKAFTKYAKKWQDED------------------GKK 144
Cdd:PRK04231  79 PMRVAAIRAYEKDPYGLKVLTEVWAEDLDKELERRITLPKKDEKKKAFEKLLKLLEEGKivdvrvivhtqpklvtgvPKK 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  145 ---LIEA-----------DFAK--LKKYCSSIRVIAHTQMIDTIGVTRGHGFKGVTSRWHTKKLPRKTH--KGLRKVACI 206
Cdd:PRK04231 159 kpeIMEIrigggsveerlEYAKelLGKEISISDVFKEGQLVDVIAVTKGKGFQGVVKRWGVKLLPRKHKrrGGSRHIGTL 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  207 GAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGksalteegkNNGStefdltqkTITPMGGFPRYGIVNQDYIMLRGAV 286
Cdd:PRK04231 239 GPWNPSRVMWTVPQAGQMGFHQRTEYNKRILKIG---------DDGD--------EITPKGGFLHYGLVRNDYVLIKGSV 301
                        330       340       350
                 ....*....|....*....|....*....|....*...
gi 71984544  287 LGPKKRLITLRKSlITQTKRVAhEKINLKWIDTSSKTG 324
Cdd:PRK04231 302 PGPAKRLIRLRPA-IRPPEPPV-EAPEITYVSTESKQG 337
L3_arch TIGR03626
ribosomal protein uL3, archaeal form; This model describes exclusively the archaeal class of ...
7-322 8.02e-76

ribosomal protein uL3, archaeal form; This model describes exclusively the archaeal class of ribosomal protein L3. A separate model (TIGR03625) describes the bacterial/organelle form, and both belong to pfam00297. Eukaryotic proteins are excluded from this model. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 274685  Cd Length: 330  Bit Score: 240.31  E-value: 8.02e-76
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544     7 SAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKskPIHLTAFLGYKAGMTHIVRDVDKPGSKVNKKEVVEAVTIVETPPMVI 86
Cdd:TIGR03626   1 HRPRRGSLAFSPRKRAKRIVPRIRSWPEVDG--EPKLQGFAGYKAGMTHVIMVDDRKNSPTEGKEISVPVTVLEAPPLRV 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544    87 AGVTGYVDTPQGPRALTTIWAEHLSEEARRRFysnwakskkKAFTKYAKKWQDEDGKKLIEADFaklkkycSSIRVIAHT 166
Cdd:TIGR03626  79 AAIRAYGKDPYGLKVLTEVWANNLDKELSRKI---------TLPKNYDVEEKLEKIEELLENDA-------DDVRLIVHT 142
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   167 Q-------------------------------------------------MIDTIGVTRGHGFKGVTSRWHTKKLPRKT- 196
Cdd:TIGR03626 143 QpklvtgvpkkkpeimeirigggsveerfeyalsilgkeisvsdvfkegqLVDVIAVTKGKGFQGVVKRWGVKLLPRKHk 222
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544   197 -HKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGksaltEEGknngstefdltqKTITPMGGFPRYGIV 275
Cdd:TIGR03626 223 rRKGGRHIGTLGPWTPSRVRWTVPQAGQMGYHQRTEYNKRILKIG-----EDG------------DEITPKGGFVNYGLV 285
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*..
gi 71984544   276 NQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKINlkWIDTSSK 322
Cdd:TIGR03626 286 RNDYVLIKGSVPGPSKRLIRLRDAIRPPKPPEGAPEIT--YISLESK 330
RplC COG0087
Ribosomal protein L3 [Translation, ribosomal structure and biogenesis];
43-308 7.94e-41

Ribosomal protein L3 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223165  Cd Length: 218  Bit Score: 145.03  E-value: 7.94e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  43 LTAFLGYKAGMTHIVRDvdkpgskvnkKEVVEAVTIVETPPMVIAGVTGYVDtpQGPRAlTTIWAEHlseearRRFYS-- 120
Cdd:COG0087   1 MLGFLGYKVGMTHVFDE----------RGISVPVTVIEVPPNVVVQVKTYET--DGYRA-VQVGAGD------RKAKRvn 61
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544 121 -------NWAKSKKKAFTKyakKWQDEDGKKLIEADFAKLKKycssIRVIAHTQMIDTIGVTRGHGFKGVTSRWHTKKLP 193
Cdd:COG0087  62 kplvghfAKAGVKPKRHLA---EFRVGGGDVAEKFEVGQEIT----VDVFKEGELVDVTGVTKGKGFQGVMKRWGFKGGP 134
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544 194 RKTHKGL--RKVACIG-AWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGksalteegknngstefdltqktitpmggfp 270
Cdd:COG0087 135 ASHGSSLshRRPGSIGqRQTPGRVFKGKKMAGHMGNERVTVQNLEVVKVD------------------------------ 184
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 71984544 271 rygiVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVA 308
Cdd:COG0087 185 ----VENNLILVKGAVPGAKKRLVVVRPAVKAKKKTSA 218
rplC PRK00001
50S ribosomal protein L3; Validated
167-299 1.32e-03

50S ribosomal protein L3; Validated


Pssm-ID: 234564  Cd Length: 210  Bit Score: 39.33  E-value: 1.32e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71984544  167 QMIDTIGVTRGHGFKGVTSRWHTKKLPrKTH---KGLRKVACIGA--WhPSRVAFTVARAGQKGFHHRTIINNKIYRIgk 241
Cdd:PRK00001 104 QKVDVTGTSKGKGFAGVIKRHNFSGGP-ASHgnsRSHRRPGSIGArqT-PGRVFKGKKMAGHMGNERVTVQNLEVVKV-- 179
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 71984544  242 salteegknngstefdltqktitpmggfprygIVNQDYIMLRGAVLGPKKRLITLRKS 299
Cdd:PRK00001 180 --------------------------------DAERNLLLVKGAVPGAKGGLVIIKPA 205
rpl3 CHL00143
ribosomal protein L3; Validated
167-239 1.47e-03

ribosomal protein L3; Validated


Pssm-ID: 177065  Cd Length: 207  Bit Score: 39.22  E-value: 1.47e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 71984544  167 QMIDTIGVTRGHGFKGVTSRWHTKKLPrKTH--KGLRKVACIGA-WHPSRVAFTVARAGQKGFHHRTIINNKIYRI 239
Cdd:CHL00143 106 QLVNVSGKSIGKGFAGLQKRHNFSRGP-MTHgsKNHRAPGSIGAgTTPGRVYPGKKMAGRLGNKKVTIKNLKILKV 180
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH