NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|71834636|ref|NP_001025421|]
View 

prostaglandin E2 receptor subtype EP2-like [Danio rerio]

Protein Classification

7tmA_PGE2_EP2 domain-containing protein (domain architecture ID 11606863)

7tmA_PGE2_EP2 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_PGE2_EP2 cd15139
prostaglandin E2 receptor EP2 subtype, member of the class A family of seven-transmembrane G ...
16-310 4.06e-179

prostaglandin E2 receptor EP2 subtype, member of the class A family of seven-transmembrane G protein-coupled receptors; Prostaglandin E2 receptor EP2, also called prostanoid EP2 receptor, is one of four receptor subtypes whose endogenous physiological ligand is prostaglandin E2 (PGE2). Each of these subtypes (EP1-EP4) have unique but overlapping tissue distributions that activate different intracellular signaling pathways. Stimulation of the EP2 receptor by PGE2 causes cAMP accumulation through G(s) protein activation, which subsequently produces smooth muscle relaxation and mediates the systemic vasodepressor response to PGE2. Prostanoids are the cyclooxygenase (COX) metabolites of arachidonic acid, which include the prostaglandins (PGD2, PGE2, PGF2alpha), prostacyclin (PGI2), and thromboxane A2 (TxA2). These five major bioactive prostanoids acts as mediators or modulators in a wide range of physiological and pathophysiological processes within the kidney and play important roles in inflammation, platelet aggregation, and vasoconstriction/relaxation, among many others. They act locally by preferentially interacting with G protein-coupled receptors designated DP, EP. FP, IP, and TP, respectively. The phylogenetic tree suggests that the prostanoid receptors can be grouped into two major branches: G(s)-coupled (DP1, EP2, EP4, and IP) and G(i)- (EP3) or G(q)-coupled (EP1, FP, and TP), forming three clusters.


:

Pssm-ID: 320267  Cd Length: 299  Bit Score: 502.38  E-value: 4.06e-179
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  16 GGSPTIPAFMFSTGVLGNVVALILLEMRRRKQPA---SLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRL 92
Cdd:cd15139   1 GGSPAISALMFSAGVLGNVLALVLLERRRRKEVGrrqSLFHVLVTSLVITDLLGTCLISPVVLASYSRNTTLVGMSPNRL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  93 ACGHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWC 172
Cdd:cd15139  81 VCGYFGFAMTFFSLATMLILLAMALERCLSIGHPYFYERYVSKRCGYVTIPLIYLLCALFCLFPFLGFGKYVQYCPGTWC 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 173 FIDMDPSASEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVR-RQRGHKRHRSMTKEVEHLVLLWFM 251
Cdd:cd15139 161 FIDMNPEASEHRAYANLYATLLLLLIVAVVLCNASVIYHLVRMYRRRKRNRSSVGgRARSHRRRFSMAEEVEHLILLVFM 240
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 71834636 252 TIAFVFCSLPLVIQVYHNTLYHRDRHRNNVIPLLFLSANPIIDPWVFIILSPPVPRLLW 310
Cdd:cd15139 241 TIIFVICSLPLTIQVYMNTFSDSENHKWDLIALRFLSVNPIIDPWVFIILSPPVLRLLW 299
 
Name Accession Description Interval E-value
7tmA_PGE2_EP2 cd15139
prostaglandin E2 receptor EP2 subtype, member of the class A family of seven-transmembrane G ...
16-310 4.06e-179

prostaglandin E2 receptor EP2 subtype, member of the class A family of seven-transmembrane G protein-coupled receptors; Prostaglandin E2 receptor EP2, also called prostanoid EP2 receptor, is one of four receptor subtypes whose endogenous physiological ligand is prostaglandin E2 (PGE2). Each of these subtypes (EP1-EP4) have unique but overlapping tissue distributions that activate different intracellular signaling pathways. Stimulation of the EP2 receptor by PGE2 causes cAMP accumulation through G(s) protein activation, which subsequently produces smooth muscle relaxation and mediates the systemic vasodepressor response to PGE2. Prostanoids are the cyclooxygenase (COX) metabolites of arachidonic acid, which include the prostaglandins (PGD2, PGE2, PGF2alpha), prostacyclin (PGI2), and thromboxane A2 (TxA2). These five major bioactive prostanoids acts as mediators or modulators in a wide range of physiological and pathophysiological processes within the kidney and play important roles in inflammation, platelet aggregation, and vasoconstriction/relaxation, among many others. They act locally by preferentially interacting with G protein-coupled receptors designated DP, EP. FP, IP, and TP, respectively. The phylogenetic tree suggests that the prostanoid receptors can be grouped into two major branches: G(s)-coupled (DP1, EP2, EP4, and IP) and G(i)- (EP3) or G(q)-coupled (EP1, FP, and TP), forming three clusters.


Pssm-ID: 320267  Cd Length: 299  Bit Score: 502.38  E-value: 4.06e-179
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  16 GGSPTIPAFMFSTGVLGNVVALILLEMRRRKQPA---SLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRL 92
Cdd:cd15139   1 GGSPAISALMFSAGVLGNVLALVLLERRRRKEVGrrqSLFHVLVTSLVITDLLGTCLISPVVLASYSRNTTLVGMSPNRL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  93 ACGHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWC 172
Cdd:cd15139  81 VCGYFGFAMTFFSLATMLILLAMALERCLSIGHPYFYERYVSKRCGYVTIPLIYLLCALFCLFPFLGFGKYVQYCPGTWC 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 173 FIDMDPSASEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVR-RQRGHKRHRSMTKEVEHLVLLWFM 251
Cdd:cd15139 161 FIDMNPEASEHRAYANLYATLLLLLIVAVVLCNASVIYHLVRMYRRRKRNRSSVGgRARSHRRRFSMAEEVEHLILLVFM 240
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 71834636 252 TIAFVFCSLPLVIQVYHNTLYHRDRHRNNVIPLLFLSANPIIDPWVFIILSPPVPRLLW 310
Cdd:cd15139 241 TIIFVICSLPLTIQVYMNTFSDSENHKWDLIALRFLSVNPIIDPWVFIILSPPVLRLLW 299
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
32-297 5.83e-19

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 84.67  E-value: 5.83e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636    32 GNVVALILLEMRRRKQpaSLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFFSVVTLAI 111
Cdd:pfam00001   1 GNLLVILVILRNKKLR--TPTNIFLLNLAVADLLFLLLTLPFWLVYALFGTWPFG----SALCKLVTALDVVNGYASILL 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636   112 LLSMAVERWLSIGHPFFYekYSSKRCGYITIALIYLLCALFCVTPFLGFG-KYVQYCPGTWCFIDMdpsasEHKAFNIIY 190
Cdd:pfam00001  75 LTAISIDRYLAIVHPLRY--RRIMRRAKAIILLIWVLALLLSLPPLLGWNtLDIPSNGVTSCLITF-----PESLWPVSY 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636   191 ASCLLLMIVCTVLCNASVIYhiSRMYRRLKAHRSSVRRQRGHKRHrsmtkeveHLVLLWFMTIAFVFCSLPLVI----QV 266
Cdd:pfam00001 148 LLFSTVVGFLLPLLVILVCY--TRIIRTLRKQARSRRRSVRSERK--------ALKTLLVVVVVFILCWLPYHIlnllDS 217
                         250       260       270
                  ....*....|....*....|....*....|....*.
gi 71834636   267 YHNTLYHRDRHRNNV-----IPLLFLSANPIIDPWV 297
Cdd:pfam00001 218 LCDLLIIISCVVTPPrtllqLTVWLAYSNSCLNPII 253
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
25-272 2.69e-03

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 38.99  E-value: 2.69e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636   25 MFSTGVLGNVVALILLEMRRRKQPASLFHVlvsSLVITDLLGTFSLsPLVLTAYFRNASLLGMNENRLACGhFAYAMTFF 104
Cdd:PHA03087  50 IFFFGLVGNIIVIYVLTKTKIKTPMDIYLL---NLAVSDLLFVMTL-PFQIYYYILFQWSFGEFACKIVSG-LYYIGFYN 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  105 SVVTLAIllsMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLcALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASEHK 184
Cdd:PHA03087 125 SMNFITV---MSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWII-SIIETTPILFVYTTKKDHETLICCMFYNNKTMNWK 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  185 AFnIIYASCLLLMIVCTVLcnasVIYHISRMYRRLKAHRSSVRRQRGHKrhrsmtkevehLVLLwfMTIAFVFCSLPLVI 264
Cdd:PHA03087 201 LF-INFEINIIGMLIPLTI----LLYCYSKILITLKGINKSKKNKKAIK-----------LVLI--IVILFVIFWLPFNV 262

                 ....*...
gi 71834636  265 QVYHNTLY 272
Cdd:PHA03087 263 SVFVYSLH 270
 
Name Accession Description Interval E-value
7tmA_PGE2_EP2 cd15139
prostaglandin E2 receptor EP2 subtype, member of the class A family of seven-transmembrane G ...
16-310 4.06e-179

prostaglandin E2 receptor EP2 subtype, member of the class A family of seven-transmembrane G protein-coupled receptors; Prostaglandin E2 receptor EP2, also called prostanoid EP2 receptor, is one of four receptor subtypes whose endogenous physiological ligand is prostaglandin E2 (PGE2). Each of these subtypes (EP1-EP4) have unique but overlapping tissue distributions that activate different intracellular signaling pathways. Stimulation of the EP2 receptor by PGE2 causes cAMP accumulation through G(s) protein activation, which subsequently produces smooth muscle relaxation and mediates the systemic vasodepressor response to PGE2. Prostanoids are the cyclooxygenase (COX) metabolites of arachidonic acid, which include the prostaglandins (PGD2, PGE2, PGF2alpha), prostacyclin (PGI2), and thromboxane A2 (TxA2). These five major bioactive prostanoids acts as mediators or modulators in a wide range of physiological and pathophysiological processes within the kidney and play important roles in inflammation, platelet aggregation, and vasoconstriction/relaxation, among many others. They act locally by preferentially interacting with G protein-coupled receptors designated DP, EP. FP, IP, and TP, respectively. The phylogenetic tree suggests that the prostanoid receptors can be grouped into two major branches: G(s)-coupled (DP1, EP2, EP4, and IP) and G(i)- (EP3) or G(q)-coupled (EP1, FP, and TP), forming three clusters.


Pssm-ID: 320267  Cd Length: 299  Bit Score: 502.38  E-value: 4.06e-179
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  16 GGSPTIPAFMFSTGVLGNVVALILLEMRRRKQPA---SLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRL 92
Cdd:cd15139   1 GGSPAISALMFSAGVLGNVLALVLLERRRRKEVGrrqSLFHVLVTSLVITDLLGTCLISPVVLASYSRNTTLVGMSPNRL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  93 ACGHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWC 172
Cdd:cd15139  81 VCGYFGFAMTFFSLATMLILLAMALERCLSIGHPYFYERYVSKRCGYVTIPLIYLLCALFCLFPFLGFGKYVQYCPGTWC 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 173 FIDMDPSASEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVR-RQRGHKRHRSMTKEVEHLVLLWFM 251
Cdd:cd15139 161 FIDMNPEASEHRAYANLYATLLLLLIVAVVLCNASVIYHLVRMYRRRKRNRSSVGgRARSHRRRFSMAEEVEHLILLVFM 240
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 71834636 252 TIAFVFCSLPLVIQVYHNTLYHRDRHRNNVIPLLFLSANPIIDPWVFIILSPPVPRLLW 310
Cdd:cd15139 241 TIIFVICSLPLTIQVYMNTFSDSENHKWDLIALRFLSVNPIIDPWVFIILSPPVLRLLW 299
7tmA_PGI2 cd15141
prostaglandin I2 receptor, member of the class A family of seven-transmembrane G ...
17-309 5.07e-91

prostaglandin I2 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Prostaglandin I2 receptor (also called prostacyclin receptor or prostanoid IP receptor) is a class A, G protein-coupled receptor whose endogenous ligand is prostacyclin, which is the major product of cyclooxygenase metabolite of arachidonic acid that found predominantly in platelets and vascular smooth muscle cells (VSMCs). The PGI2 receptor is coupled to both G(s) and G(q) protein subtypes, resulting in increased cAMP formation, phosphoinositide turnover, and Ca2+ signaling. PGI2 receptor activation by prostacyclin induces VSMC differentiation and produces a potent vasodilation and inhibition of platelet aggregation.


Pssm-ID: 320269  Cd Length: 301  Bit Score: 277.86  E-value: 5.07e-91
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  17 GSPTIPAFMFSTGVLGNVVALILLEMRR--RKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRLAC 94
Cdd:cd15141   2 GHPATSTLMFAAGVVGNLLALGILGVHRkeRRTKSSAFCVLVTGLAATDLLGTCFLSPMVFVSYAQNSSLLGLAAGQPLC 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  95 GHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFI 174
Cdd:cd15141  82 HLFAFAMTFFGLASMLILFAMAVERCLAISHPYFYAQHSGRRLAKLALPAIYAFGALFCALPLLGVGRHKQYCPGTWCFI 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 175 DM---DPSASEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQ-RGHKRHRSMTKEVEHLVLLWF 250
Cdd:cd15141 162 RMtvpGHREPGSLAFSLLYASLMALLIAAIFLCNGSVTVSLCRMYRGQKARRGSLRRCgRLGWWLGQGEEEVDHLILLAL 241
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 71834636 251 MTIAFVFCSLPLVIQVYHNTLYHRDRHRNNVIPLLFLSANPIIDPWVFIILSPPVPRLL 309
Cdd:cd15141 242 MTVIFVVCSLPLTIRAFLGAIAPDGNESGDLLAFRFSAFNPILDPWIFIIFRKAVFRKL 300
7tmA_Prostanoid_R cd14981
G protein-coupled receptors for prostanoids, member of the class A family of ...
16-309 1.95e-88

G protein-coupled receptors for prostanoids, member of the class A family of seven-transmembrane G protein-coupled receptors; Prostanoids are the cyclooxygenase (COX) metabolites of arachidonic acid, which include the prostaglandins (PGD2, PGE2, PGF2alpha), prostacyclin (PGI2), and thromboxane A2 (TxA2). These five major bioactive prostanoids acts as mediators or modulators in a wide range of physiological and pathophysiological processes within the kidney and play important roles in inflammation, platelet aggregation, and vasoconstriction/relaxation, among many others. They act locally by preferentially interacting with G protein-coupled receptors designated DP, EP. FP, IP, and TP, respectively. The phylogenetic tree suggests that the prostanoid receptors can be grouped into two major branches: G(s)-coupled (DP1, EP2, EP4, and IP) and G(i)- (EP3) or G(q)-coupled (EP1, FP, and TP), forming three clusters.


Pssm-ID: 320112  Cd Length: 288  Bit Score: 270.66  E-value: 1.95e-88
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  16 GGSPTIPAFMFSTGVLGNVVALILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNEnrlACG 95
Cdd:cd14981   1 GESPAPPALMFVFGVLGNLLALIVLARSSKSHKWSVFYRLVAGLAITDLLGILLTSPVVLAVYASNFEWDGGQP---LCD 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  96 HFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFID 175
Cdd:cd14981  78 YFGFMMSFFGLSSLLIVCAMAVERFLAITHPFFYNSHVKKRRARLMLGAVWAFALLIASLPLLGLGSYVLQYPGTWCFLD 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 176 MDPSASEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRGHKRHrsmtkEVEHLVLLWFMTIAF 255
Cdd:cd14981 158 FYSKNTGDAAYAYLYSILGLLILLVTLLCNLLVIITLLRMRRRKKRHRRSRRSARRQKRN-----EIQMVVLLLAITVVF 232
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*
gi 71834636 256 VFCSLPLVIQVYHNTLYHR-DRHRNNVIPLLFLSANPIIDPWVFIILSPPVPRLL 309
Cdd:cd14981 233 SVCWLPLMIRVLINATGDSeKNGKTDLLAVRMASWNQILDPWVYILLRKEVLRRL 287
7tmA_PGD2 cd15140
prostaglandin D2 receptor, member of the class A family of seven-transmembrane G ...
16-307 4.83e-75

prostaglandin D2 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Prostaglandin D2 receptor (also called prostanoid DP receptor, DP1, or PGD2R1) is a G-protein coupled receptor whose endogenous ligand is prostaglandin D2 (PGD2). PGD2, the major cyclooxygenase metabolite of arachidonic acid produced by mast cells, mediates inflammatory reactions in response to allergen challenge and causes peripheral vasodilation. PGD2 exerts its biological effects by binding to two types of cell surface receptors: a DP1 receptor that belongs to the prostanoid receptor family and a chemoattractant receptor-homologous molecule expressed on the T-helper type 2 cells (CRTH2 or PD2R2).


Pssm-ID: 320268  Cd Length: 312  Bit Score: 237.10  E-value: 4.83e-75
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  16 GGSPTIPAFMFSTGVLGNVVALILL-------EMRRRKQP-ASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGM 87
Cdd:cd15140   1 GSSVVSSSLLFAAGLLGNLLALGLLwlhklhaKKQRGGRPrTSVFYVLVTVLTVTDLLGKCLLSPVVLAAYAQNRSLVGL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  88 NE--NRLACGHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQ 165
Cdd:cd15140  81 TPagNLNLCQVFAFLMIFFGLASTFILLAMALECWLSLGHPFFYQRHINKRLGALVSLILYAFCLGFCALPFFGFGRYVQ 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 166 YCPGTWCFIDM--DPSASEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRG-----HKRHRSM 238
Cdd:cd15140 161 YCPGTWCFIQMtaEESSTSALAYSVLYGSLMGLLVLAIVLCNLGIMRNLYQMYRRENEKGIPSTDLQGaaafpRQQEPAG 240
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 71834636 239 TKEVEHLVLLWFMTIAFVFCSLPLVIQVYHNTLYHRDRHRNNVIPLLFLSANPIIDPWVFIILSPPVPR 307
Cdd:cd15140 241 MEELEHLILLALMTVLFTACSLPVIARAYVGAFKGEKNEAADLTALRFLSVNSIVDPWIFIIFRTSKFR 309
7tmA_PGE2_EP4 cd15142
prostaglandin E2 receptor EP4 subtype, member of the class A family of seven-transmembrane G ...
18-301 1.38e-65

prostaglandin E2 receptor EP4 subtype, member of the class A family of seven-transmembrane G protein-coupled receptors; Prostaglandin E2 receptor EP4, also called prostanoid EP4 receptor, is one of four receptor subtypes whose endogenous physiological ligand is prostaglandin E2 (PGE2). Each of these subtypes (EP1-EP4) have unique but overlapping tissue distributions that activate different intracellular signaling pathways. Like the EP2 receptor, stimulation of the EP4 receptor by PGE2 causes cAMP accumulation through G(s) protein activation. Knockout studies in mice suggest that EP4 receptor may be involved in the maintenance of bone mass and fracture healing. Prostanoids are the cyclooxygenase (COX) metabolites of arachidonic acid, which include the prostaglandins (PGD2, PGE2, PGF2alpha), prostacyclin (PGI2), and thromboxane A2 (TxA2). These five major bioactive prostanoids acts as mediators or modulators in a wide range of physiological and pathophysiological processes within the kidney and play important roles in inflammation, platelet aggregation, and vasoconstriction/relaxation, among many others. They act locally by preferentially interacting with G protein-coupled receptors designated DP, EP. FP, IP, and TP, respectively. The phylogenetic tree suggests that the prostanoid receptors can be grouped into two major branches: G(s)-coupled (DP1, EP2, EP4, and IP) and G(i)- (EP3) or G(q)-coupled (EP1, FP, and TP), forming three clusters.


Pssm-ID: 320270  Cd Length: 302  Bit Score: 212.36  E-value: 1.38e-65
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  18 SPTIPAFMFSTGVLGNVVALILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHF 97
Cdd:cd15142   3 PPTIPAVMFIFGVVGNLIAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTCLASPVTIATYLKGRWPGG----QPLCEYF 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  98 AYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMD 177
Cdd:cd15142  79 SFILLFFSLSGLSIICAMSIERYLAINHAYFYNHYVDKRLAGLTLFAIYASNILFCALPSMGLGKSKLQYPKTWCFIDWR 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 178 PSASEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQR----GHKRHRSMTK--EVEHLVLLWFM 251
Cdd:cd15142 159 TNVSVHAAYSYMYAGFSSLLILVTVLCNVLVCGALIRMHRQFVRRTSLGTDQRlsdfRRRRSFRRMAgaEIQMVILLIAT 238
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*
gi 71834636 252 TIAFVFCSLPLVIQVYHNTLYH-----RDRHRNNVIPLLFLSANPIIDPWVFIIL 301
Cdd:cd15142 239 SVVVLICSIPLVVRVFVNQLYQpavekDLDKNPDLQAIRIASVNPILDPWIYILL 293
7tmA_Opsins_type2_animals cd14969
type 2 opsins in animals, member of the class A family of seven-transmembrane G ...
23-261 3.96e-27

type 2 opsins in animals, member of the class A family of seven-transmembrane G protein-coupled receptors; This rhodopsin family represents the type 2 opsins found in vertebrates and invertebrates except sponge. Type 2 opsins primarily function as G protein coupled receptors and are responsible for vision as well as for circadian rhythm and pigment regulation. On the contrary, type 1 opsins such as bacteriorhodopsin and proteorhodopsin are found in both prokaryotic and eukaryotic microbes, functioning as light-gated ion channels, proton pumps, sensory receptors and in other unknown functions. Although these two opsin types share seven-transmembrane domain topology and a conserved lysine reside in the seventh helix, type 1 opsins do not activate G-proteins and are not evolutionarily related to type 2. Type 2 opsins can be classified into six distinct subfamilies including the vertebrate opsins/encephalopsins, the G(o) opsins, the G(s) opsins, the invertebrate G(q) opsins, the photoisomerases, and the neuropsins.


Pssm-ID: 320100  Cd Length: 284  Bit Score: 108.83  E-value: 3.96e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFSTGVLGNVVALILleMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMT 102
Cdd:cd14969   8 SLIGVLGVVLNGLVILV--FLKKKKLRTPLNLFLLNLALADLLMSVVGYPLSFYSNLSGRWSFG----DPGCVIYGFAVT 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 103 FFSVVTLAILLSMAVERWLSIGHPFFYeKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASE 182
Cdd:cd14969  82 FLGLVSISTLAALAFERYLVIVRPLKA-FRLSKRRALILIAFIWLYGLFWALPPLFGWSSYVPEGGGTSCSVDWYSKDPN 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 183 HKAFNI-IYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRGHKRHRSMTKevehLVLLwfMTIAFVFCSLP 261
Cdd:cd14969 161 SLSYIVsLFVFCFFLPLAIIIFCYYKIYRTLRKMSKRAARRKNSAITKRTKKAEKKVAK----MVLV--MIVAFLIAWTP 234
7tmA_PGE2_EP1 cd15144
prostaglandin E2 receptor EP1 subtype, member of the class A family of seven-transmembrane G ...
16-307 5.93e-26

prostaglandin E2 receptor EP1 subtype, member of the class A family of seven-transmembrane G protein-coupled receptors; Prostaglandin E2 receptor EP1, also called prostanoid EP1 receptor, is one of four receptor subtypes whose endogenous physiological ligand is prostaglandin E2 (PGE2). Each of these subtypes (EP1-EP4) have unique but overlapping tissue distributions that activate different intracellular signaling pathways. It has been shown that stimulation of the EP1 receptor by PGE2 causes smooth muscle contraction and increased intracellular Ca2+ levels; however, it is still unclear whether EP1 receptor is exclusively coupled to G(q/11), which leading to activation of phospholipase C and phosphatidylinositol hydrolysis. Prostanoids are the cyclooxygenase (COX) metabolites of arachidonic acid, which include the prostaglandins (PGD2, PGE2, PGF2alpha), prostacyclin (PGI2), and thromboxane A2 (TxA2). These five major bioactive prostanoids acts as mediators or modulators in a wide range of physiological and pathophysiological processes within the kidney and play important roles in inflammation, platelet aggregation, and vasoconstriction/relaxation, among many others. They act locally by preferentially interacting with G protein-coupled receptors designated DP, EP. FP, IP, and TP, respectively. The phylogenetic tree suggests that the prostanoid receptors can be grouped into two major branches: G(s)-coupled (DP1, EP2, EP4, and IP) and G(i)- (EP3) or G(q)-coupled (EP1, FP, and TP), forming three clusters.


Pssm-ID: 320272  Cd Length: 294  Bit Score: 105.63  E-value: 5.93e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  16 GGSPTIPAFMFSTGVLGNVVALILL-----EMRRRKQPAslFHVLVSSLVITDLLGTFSLSPLVLTAYFrNASLLGMNEN 90
Cdd:cd15144   1 PASPAMPIFSMTLGALSNIVALVILaqsyaRFRRRSKAT--FLLFASSLVLTDLAGHVIPGALVLRLYL-SGQMPAEEPR 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  91 RLACGHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGT 170
Cdd:cd15144  78 GALCQFFGACMVFFGLCPLFLGCAMAVERCVGVTRPLLHSSVVTTTRTKLSLLAIWAVALAVALLPLFRFGRYKPQFPGT 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 171 WCFIDMDPSAS-EHKAFNIIYASCLLLMIVCTVLCNAsviyhISrmyrRLKAHRSSVRRQRGHKRHRSMTKEVEHLVLLW 249
Cdd:cd15144 158 WCFIKVQPPGSwADVAFALLFSLLGLASLLVSLVCNT-----IS----GLTLVRARLRKKCSCSNRRAKSHDIEMVVQLV 228
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 71834636 250 FMTIAFVFCSLPLVIQVYH--NTLYHRDRHRNNVIPLLFL---SANPIIDPWVFIILSPPVPR 307
Cdd:cd15144 229 GIMVVSCICWSPLLIFVLIsvSRSYERPKHQYEKLLFLGVrlaSWNQILDPWVYILLRRAVLR 291
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
20-302 5.97e-25

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320086  Cd Length: 274  Bit Score: 102.35  E-value: 5.97e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  20 TIPAFMFSTGVLGNVVALILLEMRRRKQpaSLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAY 99
Cdd:cd00637   3 VLYILIFVVGLVGNLLVILVILRNRRLR--TVTNYFILNLAVADLLVGLLVIPFSLVSLLLGGWWFG----DALCKLLGF 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 100 AMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPS 179
Cdd:cd00637  77 LQTVSLTASILTLTAISVDRYLAIVHPLRYRRRFTKRRAKLVIALIWLLSLLLALPPLLGWKVYEYGGYCCCCLCWPDLT 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 180 AseHKAFNIIyascllLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRGHKRHRSMTKEVEHLVLLWFMTIAFVFCS 259
Cdd:cd00637 157 L--SKAYTIF------LFVLLFLLPLLVIIVCYVRIFRKLRRHRKRISSSSNSSRRRRRRRERKVTKMLLIVVVVFLLCW 228
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*.
gi 71834636 260 LPLVIQVYHNTLYHRDRHRNNV---IPLLFLSANPIIDPWVFIILS 302
Cdd:cd00637 229 LPYFILFLLDVFGPDPSPLPRIlyfLALLLAYLNSAINPIIYAFFN 274
7tmA_TXA2_R cd15143
thromboxane A2 receptor, member of the class A family of seven-transmembrane G protein-coupled ...
18-310 6.37e-25

thromboxane A2 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The thromboxane receptor, also known as the prostanoid TP receptor, is a class A G-protein coupled receptor whose endogenous ligand is thromboxane A2 (TXA2). TXA2 is the major product of cyclooxygenase metabolite of arachidonic acid that found predominantly in platelets and stimulates platelet aggregation, Ca2+ influx into platelets, and also causes vasoconstriction. TXA2 has been shown to be involved in immune regulation, angiogenesis and metastasis, among many others. Activation of TXA2 receptor is coupled to G(q) and G(13), resulting in the activations of phospholipase C and RhoGEF, respectively. TXA2 receptor is widely distributed in the body and is abundantly expressed in thymus and spleen.


Pssm-ID: 320271  Cd Length: 296  Bit Score: 102.59  E-value: 6.37e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  18 SPTIPAFMFSTGVLGNVVALILLEMRRRKQPA---SLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRLAC 94
Cdd:cd15143   3 SVWFSTIFSAIGLASNLFAFIVLVKSSRKTKSrsrSSFLIFLCGLVVTDFLGLLVTGTIVISFHLTNFNWRVVDPDCYLC 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  95 GHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFI 174
Cdd:cd15143  83 NFMGLSMVFYGLCPLLLGATMAVERFFGINRPFSRSTAMSKRRAWYMVGMVWAFAFLLGLLPILGLGRYTLQYPGSWCFL 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 175 DMDPSASEhKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRlkahRSSVRRQRGHkrhrsmtkEVEHLV-LLWFMTI 253
Cdd:cd15143 163 TLLFDSKD-VAFGLLFSFLGILSVGLSFLLNTVSVVTLCRVYHD----RESVQRRRDS--------EVEMMVqLLGIMVI 229
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 71834636 254 AFVfCSLPLVIQVYHNTLYH-------RDRHRNNVIPLL----FLSANPIIDPWVFIILSPPVPRLLW 310
Cdd:cd15143 230 ASV-CWLPLLVFIAQTVLQKppamllaGQIPRLTEKKLLiylrFATWNQILDPWVYILFRRAVLKRLY 296
7tmA_PGE2_EP3 cd15146
prostaglandin E2 receptor EP3 subtype, member of the class A family of seven-transmembrane G ...
18-314 7.14e-25

prostaglandin E2 receptor EP3 subtype, member of the class A family of seven-transmembrane G protein-coupled receptors; Prostaglandin E2 receptor EP3, also called prostanoid EP3 receptor, is one of four receptor subtypes whose endogenous physiological ligand is prostaglandin E2 (PGE2). Each of these subtypes (EP1-EP4) have unique but overlapping tissue distributions that activate different intracellular signaling pathways. Stimulation of the EP3 receptor by PGE2 preferentially couples to G(i) protein. This leads to a decrease in adenylate cyclase activity, thereby decreasing cAMP levels, which subsequently produces smooth muscle contraction. Knockout mice studies suggest that the EP3 receptor may act as a systemic vasopressor. Prostanoids are the cyclooxygenase (COX) metabolites of arachidonic acid, which include the prostaglandins (PGD2, PGE2, PGF2alpha), prostacyclin (PGI2), and thromboxane A2 (TxA2). These five major bioactive prostanoids acts as mediators or modulators in a wide range of physiological and pathophysiological processes within the kidney and play important roles in inflammation, platelet aggregation, and vasoconstriction/relaxation, among many others. They act locally by preferentially interacting with G protein-coupled receptors designated DP, EP. FP, IP, and TP, respectively. The phylogenetic tree suggests that the prostanoid receptors can be grouped into two major branches: G(s)-coupled (DP1, EP2, EP4, and IP) and G(i)- (EP3) or G(q)-coupled (EP1, FP, and TP), forming three clusters.


Pssm-ID: 320274  Cd Length: 308  Bit Score: 102.65  E-value: 7.14e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  18 SPTIPAFMFSTGVLGNVVALILLEMRRRKQPASL---FHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRLAC 94
Cdd:cd15146   3 SVAFPITMMITGMVGNALAMLLVYRSYRKKENKRkrsFLLCIGSLALTDLFGQLLTSPIVISVYLSDRKWERVDPSGRLC 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  95 GHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFI 174
Cdd:cd15146  83 PFFGLCMTVFGLCPLFIASAMAIERALAIRAPHWYSSHMKTRVTKAVLLGIWLAVLAFALLPIAGVGQYTLQWPGTWCFI 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 175 DMDPSASEHKAFNIIYASCLLLMIVCTVLCNASVIYH-ISRMYRRLKAHRSSVRRQRghkrhrsMTKEVEhLVLLWFMTI 253
Cdd:cd15146 163 STGDGEPGNNFFASTFASLGLFSLCVTFSCNLATIRAlVSRCKTKAGASVSSKQWER-------ITTETL-IQLLGIMCV 234
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 71834636 254 AFVfCSLPLVIQVYHNTLYHRDRHRNN------------------VIPLLFLSANPIIDPWVFIILSppvpRLLWDKIC 314
Cdd:cd15146 235 LSA-CWSPLLVLMLKMISNHTSSEHCKsatappqstelqkdcnffLTAVRLASLNQILDPWVYLLLR----KILLRKFC 308
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
32-297 5.83e-19

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 84.67  E-value: 5.83e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636    32 GNVVALILLEMRRRKQpaSLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFFSVVTLAI 111
Cdd:pfam00001   1 GNLLVILVILRNKKLR--TPTNIFLLNLAVADLLFLLLTLPFWLVYALFGTWPFG----SALCKLVTALDVVNGYASILL 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636   112 LLSMAVERWLSIGHPFFYekYSSKRCGYITIALIYLLCALFCVTPFLGFG-KYVQYCPGTWCFIDMdpsasEHKAFNIIY 190
Cdd:pfam00001  75 LTAISIDRYLAIVHPLRY--RRIMRRAKAIILLIWVLALLLSLPPLLGWNtLDIPSNGVTSCLITF-----PESLWPVSY 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636   191 ASCLLLMIVCTVLCNASVIYhiSRMYRRLKAHRSSVRRQRGHKRHrsmtkeveHLVLLWFMTIAFVFCSLPLVI----QV 266
Cdd:pfam00001 148 LLFSTVVGFLLPLLVILVCY--TRIIRTLRKQARSRRRSVRSERK--------ALKTLLVVVVVFILCWLPYHIlnllDS 217
                         250       260       270
                  ....*....|....*....|....*....|....*.
gi 71834636   267 YHNTLYHRDRHRNNV-----IPLLFLSANPIIDPWV 297
Cdd:pfam00001 218 LCDLLIIISCVVTPPrtllqLTVWLAYSNSCLNPII 253
7tmA_FP cd15145
prostaglandin F2-alpha receptor, member of the class A family of seven-transmembrane G ...
24-310 5.92e-18

prostaglandin F2-alpha receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The PGF2-alpha receptor, also called prostanoid FP receptor, is a class A G-protein coupled receptor whose endogenous ligand is prostaglandin F2-alpha. PGF2-alpha binding to this receptor is coupled to the stimulation of phospholipase C (PLC) pathway via G-protein subunit G(q). This leads to the release of inositol trisphosphate (IP3) and diacylglycerol (DAG) which results in increased intracellular Ca2+ levels and activation of PKC. The receptor activation primarily induces uterine contraction and bronchoconstriction, and stimulates luteolysis. Like most prostanoid receptors, the PGF2-alpha receptor has also been implicated in tumor angiogenesis and metastasis.


Pssm-ID: 320273  Cd Length: 290  Bit Score: 82.18  E-value: 5.92e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  24 FMfSTGVLGNVVALILL---EMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRLACGHFAYA 100
Cdd:cd15145  10 FM-TVGILSNSLAIAILmkaYQRFRQKSKASFLLLASGLVITDFFGHLINGTIAVFVYASDKDWIRFDQSNILCSVFGIC 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 101 MTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSA 180
Cdd:cd15145  89 MVFFGLCPLLLGSVMAVERCIGVTKPIFHSTKMTSKHVKMMLSGVCLFAVLVALLPILGHRDYQIQASRTWCFYKTEHIE 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 181 SEHKAFNIIYASCL-LLMIVCTVLCNAsvIYHISRMYRRLKAHRSsvRRQRGHkrHRSMTKEvehlvLLWFMTIAFVfCS 259
Cdd:cd15145 169 DWEDRFYLLLFSFLgLLALAISFLCNA--ITGITLLRVKFRSQQH--RQGRSH--HFEMVIQ-----LLAIMCVSCI-CW 236
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....
gi 71834636 260 LPLVIQVYHNTLYHRDRHRNNVIPLLFL---SANPIIDPWVFIILSPPVPRLLW 310
Cdd:cd15145 237 SPFLVTMANIGINGRDSLESCETILFALrmaTWNQILDPWVYILLRKAVLKNLY 290
7tm_GPCRs cd14964
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
20-302 7.81e-18

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320095  Cd Length: 270  Bit Score: 81.68  E-value: 7.81e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  20 TIPAFMFSTGVLGNVVALILLEMRRRKQpaSLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAY 99
Cdd:cd14964   3 VLLLLIFLLGLLGNLLVLLVILRSRRLR--TPTNLFLLNLALADLLFSLVVVPFLLLGLLSGEWSFG----FAGCKLVLF 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 100 AMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPS 179
Cdd:cd14964  77 FFYLFGFASIFLLTAMAIDRYLAICHPLKYTVLMTPRRARLLILGIWVLSLLLSLPPLLGWGTLPFCGPNVPLLTLSCSD 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 180 asehKAFNIIYASCLLLMIVCTVLCNASVIYhiSRMYRRLKAHRSSVRRQRGHKRHRSMTkevehLVLLWFMTIAFVFCS 259
Cdd:cd14964 157 ----TAWNIAYTLGLLILGFLLPLLLILVSY--ARIVRALLRRKRITRSAISSARRERKA-----FKTLLIVVLVFLLCW 225
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*
gi 71834636 260 LPL-VIQVYHNTLYHRDRHRNNVIPLLFLS-ANPIIDPWVFIILS 302
Cdd:cd14964 226 LPYhIVYLLPALLQLSNSLPLLLLLSVLLAvLNSCLNPLIYSLRN 270
7tmA_Opsin5_neuropsin cd15074
neuropsin (Opsin-5), member of the class A family of seven-transmembrane G protein-coupled ...
29-240 7.08e-16

neuropsin (Opsin-5), member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropsin, also known as Opsin-5, is a photoreceptor protein expressed in the retina, brain, testes, and spinal cord. Neuropsin belongs to the type 2 opsin family of the class A G-protein coupled receptors. Mammalian neuropsin activates Gi protein-mediated photo-transduction pathway in a UV-dependent manner, whereas, in non-mammalian vertebrates, neuropsin is involved in regulating the photoperiodic control of seasonal reproduction in birds such as quail. As with other opsins, it may also act as a retinal photoisomerase.


Pssm-ID: 320202  Cd Length: 284  Bit Score: 76.16  E-value: 7.08e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  29 GVLGNVVALILLEMRRRK-QPASLFHVlvsSLVITDLLGTFSLSPLVLTAYFRNASLLGMNenrlACGHFAYAMTFFSVV 107
Cdd:cd15074  14 STLGNGTVLFVLYRRRSKlKPAELLTV---NLAVSDLGISVFGYPLAIISAFAHRWLFGDI----GCVFYGFCGFLFGCC 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 108 TLAILLSMAVERWLSIGHPFfYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASEHKAFN 187
Cdd:cd15074  87 SINTLTAISIYRYLKICHPP-YGPKLSRRHVCIVIVAIWLYALFWAVAPLVGWGSYGPEPFGTSCSIDWTGASASVGGMS 165
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 71834636 188 IIYAS---CLLLMIVCTVLCNASVIYHISRMYRRLKAHRSsvRRQRGHKRHRSMTK 240
Cdd:cd15074 166 YIISIfifCYLLPVLIIVFSYVKIIRKVKSSRKRVAGFDS--RSKRQHKIERKVTK 219
7tmA_Melanopsin-like cd15083
vertebrate melanopsins and related opsins, member of the class A family of seven-transmembrane ...
25-251 1.51e-13

vertebrate melanopsins and related opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represent the Gq-coupled rhodopsin subfamily consists of melanopsins, insect photoreceptors R1-R6, invertebrate Gq opsins as well as their closely related opsins. Melanopsins (also called Opsin-4) are the primary photoreceptor molecules for non-visual functions such as the photo-entrainment of the circadian rhythm and pupillary constriction in mammals. Mammalian melanopsins are expressed only in the inner retina, whereas non-mammalian vertebrate melanopsins are localized in various extra-retinal tissues such as iris, brain, pineal gland, and skin. The outer photoreceptors (R1-R6) are the insect Drosophila equivalent to the vertebrate rods and are responsible for image formation and motion detection. The invertebrate G(q) opsins includes the arthropod and mollusk visual opsins as well as invertebrate melanopsins, which are also found in vertebrates. Arthropods possess color vision by the use of multiple opsins sensitive to different light wavelengths. Members of this subfamily belong to the class A of the G protein-coupled receptors and have seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320211  Cd Length: 291  Bit Score: 70.05  E-value: 1.51e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  25 MFSTGVLGNVVAL-ILLEMRRRKQPAslfHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTF 103
Cdd:cd15083  10 IGLIGVVGNGLVIyAFCRFKSLRTPA---NYLIINLAISDFLMCILNCPLMVISSFSGRWIFG----KTGCDMYGFSGGL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 104 FSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASEH 183
Cdd:cd15083  83 FGIMSINTLAAIAVDRYLVITRPMKASVRISHRRALIVIAVVWLYSLLWVLPPLFGWSRYVLEGLLTSCSFDYLSRDDAN 162
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 71834636 184 KAFnIIYASC------LLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVR--RQRGHKRHRSMTKEVEHLVLLWFM 251
Cdd:cd15083 163 RSY-VICLLIfgfvlpLLIIIYCYSFIFRAVRRHEKAMKEMAKRFSKSELssPKARRQAEVKTAKIALLLVLLFCL 237
7tmA_FMRFamide_R-like cd14978
FMRFamide (Phe-Met-Arg-Phe) receptors and related proteins, member of the class A family of ...
18-264 3.87e-13

FMRFamide (Phe-Met-Arg-Phe) receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Drosophila melanogaster G-protein coupled FMRFamide (Phe-Met-Arg-Phe-NH2) receptor DrmFMRFa-R and related invertebrate receptors, as well as the vertebrate proteins GPR139 and GPR142. DrmFMRFa-R binds with high affinity to FMRFamide and intrinsic FMRFamide-related peptides. FMRFamide is a neuropeptide from the family of FMRFamide-related peptides (FaRPs), which all containing a C-terminal RFamide (Arg-Phe-NH2) motif and have diverse functions in the central and peripheral nervous systems. FMRFamide is an important neuropeptide in many types of invertebrates such as insects, nematodes, molluscs, and worms. In invertebrates, the FMRFamide-related peptides are involved in the regulation of heart rate, blood pressure, gut motility, feeding behavior, and reproduction. On the other hand, in vertebrates such as mice, they play a role in the modulation of morphine-induced antinociception. Orphan receptors GPR139 and GPR142 are very closely related G protein-coupled receptors, but they have different expression patterns in the brain and in other tissues. These receptors couple to inhibitory G proteins and activate phospholipase C. Studies suggested that dimer formation may be required for their proper function. GPR142 is predominantly expressed in pancreatic beta-cells and mediates enhancement of glucose-stimulated insulin secretion, whereas GPR139 is mostly expressed in the brain and is suggested to play a role in the control of locomotor activity. Tryptophan and phenylalanine have been identified as putative endogenous ligands of GPR139.


Pssm-ID: 320109  Cd Length: 299  Bit Score: 68.81  E-value: 3.87e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  18 SPTIPAFmfstGVLGNVVALILLemRRRKQPASLFHVLvSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRLACGHF 97
Cdd:cd14978   7 LPVICIF----GIIGNILNLVVL--TRKSMRSSINVYL-AALAVSDILVLLSALPLFLLPYIRDYSSSFLSYFYAYFLPY 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  98 AYAMT-FFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDM 176
Cdd:cd14978  80 IYPLAnTFQTASVWLTVALTVERYIAVCHPLKARTWCTPRRARRVILIIIIFSLLLNLPRFFEYEVVECENCNNNSYYYV 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 177 DPSASEHKAFNIIYASCLLLMIVCTVL-------CNASVIYHISRMYRRLKAHRSSVRRQRGHKRH-RSMTkevehlVLL 248
Cdd:cd14978 160 IPTLLRQNETYLLKYYFWLYAIFVVLLpfillliLNILLIRALRKSKKRRRLLRRRRRLLSRSQRReRRTT------IML 233
                       250
                ....*....|....*.
gi 71834636 249 WFMTIAFVFCSLPLVI 264
Cdd:cd14978 234 IAVVIVFLICNLPAGI 249
7tmA_Opsin_Gq_invertebrates cd15337
invertebrate Gq opsins, member of the class A family of seven-transmembrane G protein-coupled ...
28-303 3.95e-11

invertebrate Gq opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; The invertebrate Gq-coupled opsin subfamily includes the arthropod and mollusc visual opsins. Like the vertebrate visual opsins, arthropods possess color vision by the use of multiple opsins sensitive to different light wavelengths. The invertebrate Gq opsins are closely related to the vertebrate melanopsins, the primary photoreceptor molecules for non-visual responses to light, and the R1-R6 photoreceptors, which are the fly equivalent to the vertebrate rods. The Gq opsins belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320459  Cd Length: 292  Bit Score: 62.72  E-value: 3.95e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  28 TGVLGNvvALILLEMRRRKQPASLFHVLVSSLVITDLlgTFSLS---PLVLTAYFRNASLLGmnenRLACGHFAYAMTFF 104
Cdd:cd15337  13 LGVIGN--LLVIYLFSKTKSLRTPSNMFIINLAISDF--GFSAVngfPLKTISSFNKKWIWG----KVACELYGFAGGIF 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 105 SVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWC---FIDMDPSas 181
Cdd:cd15337  85 GFMSITTLAAISIDRYLVIAKPLEAMKKMTFKRAFIMIIIIWLWSLLWSIPPFFGWGRYVPEGFQTSCtfdYLSRDLN-- 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 182 ehkafNIIYASCLLLM-----IVCTVLCNASVIYHISRMYRRL-----KAHRSSVRRQRGHKRHRSMTKEVEHLVLLWFM 251
Cdd:cd15337 163 -----NRLFILGLFIFgflcpLLIIIFCYVNIIRAVRNHEKEMtqtakSGMGKDTEKNDARKKAEIRIAKVAIILISLFL 237
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*
gi 71834636 252 ---TIAFVFCSLPLVIQVYHNTLYHrdrhrnNVIPLLFLSANPIIDPWVFIILSP 303
Cdd:cd15337 238 lswTPYAVVALLGQFGPAYWITPYV------SELPVMFAKASAIYNPIIYALSHP 286
7tmA_Parietopsin cd15085
non-visual parietopsins, member of the class A family of seven-transmembrane G protein-coupled ...
36-302 1.25e-10

non-visual parietopsins, member of the class A family of seven-transmembrane G protein-coupled receptors; Parietopsin is a non-visual green light-sensitive opsin that was initially identified in the parietal eye of lizards. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extra-retinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity and body color change. Parietopsin belongs to the class A of the G protein-coupled receptors and shows strong homology to the vertebrate visual opsins.


Pssm-ID: 320213  Cd Length: 280  Bit Score: 61.41  E-value: 1.25e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  36 ALILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFFSVVTLAILLSM 115
Cdd:cd15085  19 VLVIAVTLKNPQLRNPINIFILNLSFSDLMMALCGTTIVTVTNYEGYFYLG----DAFCIFQGFAVNYFGIVSLWSLTLL 94
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 116 AVERWLSIGHPFFYEKYSSKRcGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASEHKAFNIIYascll 195
Cdd:cd15085  95 AYERYNVVCKPMGGLKLSTKR-GYQGLLFIWLFCLFWAVAPLFGWSSYGPEGVQTSCSIGWEERSWSNYSYLILY----- 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 196 lMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRGhkrhRSMTKEVEHLV-LLWFMTIAFVFCSLPL----VIQVYHNT 270
Cdd:cd15085 169 -FLMCFVIPVAIIGFSYGNVLRSLHKLNKKIEQQGG----KNCPEEEERAViMVLAMVIAFLICWLPYtvfaLIVVVNPE 243
                       250       260       270
                ....*....|....*....|....*....|..
gi 71834636 271 LYHRDRHRnnVIPLLFLSANPIIDPWVFIILS 302
Cdd:cd15085 244 LSISPLAA--TMPTYFAKTSPVYNPIIYIFLN 273
7tmA_Melanopsin cd15336
vertebrate melanopsins (Opsin-4), member of the class A family of seven-transmembrane G ...
20-260 4.62e-10

vertebrate melanopsins (Opsin-4), member of the class A family of seven-transmembrane G protein-coupled receptors; Melanopsin (also called Opsin-4) is the G protein-coupled photopigment that mediates non-visual responses to light. In mammals, these photoresponses include the photo-entrainment of circadian rhythm, pupillary constriction, and acute nocturnal melatonin suppression. Mammalian melanopsins are expressed only in the inner retina, whereas non-mammalian vertebrate melanopsins are localized in various extra-retinal tissues such as iris, brain, pineal gland, and skin. Melanopsins belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320458  Cd Length: 290  Bit Score: 59.73  E-value: 4.62e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  20 TIPAFMF---STGVLGN-VVALILLEMRRRKQPASLFhvlVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACG 95
Cdd:cd15336   2 TVGSVILiigITGMLGNaLVIYAFCRSKKLRTPANYF---IINLAVSDFLMSLTQSPIFFVNSLHKRWIFG----EKGCE 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  96 HFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFID 175
Cdd:cd15336  75 LYAFCGALFGITSMITLLAISLDRYLVITKPLASIRWVSKKRAMIIILLVWLYSLAWSLPPLFGWSAYVPEGLLTSCTWD 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 176 -MDPSASEHkAFNIIYASC-----LLLMIVCtVLCNASVIYHISRMYRRLkahrSSVRRQRGHKRHRSMTKEvehlvllW 249
Cdd:cd15336 155 yMTFTPSVR-AYTMLLFCFvffipLGIIIYC-YLFIFLAIRSTGREVQKL----GSQDRKEKAKQYQRMKNE-------W 221
                       250
                ....*....|..
gi 71834636 250 FMT-IAFVFCSL 260
Cdd:cd15336 222 KMAkIAFVVILL 233
7tmA_GPR151 cd15002
G protein-coupled receptor 151, member of the class A family of seven-transmembrane G ...
18-302 3.87e-08

G protein-coupled receptor 151, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor 151 (GRP151) is an orphan receptor of unknown function. Its expression is conserved in habenular axonal projections of vertebrates and may be a promising novel target for psychiatric drug development. GPR151 shows high sequence similarity with galanin receptors (GALR). GPR151 is a member of the class A rhodopsin-like GPCRs, which represent a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320133  Cd Length: 280  Bit Score: 53.57  E-value: 3.87e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  18 SPTIPAFMFSTGVLGNVVALILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRLAcGHF 97
Cdd:cd15002   2 VPILLGVICLLGFAGNLMVIGILLNNARKGKPSLIDSLILNLSAADLLLLLFSVPFRAAAYSKGSWPLGWFVCKTA-DWF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  98 AYAMTFFSVVTLAillSMAVERWLSIGHPFFYEKYSSKRCgYITIALIYLLCALFCVTPFLgFGKYVQYCPGTWCFIDMD 177
Cdd:cd15002  81 GHACMAAKSFTIA---VLAKACYMYVVNPTKQVTIKQRRI-TAVVASIWVPACLLPLPQWL-FRTVKQSEGVYLCILCIP 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 178 PSASEhkaFNIIYASCLLLMIVCTVLCNASVIYhiSRMYRRLKAHRSSVRRQRGHKRHRSMTkevehlVLLWFMTIAFVF 257
Cdd:cd15002 156 PLAHE---FMSAFVKLYPLFVFCLPLTFALFYF--WRAYGQCQRRGTKTQNLRNQIRSRKLT------HMLLSVVLAFTI 224
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*....
gi 71834636 258 CSLP-LVIQVYHNTLYHRDRHRNNVIPL---LFLSANPIIDPWVFIILS 302
Cdd:cd15002 225 LWLPeWVAWLWLIHIKSSGSSPPQLFNVlaqLLAFSISSVNPIIFLLMS 273
7tmA_Mrgpr cd14973
mas-related G protein-coupled receptors, member of the class A family of seven-transmembrane G ...
29-293 5.84e-08

mas-related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The Mas-related G-protein coupled receptor (Mrgpr) family constitutes a group of orphan receptors exclusively expressed in nociceptive primary sensory neurons and mast cells in the skin. Members of the Mrgpr family have been implicated in the modulation of nociception, pruritus (itching), and mast cell degranulation. The Mrgpr family in rodents and humans contains more than 50 members that can be grouped into 9 distinct subfamilies: MrgprA, B, C (MrgprX1), D, E, F, G, H (GPR90), and the primate-specific MrgprX subfamily. Some Mrgprs can be activated by endogenous ligands such as beta-alanine, adenine (a cell metabolite and potential transmitter), RF-amide related peptides, or salusin-beta (a bioactive peptide). However, the effects of these agonists are not clearly understood, and the physiological role of the individual receptor family members remains to be determined. Also included in this family is Mas-related G-protein coupled receptor 1-like (MAS1L) which is only found in primates. The angiotensin-II metabolite angiotensin is an endogenous ligand for MAS1L.


Pssm-ID: 320104  Cd Length: 272  Bit Score: 53.03  E-value: 5.84e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  29 GVLGNVVALILLEMRRRKQPaslFHVLVSSLVITDLLGtfslspLVLTAYFRNASLLGMNENRLACGHFAYAMTFFS-VV 107
Cdd:cd14973  14 GLVGNGLVLWLLGFRIKRNP---FSVYILNLAAADFLF------LSCQAIQSLEDLLGGSLPGFALCRLLATLMFFSyTV 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 108 TLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDmdpsasehkafn 187
Cdd:cd14973  85 GLSLLAAISTERCLSVLFPIWYRCHRPKHLSAVVCALLWALSLLLSVLESYFCGFLFWKFNESACRTF------------ 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 188 iIYASCLLLMIVCTVLCNASVIYHIsrmyrrlkahrssvRRQRGHKRHRSmtKEVEHLVLLwfMTIAFVFCSLPLVIQVY 267
Cdd:cd14973 153 -NFLSALLFLLLFLVMCVSSLTLLI--------------RVQCSSQRRPP--TRLYVVILL--TVLVFLLCGLPLGIYWF 213
                       250       260       270
                ....*....|....*....|....*....|.
gi 71834636 268 HNTLYHRDR-HRNNVIPLLFL----SANPII 293
Cdd:cd14973 214 LLLWFSNYLfHTFHPISDLLScvnsSANPII 244
7TM_GPCR_Srx pfam10328
Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis ...
26-238 6.65e-08

Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srx is part of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 313540  Cd Length: 271  Bit Score: 52.96  E-value: 6.65e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636    26 FSTGVLGNVV-ALILLEMRRRKQPASLFHVLVSSLVITD--LLGTFSL--SPLVLTayfrNASLLGMNENRLACGHFAya 100
Cdd:pfam10328   1 FLISLFGIILnWLIFYIFLKLPSLKNSFGILCANKAISNaiICTIFLFyvVPMTLL----DLSFLPELLNSHIGGLVL-- 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636   101 MTFFSVVTLAILLsMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIdmdPSA 180
Cdd:pfam10328  75 LGLYEISPLTHLL-ISLNRFCAVFFPFKYKKIFSIKNTKIIITIIWIISIIISTLFYFPLGCHFYYSPETLTWS---FDE 150
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636   181 SEHKAFNIIYAS--CLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRghKRHRSM 238
Cdd:pfam10328 151 DPPCAEIGWYGDflKNLVLVIITNIINVITAIKLRKFSKKSALSSEESKKRR--KKEINF 208
7tmA_GnRHR-like cd15195
gonadotropin-releasing hormone and adipokinetic hormone receptors, member of the class A ...
24-301 1.01e-07

gonadotropin-releasing hormone and adipokinetic hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Gonadotropin-releasing hormone (GnRH) and adipokinetic hormone (AKH) receptors share strong sequence homology to each other, suggesting that they have a common evolutionary origin. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Adipokinetic hormone (AKH) is a lipid-mobilizing hormone that is involved in control of insect metabolism. Generally, AKH behaves as a typical stress hormone by mobilizing lipids, carbohydrates and/or certain amino acids such as proline. Thus, it utilizes the body's energy reserves to fight the immediate stress problems and subdue processes that are less important. Although AKH is known to responsible for regulating the energy metabolism during insect flying, it is also found in insects that have lost its functional wings and predominantly walk for their locomotion. Both GnRH and AKH receptors are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320323  Cd Length: 293  Bit Score: 52.40  E-value: 1.01e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  24 FMFStgVLGNVVALILLEMRRRKQpaSLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTF 103
Cdd:cd15195  11 FVIS--AAGNLTVLIQLFRRRRAK--SHIQILIMHLALADLMVTFFNMPMDAVWNYTVEWLAG----DLMCRVMMFLKQF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 104 FSVVTLAILLSMAVERWLSIGHPFFYEKysSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMD-PSASE 182
Cdd:cd15195  83 GMYLSSFMLVVIALDRVFAILSPLSANQ--ARKRVKIMLTVAWVLSALCSIPQSFIFSVLRKMPEQPGFHQCVDfGSAPT 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 183 HKAFNIIYASCLLLM----IVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRGH---KRHRSMTkevehLVLLWFMTIAF 255
Cdd:cd15195 161 KKQERLYYFFTMILSfvipLIITVTCYLLILFEISKMAKRARDTPISNRRRSRTnslERARMRT-----LRMTALIVLTF 235
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|
gi 71834636 256 VFCSLP-LVIQVYH---NTLYHRDRHRNNVIPLLFLSANPIIDPWVFIIL 301
Cdd:cd15195 236 IVCWGPyYVLGLWYwfdKESIKNLPPALSHIMFLLGYLNPCLHPIIYGVF 285
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
23-218 1.17e-07

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098  Cd Length: 259  Bit Score: 52.18  E-value: 1.17e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFSTGVLGNvvALILLEMRRRKQPASLFHVLVSSLVITDLL-GTFSLSPLVLTAYFRNASLlgmneNRLACgHFAYAM 101
Cdd:cd14967   7 SLIILVTVFGN--LLVILAVYRNRRLRTVTNYFIVSLAVADLLvALLVMPFSAVYTLLGYWPF-----GPVLC-RFWIAL 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 102 TFF----SVVTLAIllsMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFidmd 177
Cdd:cd14967  79 DVLcctaSILNLCA---ISLDRYLAITRPLRYRQLMTKKRALIMIAAVWVYSLLISLPPLVGWRDETQPSVVDCEC---- 151
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*.
gi 71834636 178 pSASEHKAFNIIYASC-----LLLMIVCTVLcnasvIYHISRMYRR 218
Cdd:cd14967 152 -EFTPNKIYVLVSSVIsffipLLIMIVLYAR-----IFRVARRELK 191
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
25-302 1.43e-07

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124  Cd Length: 296  Bit Score: 52.22  E-value: 1.43e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  25 MFSTGVLGNV-VALILLEMRRRKQPASLFHVlvsSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTF 103
Cdd:cd14993  10 VFLLALVGNSlVIAVVLRNKHMRTVTNYFLV---NLAVADLLVSLFCMPLTLLENVYRPWVFG----EVLCKAVPYLQGV 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 104 F---SVVTLAillSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLcALFCVTPFL------------GFGKYVQYCP 168
Cdd:cd14993  83 SvsaSVLTLV---AISIDRYLAICYPLKARRVSTKRRARIIIVAIWVI-AIIIMLPLLvvyeleeiissePGTITIYICT 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 169 GTWcfidmdPSASEHKAFNI-----IYASCLLLMIVCTVLcnasviyhISRMYRRLKA--HRSSVRRQRGHKRHRSMTKE 241
Cdd:cd14993 159 EDW------PSPELRKAYNValfvvLYVLPLLIISVAYSL--------IGRRLWRRKPpgDRGSANSTSSRRILRSKKKV 224
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 71834636 242 VEHLVLLwfmTIAFVFCSLPL-VIQVYHNTLYHRDRHRNNVIPLLFLSA------NPIIDPWVFIILS 302
Cdd:cd14993 225 ARMLIVV---VVLFALSWLPYyVLSILLDFGPLSSEESDENFLLILPFAqllgysNSAINPIIYCFMS 289
7tmA_Vasopressin_Oxytocin cd15196
vasopressin and oxytocin receptors, member of the class A family of seven-transmembrane G ...
23-203 3.33e-07

vasopressin and oxytocin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) and oxytocin are synthesized in the hypothalamus and are released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320324  Cd Length: 264  Bit Score: 50.70  E-value: 3.33e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFSTGVLGNvvALILLEMRRRKQPASLFHVLVSSLVITDLL-GTFSLSP-LVLTAYFRnasLLGmneNRLACghfaYA 100
Cdd:cd15196   8 ATILVLALFGN--SCVLLVLYRRRRKLSRMHLFILHLSVADLLvALFNVLPqLIWDITYR---FYG---GDLLC----RL 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 101 MTFFSVVTLA----ILLSMAVERWLSIGHPFFYEKYSSKRCgYITIALIYLLCALFCvTPFLGFGKYVQYCPGTW-CFID 175
Cdd:cd15196  76 VKYLQVVGMYassyVLVATAIDRYIAICHPLSSHRWTSRRV-HLMVAIAWVLSLLLS-IPQLFIFSYQEVGSGVYdCWAT 153
                       170       180
                ....*....|....*....|....*...
gi 71834636 176 MDPSASEhKAFnIIYASCLLLMIVCTVL 203
Cdd:cd15196 154 FEPPWGL-RAY-ITWFTVAVFVVPLIIL 179
7tmA_photoreceptors_insect cd15079
insect photoreceptors R1-R6 and similar proteins, member of the class A family of ...
24-303 3.45e-07

insect photoreceptors R1-R6 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the insect photoreceptors and their closely related proteins. The Drosophila eye is composed of about 800 unit eyes called ommatidia, each of which contains eight photoreceptor cells (R1-R8). The six outer photoreceptors (R1-R6) function like the vertebrate rods and are responsible for motion detection in dim light and image formation. The R1-R6 photoreceptors express a blue-absorbing pigment, Rhodopsin 1(Rh1). The inner photoreceptors (R7 and R8) are considered the equivalent of the color-sensitive vertebrate cone cells, which express a range of different pigments. The R7 photoreceptors express one of two different UV absorbing pigments, either Rh3 or Rh4. Likewise, the R8 photoreceptors express either the blue absorbing pigment Rh5 or green absorbing pigment Rh6. These photoreceptors belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320207  Cd Length: 292  Bit Score: 51.04  E-value: 3.45e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  24 FMFSTGVLGN-VVALILLEMRRRKQPASLFhvlVSSLVITDLLGTFSLSPLVLTAYFRnASLLGmnenRLACGHFAYAMT 102
Cdd:cd15079   9 FLGIVSLLGNgLVIYIFSTTKSLRTPSNML---VVNLAISDFLMMIKMPIFIYNSFYE-GWALG----PLGCQIYAFLGS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 103 FFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCgYITIALIYLLCALFCVTPFL-GFGKYVQYCPGTWCFIDMDPSAS 181
Cdd:cd15079  81 LSGIGSIWTNAAIAYDRYNVIVKPLNGNPLTRGKA-LLLILFIWLYALPWALLPLLfGWGRYVPEGFLTSCSFDYLTRDW 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 182 EHKAFNIIYasclllMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQ---------RGHKRHRSMTKEVE------HLV 246
Cdd:cd15079 160 NTRSFVATI------FVFAYVIPLIIIIYCYSFIVKAVFAHEKALREQakkmnvvslRSNADANKQSAEIRiakvalTNV 233
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 71834636 247 LLWFM------TIAFVFCS------LPLVIQvyhntlyhrdrhrnnvIPLLFLSANPIIDPWVFIILSP 303
Cdd:cd15079 234 FLWFIawtpyaVVALIGAFgnqsllTPLVSM----------------IPALFAKTAACYNPIVYAISHP 286
7tmA_EDG-like cd14972
endothelial differentiation gene family, member of the class A family of seven-transmembrane G ...
34-298 5.23e-07

endothelial differentiation gene family, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents the endothelial differentiation gene (Edg) family of G-protein coupled receptors, melanocortin/ACTH receptors, and cannabinoid receptors as well as their closely related receptors. The Edg GPCRs bind blood borne lysophospholipids including sphingosine-1-phosphate (S1P) and lysophosphatidic acid (LPA), which are involved in the regulation of cell proliferation, survival, migration, invasion, endothelial cell shape change and cytoskeletal remodeling. The Edg receptors are classified into two subfamilies: the lysophosphatidic acid subfamily that includes LPA1 (Edg2), LPA2 (Edg4), and LPA3 (Edg7); and the S1P subfamily that includes S1P1 (Edg1), S1P2 (Edg5), S1P3 (Edg3), S1P4 (Edg6), and S1P5 (Edg8). Melanocortin receptors bind a group of pituitary peptide hormones known as melanocortins, which include adrenocorticotropic hormone (ACTH) and the different isoforms of melanocyte-stimulating hormones. Two types of cannabinoid receptors, CB1 and CB2, are activated by naturally occurring endocannabinoids, cannabis plant-derived cannabinoids such as tetrahydrocannabinol, or synthetic cannabinoids. The CB receptors are involved in the various physiological processes such as appetite, mood, memory, and pain sensation. CB1 receptor is expressed predominantly in central and peripheral neurons, while CB2 receptor is found mainly in the immune system.


Pssm-ID: 320103  Cd Length: 274  Bit Score: 50.38  E-value: 5.23e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  34 VVALILLEMRRRKQpaslFHVLVSSLVITDLL-GTFSLSPLVLTAYFrnASLLGMNENRLACGHFAYAMTffsvVTLAIL 112
Cdd:cd14972  19 VLAAIIKNRQLHKP----MYIFIANLAASDLLaGIAFVFTFLSVLLV--SLTPSPAVWLLRKGSLVLSLL----ASAYSL 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 113 LSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFgkyvqycpgtWCFIDMDPSASehKAFNIIYAS 192
Cdd:cd14972  89 LAITVDRYWSIVHGLTYVNNVTNKRCKVLIALVWVLSVLLALLPVLGW----------NCVLSDQSSCS--PLGPGLPKS 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 193 CLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQ-RGHKRHRSMTKEVEHLVLLwfMTIAFVFCSLPLVIQVYHNTL 271
Cdd:cd14972 157 YLVLILVFFFIALVIIVFLNVRIFWCLWRHANAIAAQeAAVPAQPSTSRKLAKTVVI--ILVVFLVCWLPLFILLVLDVL 234
                       250       260
                ....*....|....*....|....*....
gi 71834636 272 YHRDRHRNNV--IPLLFLSANPIIDPWVF 298
Cdd:cd14972 235 CPSVCDIQVVfyYFLVLALLNSAINPIIY 263
7tmA_NPY1R cd15395
neuropeptide Y receptor type 1, member of the class A family of seven-transmembrane G ...
29-264 5.40e-07

neuropeptide Y receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.


Pssm-ID: 320517  Cd Length: 293  Bit Score: 50.20  E-value: 5.40e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  29 GVLGNVvALILLEMRRrKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFFSVVT 108
Cdd:cd15395  14 GVSGNL-ALIIIILKQ-KEMHNVTNILIVNLSFSDLLMTIMCLPFTFVYTLMDHWVFG----EAMCKLNSMVQCISITVS 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 109 LAILLSMAVERWLSIGHPFFYEkySSKRCGYITIALIYLLcALFCVTPFLGF-----------GKYVQYCPGTWCFIDMD 177
Cdd:cd15395  88 IFSLVLIAIERHQLIINPRGWR--PNNRHAYVGIAVIWVL-AVLTSLPFLIFqvltdepfknvNVSLDAYKGKYVCLDQF 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 178 PSASehkaFNIIYASCLLLMIVCTVLCNASVIYhiSRMYRRLKAHRSSVRRQRGHKRHRSMTKEVEhlVLLWFMTIAFVF 257
Cdd:cd15395 165 PSDT----IRLSYTTCLLVLQYFGPLCFIFICY--LKIYIRLKRRNNMMDKMRDNKYRSSETKRIN--IMLISIVVAFAV 236

                ....*..
gi 71834636 258 CSLPLVI 264
Cdd:cd15395 237 CWLPLNI 243
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
23-264 1.22e-06

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331  Cd Length: 293  Bit Score: 49.14  E-value: 1.22e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFSTGVLGNVvALILLEMRRRKQpASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAM- 101
Cdd:cd15203   8 GLIIVLGVVGNL-LVIYVVLRNKSM-QTVTNIFILNLAVSDLLLCLVSLPFTLIYTLTKNWPFG----SILCKLVPSLQg 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 102 --TFFSVVTLAillSMAVERWLSIGHPFfyEKYSSKRCGYITIALIYLLCALFCV----------TPFLGFGKYVQYCPG 169
Cdd:cd15203  82 vsIFVSTLTLT---AIAIDRYQLIVYPT--RPRMSKRHALLIIALIWILSLLLSLplaifqelsdVPIEILPYCGYFCTE 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 170 TWcfidmdPSASEHKAFNIIyascLLLMIVCTVLCNASVIYhiSRMYRRLkahRSSVRRQRGHKRHRSMTKEVEH----- 244
Cdd:cd15203 157 SW------PSSSSRLIYTIS----VLVLQFVIPLLIISFCY--FRISLKL---RKRVKKKRGKRTLSSRRRRSELrrkrr 221
                       250       260
                ....*....|....*....|.
gi 71834636 245 -LVLLWFMTIAFVFCSLPLVI 264
Cdd:cd15203 222 tNRLLIAMVVVFAVCWLPLNL 242
7tmA_Peropsin cd15073
retinal pigment epithelium-derived rhodopsin homolog, member of the class A family of ...
28-259 1.26e-06

retinal pigment epithelium-derived rhodopsin homolog, member of the class A family of seven-transmembrane G protein-coupled receptors; Peropsin, also known as a retinal pigment epithelium-derived rhodopsin homolog (RRH), is a visual pigment-like protein found exclusively in the apical microvilli of the retinal pigment epithelium. Peropsin belongs to the type 2 opsin family of the class A G-protein coupled receptors. Peropsin presumably plays a physiological role in the retinal pigment epithelium either by detecting light directly or monitoring the levels of retinoids, the primary light absorber in visual perception, or other pigment-related compounds in the eye.


Pssm-ID: 320201  Cd Length: 280  Bit Score: 48.96  E-value: 1.26e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  28 TGVLGNVVAL-ILLEMRRRKQPASLFHVlvsSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFFSV 106
Cdd:cd15073  13 ISTISNGIVLvTFVKFRELRTPTNALII---NLAVTDLGVSIIGYPFSAASDLHGSWKFG----YAGCQWYAFLNIFFGM 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 107 VTLAILLSMAVERWLSIGHPFFYEKYSSKRCGyITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASEHKAF 186
Cdd:cd15073  86 ASIGLLTVVAVDRYLTICRPDLGRKMTTNTYT-VMILLAWTNAFFWAAMPLVGWASYALDPTGATCTINWRKNDSSFVSY 164
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 71834636 187 NIIYaSCLLLMIVCTVLcnASVIYHISRMYRRLKAHRSSVRRQRGHKRHRSMTKEVEHLVLLWFM-----TIAFVFCS 259
Cdd:cd15073 165 TMSV-IVVNFIVPLAVM--FYCYYNVSRFVKKVLASDCLESVNIDWTDQNDVTKMSVIMIVMFLVawspySIVCLWAS 239
7tmA_CysLTR cd15921
cysteinyl leukotriene receptors, member of the class A family of seven-transmembrane G ...
19-298 1.69e-06

cysteinyl leukotriene receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320587  Cd Length: 283  Bit Score: 48.65  E-value: 1.69e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVVALILLEMRRRKQPAslFHVLVSSLVITDLLGTFSLsPLVLTAYFRNASLLGmneNRLACGHFA 98
Cdd:cd15921   4 PTAYILIFILGLTGNSISVYVFLSQYRSQTP--VSVLMVNLAISDLLLVCTL-PLRLTYYVLNSHWPF---GDIACRIIL 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  99 YAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCvTPFLGFGKYVQYCPGTWCF-IDMD 177
Cdd:cd15921  78 YVLYVNMYSSIYFLTALSVFRYLALVWPYLYLRVQTHSVAGIICGLIWILMGLAS-SPLLFAKSKQHDEGSTRCLeLAHD 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 178 PSASEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQrghkrhrsmtkevehLVLLWFMTIAFVF 257
Cdd:cd15921 157 AVDKLLLINYVTLPVGFVVPFMTVIFCYIFIIKNLLKPSPALGRTRPSRRKA---------------CALIIISLGIFLV 221
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|.
gi 71834636 258 CSLPLVIQ-VYHNTLYHRDR---------HRNNVIPLLFLSANPIIDPWVF 298
Cdd:cd15921 222 CFLPYHIVrTIHLITERQIKescgyilrvRKAAVITLCLAASNSCFDPLLY 272
7tmA_ETH-R cd14997
ecdysis-triggering hormone receptors, member of the class A family of seven-transmembrane G ...
23-236 2.79e-06

ecdysis-triggering hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the ecdysis-triggering hormone receptors found in insects, which are members of the class A family of seven-transmembrane G-protein coupled receptors. Ecdysis-triggering hormones are vital regulatory signals that govern the stereotypic physiological sequence leading to cuticle shedding in insects. Thus, the ETH signaling system has been a target for the design of more sophisticated insect-selective pest control strategies. Two subtypes of ecdysis-triggering hormone receptor were identified in Drosophila melanogaster. Blood-borne ecdysis-triggering hormone (ETH) activates the behavioral sequence through direct actions on the central nervous system. In insects, ecdysis is thought to be controlled by the interaction between peptide hormones; in particular between ecdysis-triggering hormone (ETH) from the periphery and eclosion hormone (EH) and crustacean cardioactive peptide (CCAP) from the central nervous system. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320128  Cd Length: 294  Bit Score: 48.06  E-value: 2.79e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFSTGVLGNV-VALILLEMRRRKQPASLFHVlvsSLVITDLLGTFSLSPLVLTAYF-RNASLLGmnENRLACGHFAYA 100
Cdd:cd14997   8 GVIFVVGVLGNVlVGIVVWKNKDMRTPTNIFLV---NLSVADLLVLLVCMPVALVETWaREPWLLG--EFMCKLVPFVEL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 101 MTFF-SVVTLailLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVtPFLGFGKYVQY--CPGTWCFIDMD 177
Cdd:cd14997  83 TVAHaSVLTI---LAISFERYYAICHPLQAKYVCTKRRALVIIALIWLLALLTSS-PVLFITEFKEEdfNDGTPVAVCRT 158
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 178 PSASEHKAFNIIYASCLLLMIVCTVLCnasVIYhiSRMYRRLKAHRSSV-RRQRGHKRHR 236
Cdd:cd14997 159 PADTFWKVAYILSTIVVFFVVPLAILS---GLY--SVICRRLVGHPALEsRRADAANRHT 213
7tmA_Mel1A cd15402
melatonin receptor subtype 1A, member of the class A family of seven-transmembrane G ...
20-262 4.42e-06

melatonin receptor subtype 1A, member of the class A family of seven-transmembrane G protein-coupled receptors; Melatonin (N-acetyl-5-methoxytryptamine) is a naturally occurring sleep-promoting chemical found in vertebrates, invertebrates, bacteria, fungi, and plants. In mammals, melatonin is secreted by the pineal gland and is involved in regulation of circadian rhythms. Its production peaks during the nighttime, and is suppressed by light. Melatonin is shown to be synthesized in other organs and cells of many vertebrates, including the Harderian gland, leukocytes, skin, and the gastrointestinal (GI) tract, which contains several hundred times more melatonin than the pineal gland and is involved in the regulation of GI motility, inflammation, and sensation. Melatonin exerts its pleiotropic physiological effects through specific membrane receptors, named MT1A, MT1B, and MT1C, which belong to the class A rhodopsin-like G-protein coupled receptor family. MT1A and MT1B subtypes are present in mammals, whereas MT1C subtype has been found in amphibians and birds. The melatonin receptors couple to G proteins of the G(i/o) class, leading to the inhibition of adenylate cyclase.


Pssm-ID: 320524  Cd Length: 279  Bit Score: 47.59  E-value: 4.42e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  20 TIPAFMFSTGVLGNVvaLILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNasllGMNENRLACGHFAY 99
Cdd:cd15402   5 CILIFTIVVDILGNL--LVILSVYRNKKLRNAGNIFVVSLAVADLVVAIYPYPLVLTSIFHN----GWNLGYLHCQISGF 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 100 AMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLcALFCVTPFLGFGKyVQYCPGTWCfIDMDPS 179
Cdd:cd15402  79 LMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYSDKNSLCYVLLIWVL-TVAAIVPNLFVGS-LQYDPRIYS-CTFAQS 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 180 ASEHKAFNIIYASCLLLMIVCTvLCNASVIYHISRMYRRLKAHRssvrrqrghkRHRSMTKEVEHLVLLWFMTIAFVFCS 259
Cdd:cd15402 156 VSSAYTIAVVFFHFILPIIIVT-FCYLRIWILVIQVRRRVKPDN----------KPKLKPHDFRNFVTMFVVFVLFAVCW 224

                ...
gi 71834636 260 LPL 262
Cdd:cd15402 225 APL 227
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
20-261 4.46e-06

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 320116  Cd Length: 284  Bit Score: 47.38  E-value: 4.46e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  20 TIPAF---MFSTGVLGNVVALILLEMRRRkqPASLFHVLVSSLVITDLLGTFSLsPLVLTAYfrnASLLGMNENRLACGH 96
Cdd:cd14985   2 VIPAFyiaIFLVGLLGNLFVVWLFLLPRG--PKRVADIFIANLAAADLVFVLTL-PLWATYT---ANQYDWPFGDFLCKV 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  97 FAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLgfGKYVQYCPG---TWCF 173
Cdd:cd14985  76 SSYAITVNMFASVFLLTCMSVDRYLAIVHPVASRRLRRRRQARVTCALIWVVACLLSLPTFL--LRSLQALPDlnkTACI 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 174 idMDPSaseHKAFNIIYAscLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRghKRHRSMTKEVEHLVLlwfmti 253
Cdd:cd14985 154 --ELYP---HEAWHVGLS--LVLNILGFVLPLVIILTCYCHIARTLRTHYERTGKGG--RKRRKSLKIIFAVVV------ 218

                ....*...
gi 71834636 254 AFVFCSLP 261
Cdd:cd14985 219 AFLVCWLP 226
7tmA_Glycoprotein_LRR_R-like cd14980
glycoprotein hormone receptors and leucine-rich repeats containing G protein-coupled receptors, ...
30-240 7.19e-06

glycoprotein hormone receptors and leucine-rich repeats containing G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes the glycoprotein hormone receptors (GPHRs), vertebrate receptors containing 17 leucine-rich repeats (LGR4-6), and the relaxin family peptide receptors (also known as LGR7 and LGR8). They are seven transmembrane domain receptors with a very large extracellular N-terminal domain containing many leucine-rich repeats responsible for hormone recognition and binding. The glycoprotein hormone receptor family contains receptors for the pituitary hormones, thyrotropin (thyroid-stimulating hormone receptor), follitropin (follicle-stimulating hormone receptor), and lutropin (luteinizing hormone receptor). Glycoprotein hormone receptors couple primarily to the G(s)-protein and promotes cAMP production, but also to the G(i)- or G(q)-protein. Two orphan GPCRs, LGR7 and LGR8, have been recently identified as receptors for the relaxin peptide hormones.


Pssm-ID: 320111  Cd Length: 286  Bit Score: 46.85  E-value: 7.19e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  30 VLGNVVALILLeMRRRKQPASLFHVLVSSLVITDLLGTFSLSPL--VLTAYFRNASLLGMNENRLACGHFA-YAMTFFSV 106
Cdd:cd14980  15 LIGNILVIIWH-ISSKKKKKKVPKLLIINLAIADFLMGIYLLIIaiADQYYRGRYAQYSEEWLRSPPCLLAcFLVSLSSL 93
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 107 VTLAILLSMAVERWLSIGHPFFYEKYsSKRCGYITIALIYLLCALFCVTPFL-GFGKYVQYCPGTWCFIDMdPSASEhka 185
Cdd:cd14980  94 MSVLMMLLITLDRYICIVYPFSNKRL-SYKSAKIILILGWLFSIIFAAIPILySINQPGDNRLYGYSSICM-PSNVS--- 168
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*
gi 71834636 186 fNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQrGHKRHRSMTK 240
Cdd:cd14980 169 -NPYYRGWLIAYLLLTFIAWIIICILYILIFISVRKSRKSARRS-SSKRDKRIAI 221
7tmA_KiSS1R cd15095
KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of ...
19-301 8.26e-06

KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled KiSS1-derived peptide receptor (GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (previously known as metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. The KiSS1 receptor is coupled to G proteins of the G(q/11) family, which lead to activation of phospholipase C and increase of intracellular calcium. This signaling cascade plays an important role in reproduction by regulating the secretion of gonadotropin-releasing hormone.


Pssm-ID: 320223  Cd Length: 288  Bit Score: 46.51  E-value: 8.26e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNvvALILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFA 98
Cdd:cd15095   4 PLIFAIIFLVGLAGN--SLVIYVVSRHREMRTVTNYYIVNLAVTDLAFLVCCVPFTAALYATPSWVFG----DFMCKFVN 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  99 YAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFC--VTPFLGFGKYVQYCPGTWCfIDM 176
Cdd:cd15095  78 YMMQVTVQATCLTLTALSVDRYYAIVHPIRSLRFRTPRVAVVVSACIWIVSFLLSipVAIYYRLEEGYWYGPQTYC-REV 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 177 DPSASEHKAFNIIYA-SCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRGHKRhRSMTKEVEHLVLLwfmtiaF 255
Cdd:cd15095 157 WPSKAFQKAYMIYTVlLTYVIPLAIIAVCYGLILRRLWRRSVDGNNQSEQLSERALRQK-RKVTRMVIVVVVL------F 229
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....
gi 71834636 256 VFCSLPlvIQVYhNTLYHRDRHRNNVIPL-------LFLS-ANPIIDPWVFIIL 301
Cdd:cd15095 230 AICWLP--NHVL-NLWQRFDPNFPETYATyalkiaaLCLSyANSAVNPFVYAFM 280
7tmA_Gal1_R cd15098
galanin receptor subtype 1, member of the class A family of seven-transmembrane G ...
19-261 1.03e-05

galanin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320226  Cd Length: 282  Bit Score: 46.26  E-value: 1.03e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVVALILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMnenrLACGHFA 98
Cdd:cd15098   4 PVVFGLIFCLGVLGNSLVITVLARVKPGKRRSTTNVFILNLSIADLFFLLFCVPFQATIYSLPEWVFGA----FMCKFVH 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  99 YAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLcALFCVTPFLGFGKYVQYCPGTW---CFID 175
Cdd:cd15098  80 YFFTVSMLVSIFTLVAMSVDRYIAVVHSRTSSSLRTRRNALLGVLVIWVL-SLAMASPVAVHQDLVHHWTASNqtfCWEN 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 176 MDPSASEH--KAFNIIYASCLLLMIVCtvLCNASVIYHisrMYRRLKahrssvrrqRGHKRHRSMTKEVEHLVLLwfMTI 253
Cdd:cd15098 159 WPEKQQKPvyVVCTFVFGYLLPLLLIT--FCYAKVLNH---LHKKLK---------NMSKKSERSKKKTAQTVLV--VVV 222

                ....*...
gi 71834636 254 AFVFCSLP 261
Cdd:cd15098 223 VFGISWLP 230
7tmA_5-HT1A_vertebrates cd15330
serotonin receptor subtype 1A from vertebrates, member of the class A family of ...
25-199 1.81e-05

serotonin receptor subtype 1A from vertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320453  Cd Length: 260  Bit Score: 45.35  E-value: 1.81e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  25 MFSTGVLGNVVALILLEMRRRKQpaSLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFF 104
Cdd:cd15330  10 LILCAIFGNACVVAAIALERSLQ--NVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLG----QVTCDLFIALDVLC 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 105 SVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASEHK 184
Cdd:cd15330  84 CTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISLTWLIGFSISIPPMLGWRTPEDRSDPDACTISKDPGYTIYS 163
                       170
                ....*....|....*
gi 71834636 185 AFNIIYASCLLLMIV 199
Cdd:cd15330 164 TFGAFYIPLILMLVL 178
7tmA_GPR25 cd15193
G protein-coupled receptor 25, member of the class A family of seven-transmembrane G ...
19-249 2.15e-05

G protein-coupled receptor 25, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR25 is an orphan G-protein coupled receptor that shares strong sequence homology to GPR15 and the angiotensin II receptors. These closely related receptors form a group within the class A G-protein coupled receptors (GPCRs). GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation. Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors.


Pssm-ID: 320321  Cd Length: 279  Bit Score: 45.13  E-value: 2.15e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVVALILLEMRRR-KQPASLFhvlVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRLAcgHF 97
Cdd:cd15193   4 PILYLIIFFTGLLGNLFVIALMSKRSTtKRLVDTF---VLNLAVADLVFVLTLPFWAASTALGGQWLFGEGLCKLS--SF 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  98 AYAMTFFSVVTLaiLLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLcALFCVTPFLGFGKYVQycpGTWCFIDMD 177
Cdd:cd15193  79 IIAVNRCSSILF--LTGMSVDRYLAVVKLLDSRPLRTRRCALITCCIIWAV-SLVLGIPSLVYRNLIN---ESVCVEDSS 152
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 71834636 178 PSASEHKAFNIIYASCLLLMIVcTVLCnasviyhISRMYRRLKAHRSSVRR--QRGHKRHRSMTKEVEHLVLLW 249
Cdd:cd15193 153 SRFFQGISLATLFLTFVLPLIV-ILFC-------YCSILVRLRRHFHGAKRtgRRRRNSLRIVFAIVTAFVLSW 218
7tmA_GPR84-like cd15210
G protein-coupled receptor 84 and similar proteins, member of the class A family of ...
23-160 2.42e-05

G protein-coupled receptor 84 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR84, also known as the inflammation-related G-Protein coupled receptor EX33, is a receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Among these medium-chain FFAs, capric acid (C10:0), undecanoic acid (C11:0), and lauric acid (C12:0) are the most potent endogenous agonists of GPR84, whereas short-chain and long-chain saturated and unsaturated FFAs do not activate this receptor. GPR84 contains a [G/N]RY-motif instead of the highly conserved Asp-Arg-Tyr (DRY) motif found in the third transmembrane helix (TM3) of the rhodopsin-like class A receptors and important for efficient G protein-coupled signal transduction. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, which then activate the heterotrimeric G proteins. In the case of GPR84, activation of the receptor couples to a pertussis toxin sensitive G(i/o)-protein pathway. GPR84 knockout mice showed increased Th2 cytokine production including IL-4, IL-5, and IL-13 compared to wild-type mice. It has been also shown that activation of GPR84 augments lipopolysaccharide-stimulated IL-8 production in polymorphonuclear leukocytes and TNF-alpha production in macrophages, suggesting that GPR84 may function as a proinflammatory receptor.


Pssm-ID: 320338  Cd Length: 254  Bit Score: 44.95  E-value: 2.42e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFsTGVLGN---VVALILLEMRRrkqpaSLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAy 99
Cdd:cd15210   9 VFMV-VGVPGNlltVLALLRSKKLR-----TRTNAFIINLSISDLLFCAFNLPLAASTFLHQAWIHG----ETLCRVFP- 77
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 71834636 100 AMTFFSV-VTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGF 160
Cdd:cd15210  78 LLRYGLVaVSLLTLVLITLNRYILIAHPSLYPRIYTRRGLALMIAGTWIFSFGSFLPLWLGI 139
7tmA_D1-like_dopamine_R cd15057
D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G ...
30-264 2.44e-05

D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. In contrast, activation of D2-like family receptors is linked to G proteins of the G(i) family, which inhibit adenylate cyclase. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320185  Cd Length: 299  Bit Score: 45.11  E-value: 2.44e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  30 VLGNVVaLILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenrlacghfAYAMTFfsvVTL 109
Cdd:cd15057  15 LLGNAL-VIAAVLRFRHLRSKVTNYFIVSLAVSDLLVAILVMPWAAVNEVAGYWPFG-----------SFCDVW---VSF 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 110 AILLSMA---------VERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPfLGFGKYVQYCPGTWCFIDMDPSA 180
Cdd:cd15057  80 DIMCSTAsilnlcvisVDRYWAISSPFRYERRMTRRRAFIMIAVAWTLSALISFIP-VQLGWHRADDTSEALALYADPCQ 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 181 SEHKAfNIIYA---SCLLLMI-VCTVLCNASVIYHISR-MYRRLKAHRSSVRRQRGHKRHR--SMTKEVEHLVLLWFMTI 253
Cdd:cd15057 159 CDSSL-NRTYAissSLISFYIpVAIMIVTYTRIYRIARrQIRRIAALERAAQESTNPDSSLrsSLRRETKALKTLSIIMG 237
                       250
                ....*....|.
gi 71834636 254 AFVFCSLPLVI 264
Cdd:cd15057 238 VFVCCWLPFFI 248
7tmA_UII-R cd14999
urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled ...
19-302 2.52e-05

urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The urotensin-II receptor (UII-R, also known as the hypocretin receptor) is a member of the class A rhodopsin-like G-protein coupled receptors, which binds the peptide hormone urotensin-II. Urotensin II (UII) is a vasoactive somatostatin-like or cortistatin-like peptide hormone. However, despite the apparent structural similarity to these peptide hormones, they are not homologous to UII. Urotensin II was first identified in fish spinal cord, but later found in humans and other mammals. In fish, UII is secreted at the back part of the spinal cord, in a neurosecretory centre called uroneurapophysa, and is involved in the regulation of the renal and cardiovascular systems. In mammals, urotensin II is the most potent mammalian vasoconstrictor identified to date and causes contraction of arterial blood vessels, including the thoracic aorta. The urotensin II receptor is a rhodopsin-like G-protein coupled receptor, which binds urotensin-II. The receptor was previously known as GPR14, or sensory epithelial neuropeptide-like receptor (SENR). The UII receptor is expressed in the CNS (cerebellum and spinal cord), skeletal muscle, pancreas, heart, endothelium and vascular smooth muscle. It is involved in the pathophysiological control of cardiovascular function and may also influence CNS and endocrine functions. Binding of urotensin II to the receptor leads to activation of phospholipase C, through coupling to G(q/11) family proteins. The resulting increase in intracellular calcium may cause the contraction of vascular smooth muscle.


Pssm-ID: 320130  Cd Length: 282  Bit Score: 45.12  E-value: 2.52e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVVALILleMRRRKQPASLFHVLVSSLVITDLLgTFSLSPLVLTAYFRNASLLGMNENRLACGHFA 98
Cdd:cd14999   3 GTVLSLMCVVGVAGNVYTLVV--MCLSMRPRASMYVYILNLALADLL-YLLTIPFYVSTYFLKKWYFGDVGCRLLFSLDF 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  99 YAMtFFSVVTLAIllsMAVERWLSIGHPFFYEKYS--SKRCgyitIALIYLLCALFCVTPFLGFGKYVQYCP----GTWC 172
Cdd:cd14999  80 LTM-HASIFTLTV---MSTERYLAVVKPLDTVKRSksYRKL----LAGVIWLLSLLLTLPMAIMIRLVTVEDksggSKRI 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 173 FIDMdPSASEHKAFniiyascLLLMIVCTVLCNASViyhISRMYRRL-KAHRSSVRRQRGHKRHRSMTKEVEHLVLLwfM 251
Cdd:cd14999 152 CLPT-WSEESYKVY-------LTLLFSTSIVIPGLV---IGYLYIRLaRKYWLSQAAASNSSRKRLPKQKVLKMIFT--I 218
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 71834636 252 TIAFVFCSLPL----VIQVYHNTLYHRDRHRNNVIPLL--FLSANPIIDPWVFIILS 302
Cdd:cd14999 219 VLVFWACFLPFwiwqLLYLYSPSLSLSPRTTTYVNYLLtcLTYSNSCINPFLYTLLT 275
7tmA_PAR4 cd15372
protease-activated receptor 4, member of the class A family of seven-transmembrane G ...
19-158 3.07e-05

protease-activated receptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; Protease-acted receptors (PARs) are seven-transmembrane proteins that belong to the class A G-protein coupled receptor (GPCR) family. Four different types of the protease-activated receptors have been identified: PAR1, PAR2, PAR3, and PAR4. PARs are predominantly expressed in platelets and are activated by serine proteases such as thrombin, trypsin, and tryptase. These proteases cleave the extracellular domain of the receptor to form a new N-terminus, which in turn functions as a tethered ligand. The newly-formed tethered ligand binds intramolecularly to activate the receptor and triggers G-protein binding and intracellular signaling. PAR1, PA3, and PAR4 are activated by thrombin, whereas PAR2 is activated by trypsin. The PARs are known to couple with several G-proteins including Gi (cAMP inhibitory), G12/13 (Rho and Ras activation), and Gq (calcium signaling) to activate downstream signaling messengers which induces numerous cellular and physiological effects.


Pssm-ID: 320494  Cd Length: 274  Bit Score: 44.74  E-value: 3.07e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVVALILLEMRRRKQPASLFHVlvsSLVITDLLGTFSLsPLVLTAYFR-NASLLGMNENRLACGHF 97
Cdd:cd15372   4 PSLYTLVFLVGLPANGLALWVLATQVKRLPSTIFLI---NLAVADLLLILVL-PFKISYHFLgNNWPFGEGLCRVVTAFF 79
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 71834636  98 aYAMTFFSVVTLAillSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYlLCALFCVTPFL 158
Cdd:cd15372  80 -YGNMYCSVLLLM---CISLDRYLAVVHPFFARTLRSRRFALCMCTAIW-LIAAALTLPLT 135
7tmA_CCK_R cd15206
cholecystokinin receptors, member of the class A family of seven-transmembrane G ...
23-210 3.15e-05

cholecystokinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cholecystokinin receptors (CCK-AR and CCK-BR) are a group of G-protein coupled receptors which bind the peptide hormones cholecystokinin (CCK) or gastrin. CCK, which facilitates digestion in the small intestine, and gastrin, a major regulator of gastric acid secretion, are highly similar peptides. Like gastrin, CCK is a naturally-occurring linear peptide that is synthesized as a preprohormone, then proteolytically cleaved to form a family of peptides with the common C-terminal sequence (Gly-Trp-Met-Asp-Phe-NH2), which is required for full biological activity. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors.


Pssm-ID: 320334  Cd Length: 269  Bit Score: 44.69  E-value: 3.15e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFSTGVLGNVVALILLEMRRRKQpaSLFHVLVSSLVITDLLGT-----FSLSPLVLTAYFRNASLlgmnenrlaCGHF 97
Cdd:cd15206   8 SVIFLLAVVGNILVIVTLVQNKRMR--TVTNVFLLNLAVSDLLLAvfcmpFTLVGQLLRNFIFGEVM---------CKLI 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  98 AYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCaLFCVTPFLGFGKYVQYCPGTWCFIDMD 177
Cdd:cd15206  77 PYFQAVSVSVSTFTLVAISLERYFAICHPLKSRVWQTLSHAYKVIAGIWLLS-FLIMSPILVFSNLIPMSRPGGHKCREV 155
                       170       180       190
                ....*....|....*....|....*....|....
gi 71834636 178 -PSASEHKAFNIIyascLLLMIVCTVLCNASVIY 210
Cdd:cd15206 156 wPNEIAEQAWYVF----LDLMLLVIPGLVMSVAY 185
7tmA_GPR101 cd15215
orphan G protein-coupled receptor 101, member of the class A family of seven-transmembrane G ...
28-223 4.86e-05

orphan G protein-coupled receptor 101, member of the class A family of seven-transmembrane G protein-coupled receptors; Gpr101, an orphan GPCR, is predominantly expressed in the brain within discrete nuclei and is predicted to couple to the stimulatory G(s) protein, a potent activator of adenylate cyclase. GPR101 has been implicated in mediating the actions of GnRH-(1-5), a pentapeptide formed by metallopeptidase cleavage of the decapeptide gonadotropin-releasing hormone (GnRH), which plays a critical role in the regulation of the hypothalamic-pituitary-gonadal axis. GnRH-(1-5) acts on GPR101 to stimulate epidermal growth factor (EFG) release and EFG-receptor (EGFR) phosphorylation, leading to enhanced cell migration and invasion in the Ishikawa endometrial cancer cell line. Furthermore, these effects of GnRH-(1-5) are also dependent on enzymatic activation of matrix metallopeptidase-9 (MMP-9). GPR101 is a member of the class A family of GPCRs, which includes receptors for hormones, neurotransmitters, sensory stimuli, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320343  Cd Length: 261  Bit Score: 44.06  E-value: 4.86e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  28 TGVLGNVVALILLEmrRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAyfrNASLLGMNENRLaCGHFAYAMTFFSVV 107
Cdd:cd15215  12 ASLFGNIVLLLVFQ--RKPQLLQVANRFIFNLLVADLLQTVLVMPWVIAT---SVPLFWPLDSHL-CTALVVLMHLFAFA 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 108 TLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYV-----QYCPGTWcfidmdpsaSE 182
Cdd:cd15215  86 GVNTIVVVSVDRYLAIIHPLSYPTKMTPRRGYLLIYGTWIVSVLQSTPPLYGWGQAAfdernALCSVIW---------GS 156
                       170       180       190       200
                ....*....|....*....|....*....|....*....|.
gi 71834636 183 HKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHR 223
Cdd:cd15215 157 SYSYTILSVVSSFVLPVIIMLACYSMVFRAARRCYHCKAAK 197
7tmA_SWS1_opsin cd15076
short wave-sensitive 1 opsins, member of the class A family of seven-transmembrane G ...
24-293 5.83e-05

short wave-sensitive 1 opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Short Wave-Sensitive opsin 1 (SWS1), which mediates visual transduction in response to light at short wavelengths (ultraviolet to blue). Vertebrate cone opsins are expressed in cone photoreceptor cells of the retina and involved in mediating photopic vision, which allows color perception. The cone opsins can be classified into four classes according to their peak absorption wavelengths: SWS1 (ultraviolet sensitive), SWS2 (short wave-sensitive), MWS/LWS (medium/long wave-sensitive), and RH2 (medium wave-sensitive, rhodopsin-like opsins). Members of this group belong to the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320204  Cd Length: 280  Bit Score: 44.04  E-value: 5.83e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  24 FMFSTGV-LGNVVALILLEMRRRKQPasLFHVLVSSLVITDLLGTFSLSPlVLTAYFRNASLLGmnenRLACGHFAYAMT 102
Cdd:cd15076   9 FVFIVGTpLNAIVLFVTIKYKKLRQP--LNYILVNISLAGFIFCIFSVFP-VFVASAQGYFFFG----RTVCALEAFVGS 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 103 FFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRcGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASE 182
Cdd:cd15076  82 LAGLVTGWSLAFLAFERYIVICKPFGNFRFGSKH-ALGAVVATWIIGIGVSLPPFFGWSRYIPEGLQCSCGPDWYTVGTK 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 183 HKAFNIIYasclLLMIVCTVLCNASVIYHISRMyrrLKAHRSSVRRQRGHKRHRSMTKEVEHLVLlwFMTIAFVFCSLPL 262
Cdd:cd15076 161 YRSEYYTW----FLFIFCFIVPLSIIIFSYSQL---LGALRAVAAQQQESASTQKAEREVSRMVV--VMVGSFCLCYVPY 231
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 71834636 263 -VIQVYH-NTLYHRDRHRNNVIPLLFLSA----NPII 293
Cdd:cd15076 232 aALAMYMvNNRDHGLDLRLVTIPAFFSKSscvyNPII 268
7tmA_Vasopressin-like cd14986
vasopressin receptors and its related G protein-coupled receptors, member of the class A ...
25-302 6.64e-05

vasopressin receptors and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this group form a subfamily within the class A G-protein coupled receptors (GPCRs), which includes the vasopressin and oxytocin receptors, the gonadotropin-releasing hormone receptors (GnRHRs), the neuropeptide S receptor (NPSR), and orphan GPR150. These receptors share significant sequence homology with each other, suggesting that they have a common evolutionary origin. Vasopressin, also known as arginine vasopressin or anti-diuretic hormone, is a neuropeptide synthesized in the hypothalamus. The actions of vasopressin are mediated by the interaction of this hormone with three tissue-specific subtypes: V1AR, V1BR, and V2R. Although vasopressin differs from oxytocin by only two amino acids, they have divergent physiological functions. Vasopressin is involved in regulating osmotic and cardiovascular homeostasis, whereas oxytocin plays an important role in the uterus during childbirth and in lactation. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Neuropeptide S (NPS) promotes arousal and anxiolytic-like effects by activating its cognate receptor NPSR. NPSR has also been associated with asthma and allergy. GPR150 is an orphan receptor closely related to the oxytocin and vasopressin receptors.


Pssm-ID: 320117  Cd Length: 295  Bit Score: 43.90  E-value: 6.64e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  25 MFSTGVLGNvvALILLEMRRRKQPASLFHVLVSSLVITDLLGTF--SLSPLVLTAYFRnaSLLGMNENRLacghfayaMT 102
Cdd:cd14986  10 LFVFTLVGN--GLVILVLRRKRKKRSRVNIFILNLAIADLVVAFftVLTQIIWEATGE--WVAGDVLCRI--------VK 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 103 FFSVVTLA----ILLSMAVERWLSIGHPFFYEKysSKRCGYITIALIYLLCALFCVTPFLGFGKyVQYCPGTWCFIDMDP 178
Cdd:cd14986  78 YLQVVGLFastyILVSMSLDRYQAIVKPMSSLK--PRKRARLMIVVAWVLSFLFSIPQLVIFVE-RELGDGVHQCWSSFY 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 179 SASEHKAFNIIYA-----------SCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRGHKRHRSMTKEVEhlvl 247
Cdd:cd14986 155 TPWQRKVYITWLAtyvfvipliilSYCYGRILRTIWIRSRQKTDRPIAPTAMSCRSVSCVSSRVSLISRAKIKTIK---- 230
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 71834636 248 lwfMTI----AFVFCSLP-LVIQVYHN-TLYHRDRHRNNVIPLLFLSANPIIDPWVFIILS 302
Cdd:cd14986 231 ---MTLviilAFILCWTPyFIVQLLDVyAGMQQLENDAYVVSETLASLNSALNPLIYGFFS 288
7tmA_NTSR-like cd14979
neurotensin receptors and related G protein-coupled receptors, member of the class A family of ...
24-265 6.83e-05

neurotensin receptors and related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes the neurotensin receptors and related G-protein coupled receptors, including neuromedin U receptors, growth hormone secretagogue receptor, motilin receptor, the putative GPR39 and the capa receptors from insects. These receptors all bind peptide hormones with diverse physiological effects. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320110  Cd Length: 300  Bit Score: 43.88  E-value: 6.83e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  24 FMFSTGVLGNVVALILLEMRRRKQPASLFHVLvsSLVITDLLGTFSLSPLVLTAYFRNAS-LLGMnenrLACGHFAYAMT 102
Cdd:cd14979   9 AIFVVGIVGNLLTCIVIARHKSLRTTTNYYLF--SLAVSDLLILLVGLPVELYNFWWQYPwAFGD----GGCKLYYFLFE 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 103 FFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGkyVQY----CPGTWCFIDMDP 178
Cdd:cd14979  83 ACTYATVLTIVALSVERYVAICHPLKAKTLVTKRRVKRFILAIWLVSILCAIPILFLMG--IQYlngpLPGPVPDSAVCT 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 179 SASEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRGHKRHRSMTKEVEHLV--LLWFMTIAFV 256
Cdd:cd14979 161 LVVDRSTFKYVFQVSTFIFFVLPMFVISILYFRIGVKLRSMRNIKKGTRAQGTRNVELSLSQQARRQVvkMLGAVVIAFF 240

                ....*....
gi 71834636 257 FCSLPLVIQ 265
Cdd:cd14979 241 VCWLPFHAQ 249
7tmA_GPR35_55-like cd15923
G protein-coupled receptor 35, GPR55, and similar proteins, member of the class A family of ...
21-262 8.78e-05

G protein-coupled receptor 35, GPR55, and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily is composed of GPR35, GPR55, and similar proteins. GPR35 shares closest homology with GPR55, and they belong to the class A G protein-coupled receptor superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A number of studies have suggested that GPR35 may play important physiological roles in hypertension, atherosclerosis, nociception, asthma, glucose homeostasis and diabetes, and inflammatory bowel disease. GPR35 is thought to be responsible for brachydactyly mental retardation syndrome, which is associated with a deletion comprising chromosome 2q37 in human, and is also implicated as a potential oncogene in stomach cancer. GPR35 couples to G(13) and G(i/o) proteins, whereas GPR55 has been reported to couple to G(13), G(12), or G(q) proteins. Activation of GPR55 leads to activation of phospholipase C, RhoA, ROCK, ERK, p38MAPK, and calcium release. Recently, lysophophatidylinositol (LPI) has been identified as an endogenous ligand for GPR55, while several endogenous ligands for GPR35 have been identified including kynurenic acid, 2-oleoyl lysophosphatidic acid, and zaprinast.


Pssm-ID: 320589  Cd Length: 273  Bit Score: 43.21  E-value: 8.78e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  21 IPAFMFstGVLGNVVALILLEMRRRKQPASlfHVLVSSLVITDLLGTFSLsPLVLTAYFRNASLLGMNENRLACGHFAYA 100
Cdd:cd15923   8 IPTFVL--GLLLNILALWVFCWRLKKWTET--NIYMTNLAVADLLLLISL-PFKMHSYRRESAGLQKLCNFVLSLYYINM 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 101 MTFFSVVTlaillSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYvqycPGTWCFIDMDPSA 180
Cdd:cd15923  83 YVSIFTIT-----AISVDRYVAIRYPLRARELRSPRKAAVVCAVIWVLVVTISIPYFLLDSSN----EKTMCFQRTKQTE 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 181 SEHKAFNIIYASCLLLMIVcTVLCNASVIYhisrmyrrlkahrsSVRRQRGHKRHRSMTKEVEHLVllWFMTIAFVFCSL 260
Cdd:cd15923 154 SLKVFLLLEIFGFLLPLII-MTFCSARVIH--------------TLQKRLDDVGSRSETKQCIRVI--MANLIVFIVCFL 216

                ..
gi 71834636 261 PL 262
Cdd:cd15923 217 PV 218
7tmA_NPY4R cd15397
neuropeptide Y receptor type 4, member of the class A family of seven-transmembrane G ...
29-262 1.06e-04

neuropeptide Y receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety.


Pssm-ID: 320519  Cd Length: 293  Bit Score: 43.19  E-value: 1.06e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  29 GVLGNVvaLILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFFSVVT 108
Cdd:cd15397  14 GLLGNI--CLICVIARQKEKTNVTNILIANLSFSDILVCLVCLPFTVVYTLMDYWIFG----EVLCKMTPFIQCMSVTVS 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 109 LAILLSMAVERWLSIGHPFFYEkySSKRCGYITIALIYLLcALFCVTPFLGF---------GKYVQYCPGTWCFIDMDPS 179
Cdd:cd15397  88 ILSLVLIALERHQLIINPTGWK--PSVSQAYLAVVVIWML-ACFISLPFLAFhiltdepykNLSHFFAPLADKAVCTESW 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 180 ASEHKAFniIYASCLLLMIVCTVLCNASVIYhiSRMYRRLKAHRSSVRRQRGHKRHRSMTKEVEhlVLLWFMTIAFVFCS 259
Cdd:cd15397 165 PSEHHKL--AYTTWLLLFQYCLPLLFILVCY--LRIYLRLRRRKDMLERRGEYNRRAGHSKRIN--VMLVSLVAAFALCW 238

                ...
gi 71834636 260 LPL 262
Cdd:cd15397 239 LPL 241
7tmA_Galanin_R-like cd14971
galanin receptor and related proteins, member of the class A family of seven-transmembrane G ...
19-268 1.07e-04

galanin receptor and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled galanin receptors, kisspeptin receptor and allatostatin-A receptor (AstA-R) in insects. These receptors, which are members of the class A of seven transmembrane GPCRs, share a high degree of sequence homology among themselves. The galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, eating disorders, and epilepsy, among many others. KiSS1-derived peptide receptor (also known as GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. AstA-R is a G-protein coupled receptor that binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320102  Cd Length: 281  Bit Score: 43.22  E-value: 1.07e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNvvALILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFA 98
Cdd:cd14971   4 PLFFALIFLLGLVGN--SLVILVVARNKPMRSTTNLFILNLAVADLTFLLFCVPFTATIYPLPGWVFG----DFMCKFVH 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  99 YAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVtPFLGFGKYVQYCPGTWCFIDMDP 178
Cdd:cd14971  78 YFQQVSMHASIFTLVAMSLDRFLAVVYPLRSLHIRTPRNALAASGCIWVVSLAVAA-PVLALHRLRNYTPGNRTVCSEAW 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 179 SASEHKAfniIYASCLLLMIVCTVLCNASVIYhiSRMYRRLkahRSSVRRQRGHKRHRSMTKEVEHLVLLwfmtIAFVFC 258
Cdd:cd14971 157 PSRAHRR---AFALCTFLFGYLLPLLLICVCY--AAMLRHL---WRVAVRPVLSEGSRRAKRKVTRLVLV----VVVLFA 224
                       250
                ....*....|
gi 71834636 259 SLPLVIQVYH 268
Cdd:cd14971 225 ACWGPIHAIL 234
7tmA_TACR cd15390
neurokinin receptors (or tachykinin receptors), member of the class A family of ...
97-273 1.13e-04

neurokinin receptors (or tachykinin receptors), member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents G-protein coupled receptors for a variety of neuropeptides of the tachykinin (TK) family. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320512  Cd Length: 289  Bit Score: 43.05  E-value: 1.13e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  97 FAYAMTFFSVVTLAI----LLSMAVERWLSIGHPFfyEKYSSKRCGYITIALIYLLCALFCVtPFLGFGK---YVQYCPG 169
Cdd:cd15390  72 YCKFSNFVAITTVAAsvftLMAISIDRYIAIVHPL--RPRLSRRTTKIAIAVIWLASFLLAL-PQLLYSTtetYYYYTGS 148
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 170 TW--CFIDMDPSASehKAFNIIYASCLLLMIVCTVLCNASVIYhiSRMYRRLKAHRSSVRR-QRGHKRHRSMTKEVEHLV 246
Cdd:cd15390 149 ERtvCFIAWPDGPN--SLQDFVYNIVLFVVTYFLPLIIMAVAY--TRVGVELWGSKTIGENtPRQLESVRAKRKVVKMMI 224
                       170       180
                ....*....|....*....|....*..
gi 71834636 247 LlwfMTIAFVFCSLPLviQVYHNTLYH 273
Cdd:cd15390 225 V---VVVIFAICWLPY--HLYFILTYL 246
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
20-302 1.25e-04

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101  Cd Length: 282  Bit Score: 43.05  E-value: 1.25e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  20 TIPAF---MFSTGVLGNV-VALILLEMRRRKQPAslfHVLVSSLVITDLLGTFSLsPLVLTAYFRNASLLGMNENRLACG 95
Cdd:cd14970   2 VIPAVysvVCVVGLTGNSlVIYVILRYSKMKTVT---NIYILNLAVADELFLLGL-PFLATSYLLGYWPFGEVMCKIVLS 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  96 HFAYAMtFFSVVTLAIllsMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLcALFCVTPFLGFGKYVQYCPGTW-CFI 174
Cdd:cd14970  78 VDAYNM-FTSIFCLTV---MSVDRYLAVVHPVKSLRFRTPRKAKLVSLCVWAL-SLVLGLPVIIFARTLQEEGGTIsCNL 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 175 DM-DPSASEHKAFnIIYASCLLLMIVCTVLCnasVIYhiSRMYRRLKahRSSVRRQRGHKRHRSMTKEVEHLVLLwfMTI 253
Cdd:cd14970 153 QWpDPPDYWGRVF-TIYTFVLGFAVPLLVIT---VCY--SLIIRRLR--SSRNLSTSGAREKRRARRKVTRLVLV--VVA 222
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*
gi 71834636 254 AFVFCSLPlvIQVYHNTLYHRDRHRNNVIPLLFLS------ANPIIDPWVFIILS 302
Cdd:cd14970 223 VFVVCWLP--FHVFQIVRLLIDPPETLTVVGVFLFcialsyANSCLNPILYAFLD 275
7tmA_OR51_52-like cd15917
olfactory receptor family 51, 52, 56 and related proteins, member of the class A family of ...
20-167 1.45e-04

olfactory receptor family 51, 52, 56 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor families 51, 52, 56, and related proteins in other mammals, sauropsids, amphibians, and fishes. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320583  Cd Length: 275  Bit Score: 42.67  E-value: 1.45e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  20 TIP-AFMFSTGVLGNVVALILLEMRR-RKQPASLFhvlVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNenrlACGHF 97
Cdd:cd15917   4 SIPfCAMYLVALVGNITILFVIKIESsLHEPMYLF---LAMLAATDLGLSTSTVPKMLGIFWFNAREISFD----ACLAQ 76
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  98 AYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCgYITIALIYLLCALFCVTPFLGFGKYVQYC 167
Cdd:cd15917  77 MFFIHAFTAMESGVLLAMAFDRYVAICYPLRYTTILTNTV-VGKIGLAILLRAVLLIIPLPLLVRRLPYC 145
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
19-261 1.54e-04

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320115  Cd Length: 278  Bit Score: 42.59  E-value: 1.54e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVvaLILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLsPLvLTAYFRNASLLGMNENRLACGhfA 98
Cdd:cd14984   4 PVLYSLVFVLGLVGNS--LVLLVLLYYKKLRSMTDVYLLNLALSDLLFVLTL-PF-WAVYAAHGWVFGSFLCKLVSA--L 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  99 YAMTFFSVVTLAILLSmaVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVtPFLGFGKYVQYCPGTWCfidmDP 178
Cdd:cd14984  78 YTINFYSGILFLACIS--IDRYLAIVHAVSALRARTLLHGKLTCLAVWALALLLSL-PEFIFSQVYEENGSSRC----SY 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 179 SASEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLkahrssvRRQRGHKRHRSmtkevehLVLLWFMTIAFVFC 258
Cdd:cd14984 151 IYPEDTATTWKTLLRLLQNILGFLLPLLVMLFCYSRIIRTL-------LRARNHKKHRA-------LRLIFAVVVVFFLC 216

                ...
gi 71834636 259 SLP 261
Cdd:cd14984 217 WLP 219
7tmA_tmt_opsin cd15086
teleost multiple tissue (tmt) opsin, member of the class A family of seven-transmembrane G ...
24-261 1.81e-04

teleost multiple tissue (tmt) opsin, member of the class A family of seven-transmembrane G protein-coupled receptors; Teleost multiple tissue (tmt) opsins are homologs of encephalopsin. Mouse encephalopsin (or panopsin) is highly expressed in the brain and testes, whereas the teleost homologs are localized to multiple tissues. The exact functions of the encephalopsins and tmt-opsins are unknown. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extra-retinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity and body color change. Tmt opsins belong to the class A of the G protein-coupled receptors and show strong homology to the vertebrate visual opsins.


Pssm-ID: 320214  Cd Length: 276  Bit Score: 42.42  E-value: 1.81e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  24 FMFSTGVLGNVVALILLEmrRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTF 103
Cdd:cd15086   9 FILTFGFLNNLLVLVLFC--KYKVLRSPINLLLLNISLSDLLVCVLGTPFSFAASTQGRWLIG----EHGCRWYGFANSL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 104 FSVVTLAILLSMAVERWLSIGHPFFYEKYSSKR-CGYITIALIYLLcaLFCVTPFLGFGKYVQYCPGTWCFIDMDPSASE 182
Cdd:cd15086  83 FGIVSLISLAVLSYERYCTLLRPTEADVSDYRKaWLGVGGSWLYSL--LWTLPPLLGWSSYGPEGPGTTCSVQWTSRSAN 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 183 HKAFNI-IYASCLLLMIVCTVLCNASVIYHISRMYrrlKAHRSSVRRQRGHKrhrsmtkevehLVLLWFMTIAFVFCSLP 261
Cdd:cd15086 161 SISYIIcLFIFCLLLPFLVMVYCYGRLLYAIKQVG---KINKSTARKREQHV-----------LLMVVTMVICYLLCWLP 226
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
24-304 1.88e-04

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320113  Cd Length: 283  Bit Score: 42.25  E-value: 1.88e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  24 FMFSTGVLGNVVAL-ILLEMRRRKQPASLFhvlVSSLVITDLLGTFSLsPLVLTAYF-RNASLLGmnenRLACGHFAYAM 101
Cdd:cd14982   9 LIFILGLLGNILALwVFLRKMKKRSPTTIY---MINLALADLLFVLTL-PFRIYYYLnGGWWPFG----DFLCRLTGLLF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 102 TFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCF-IDMDPSA 180
Cdd:cd14982  81 YINMYGSILFLTCISVDRYLAVVHPLKSRRLRRKRYAVGVCAGVWILVLAASVPLLLLRSTIAKENNSTTCFeFLSEWLA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 181 SEHKAFNI----IYASCLLLMIVCTVLCnasviyhISRMYRRLKAHRSSVRRQRGhkrhrsmtkevehLVLLWFMTIAFV 256
Cdd:cd14982 161 SAAPLVLIalvvGFLIPLLIILVCYSLI-------IRALRRRSKQSQKSVRKRKA-------------LRMILIVLAVFL 220
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 71834636 257 FCSLP----------LVIQVYHNTLYHRDRHRNNVIPLLFLSANPIIDPWVFIILSPP 304
Cdd:cd14982 221 VCFLPyhvtrilyllVRLSVIADCSARNSLYKAYRITLCLASLNSCLDPLIYYFLSKT 278
7tmA_Mel1 cd15209
melatonin receptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
30-171 1.93e-04

melatonin receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Melatonin (N-acetyl-5-methoxytryptamine) is a naturally occurring sleep-promoting chemical found in vertebrates, invertebrates, bacteria, fungi, and plants. In mammals, melatonin is secreted by the pineal gland and is involved in regulation of circadian rhythms. Its production peaks during the nighttime, and is suppressed by light. Melatonin is shown to be synthesized in other organs and cells of many vertebrates, including the Harderian gland, leukocytes, skin, and the gastrointestinal (GI) tract, which contains several hundred times more melatonin than the pineal gland and is involved in the regulation of GI motility, inflammation, and sensation. Melatonin exerts its pleiotropic physiological effects through specific membrane receptors, named MT1A, MT1B, and MT1C, which belong to the class A rhodopsin-like G-protein coupled receptor family. MT1A and MT1B subtypes are present in mammals, whereas MT1C subtype has been found in amphibians and birds. The melatonin receptors couple to G proteins of the G(i/o) class, leading to the inhibition of adenylate cyclase.


Pssm-ID: 320337  Cd Length: 279  Bit Score: 42.46  E-value: 1.93e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  30 VLGNVvaLILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFFSVVTL 109
Cdd:cd15209  15 VLGNL--LVILSVLRNKKLRNAGNIFVVSLSVADLVVAIYPYPLILHAIFHNGWTLG----QLHCQASGFIMGLSVIGSI 88
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 71834636 110 AILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFlgFGKYVQYCPGTW 171
Cdd:cd15209  89 FNITAIAINRYCYICHSLQYDRLYSLRNTCCYLCLTWLLTVLAVLPNF--FIGSLQYDPRIY 148
7tmA_GPRnna14-like cd15001
GPRnna14 and related proteins, member of the class A family of seven-transmembrane G ...
26-202 2.01e-04

GPRnna14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the orphan G-protein coupled receptor GPRnna14 found in body louse (Pediculus humanus humanus) as well as its closely related proteins of unknown function. These receptors are members of the class A rhodopsin-like G-protein coupled receptors. As an obligatory parasite of humans, the body louse is an important vector for human diseases, including epidemic typhus, relapsing fever, and trench fever. GPRnna14 shares significant sequence similarity with the members of the neurotensin receptor family. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320132  Cd Length: 266  Bit Score: 42.26  E-value: 2.01e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  26 FSTGVLGNVvaLILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMnenrLACG--HFAYAMTF 103
Cdd:cd15001  10 FVLGLIGNS--LVIFVVARFRRMRSVTNVFLASLATADLLLLVFCVPLKTAEYFSPTWSLGA----FLCKavAYLQLLSF 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 104 F-SVVTLailLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYC----PGTWCFIDMdP 178
Cdd:cd15001  84 IcSVLTL---TAISIERYYVILHPMKAKSFCTIGRARKVALLIWILSAILASPVLFGQGLVRYESengvTVYHCQKAW-P 159
                       170       180
                ....*....|....*....|....
gi 71834636 179 SASEHKAFNIIYASCLLLMIVCTV 202
Cdd:cd15001 160 STLYSRLYVVYLAIVIFFIPLIVM 183
7tmA_Mel1B cd15400
melatonin receptor subtype 1B, member of the class A family of seven-transmembrane G ...
30-158 2.29e-04

melatonin receptor subtype 1B, member of the class A family of seven-transmembrane G protein-coupled receptors; Melatonin (N-acetyl-5-methoxytryptamine) is a naturally occurring sleep-promoting chemical found in vertebrates, invertebrates, bacteria, fungi, and plants. In mammals, melatonin is secreted by the pineal gland and is involved in regulation of circadian rhythms. Its production peaks during the nighttime, and is suppressed by light. Melatonin is shown to be synthesized in other organs and cells of many vertebrates, including the Harderian gland, leukocytes, skin, and the gastrointestinal (GI) tract, which contains several hundred times more melatonin than the pineal gland and is involved in the regulation of GI motility, inflammation, and sensation. Melatonin exerts its pleiotropic physiological effects through specific membrane receptors, named MT1A, MT1B, and MT1C, which belong to the class A rhodopsin-like G-protein coupled receptor family. MT1A and MT1B subtypes are present in mammals, whereas MT1C subtype has been found in amphibians and birds. The melatonin receptors couple to G proteins of the G(i/o) class, leading to the inhibition of adenylate cyclase.


Pssm-ID: 320522  Cd Length: 279  Bit Score: 42.15  E-value: 2.29e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  30 VLGNVvaLILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFFSVVTL 109
Cdd:cd15400  15 ILGNL--LVIISVFRNRKLRNSGNVFVVSLALADLVVALYPYPLVLVAIFHNGWALG----EMHCKVSGFVMGLSVIGSI 88
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*....
gi 71834636 110 AILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFL 158
Cdd:cd15400  89 FNITGIAINRYCYICHSFAYDKLYSRWNTLLYVCLIWALTVVAIVPNFF 137
7tmA_MCHR2 cd15339
melanin concentrating hormone receptor 2, member of the class A family of seven-transmembrane ...
19-302 3.79e-04

melanin concentrating hormone receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320461  Cd Length: 283  Bit Score: 41.34  E-value: 3.79e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVVALILLEMRRRKQPASLFhvlVSSLVITDLLGTFSLsPLVLTAYFRNASLLGMNenrLACGHFA 98
Cdd:cd15339   4 PSFIGILCSTGLVGNILVLFTIIRSRKKTVPDIY---VCNLAVADLVHIIVM-PFLIHQWARGGEWVFGS---PLCTIIT 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  99 YAMTFFSVVTLAILLSMAVERWLSIGHPFfyeKYSSKRCGYITIALIYLLCA--LFCVTPFLGFGKYVQYCPGT-WCFID 175
Cdd:cd15339  77 SLDTCNQFACSAIMTAMSLDRYIALVHPF---RLTSLRTRSKTIRINLLVWAasFILVLPVWVYAKVIKFRDGLeSCAFN 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 176 MDpsASEHKAFNIIYASC------LLLMIVCTVLcnasVIYHISRMYRRLK-AHRSSVRRQRghKRHRSMTKEVEHLVLL 248
Cdd:cd15339 154 LT--SPDDVLWYTLYQTIttfffpLPLILICYIL----ILCYTWEMYRKNKkAGRYNTSIPR--QRVMRLTKMVLVLVGV 225
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....
gi 71834636 249 WFMTIAFVFCSLPLVIQVYHNTLYHrdrHRNNVIPLLFLSANPIIDPWVFIILS 302
Cdd:cd15339 226 FLVSAAPYHVIQLVNLSVSQPTLAF---YVSYYLSICLSYASSSINPFLYILLS 276
7tmA_Ap5-HTB1-like cd15065
serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of ...
28-264 3.91e-04

serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes Aplysia californica serotonin receptors Ap5-HTB1 and Ap5-HTB2, and similar proteins from bilateria including insects, mollusks, annelids, and worms. Ap5-HTB1 is one of the several different receptors for 5-hydroxytryptamine (5HT, serotonin). In Aplysia, serotonin plays important roles in a variety of behavioral and physiological processes mediated by the central nervous system. These include circadian clock, feeding, locomotor movement, cognition and memory, synaptic growth and synaptic plasticity. Both Ap5-HTB1 and Ap5-HTB2 receptors are coupled to G-proteins that stimulate phospholipase C, leading to the activation of phosphoinositide metabolism. Ap5-HTB1 is expressed in the reproductive system, whereas Ap5-HTB2 is expressed in the central nervous system.


Pssm-ID: 320193  Cd Length: 300  Bit Score: 41.57  E-value: 3.91e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  28 TGVLGNV-VALILLEMRRRKQPASLFHVlvsSLVITDLLgtfsLSPLVLTAYFRNASLlgmnenrlacGHFAYAMTF-FS 105
Cdd:cd15065  12 LAIFGNVlVCLAIFTDRRLRKKSNLFIV---SLAVADLL----VALLVMTFAVVNDLL----------GYWLFGETFcNI 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 106 VVTLAILLSMA---------VERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTP-FLGFGKYVQYCPGTWCfID 175
Cdd:cd15065  75 WISFDVMCSTAsilnlcaisLDRYIHIKKPLKYERWMTTRRALVVIASVWILSALISFLPiHLGWHRLSQDEIKGLN-HA 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 176 MDPSASEHKAFNIIYA---SCLLLMIVCTV-LCNASVIYHISRMY-RRLKAH-------RSSVRRQRGHKRHRSMTKEVE 243
Cdd:cd15065 154 SNPKPSCALDLNPTYAvvsSLISFYIPCLVmLLIYSRLYLYARKHvVNIKSQklpsesgSKFQVPSLSSKHNNQGVSDHK 233
                       250       260
                ....*....|....*....|.
gi 71834636 244 HLVLLWFMTIAFVFCSLPLVI 264
Cdd:cd15065 234 AAVTLGIIMGVFLICWLPFFI 254
7tmA_capaR cd15134
neuropeptide capa receptor and similar invertebrate proteins, member of the class A family of ...
21-265 4.88e-04

neuropeptide capa receptor and similar invertebrate proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; CapaR is a G-protein coupled receptor for the Drosophila melanogaster capa neuropeptides (Drm-capa-1 and -2), which act on the Malpighian tubules to increase fluid transport. The capa peptides are evolutionarily related to vertebrate Neuromedin U neuropeptide and contain a C-terminal FPRXamide motif. CapaR regulates fluid homeostasis through its ligands, thereby acts as a desiccation stress-responsive receptor. CapaR undergoes desensitization, with internalization mediated by beta-arrestin-2.


Pssm-ID: 320262  Cd Length: 298  Bit Score: 41.16  E-value: 4.88e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  21 IPAFMFSTGVLGNVVALILLEMRRRKQPASLFHVLvsSLVITDLLG-TFSLSPLVLTAYFRNASLLGMnenrLACGHFAY 99
Cdd:cd15134   6 IYGIIFVTGVVGNLCTCIVIARNRSMHTATNYYLF--SLAVSDLLLlILGLPFELYTIWQQYPWVFGE----VFCKLRAF 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 100 AMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSS-KRCGYITIALiyLLCALFCVTPFLGFGK--YVQYCPGTWCFI-D 175
Cdd:cd15134  80 LSEMSSYASVLTITAFSVERYLAICHPLRSHTMSKlSRAIRIIIAI--WIIAFVCALPFAIQTRivYLEYPPTSGEALeE 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 176 MDPSASEHKAFNIIY---ASCLLLMIVCTVLCnaSVIY-----HISRMYRRLKAHRSSVRRQRGHKRHRSMTKevehlvL 247
Cdd:cd15134 158 SAFCAMLNEIPPITPvfqLSTFLFFIIPMIAI--IVLYvliglQLRRSTLLRRGQRSVSGGRRSSQSRRTVLR------M 229
                       250
                ....*....|....*...
gi 71834636 248 LWFMTIAFVFCSLPLVIQ 265
Cdd:cd15134 230 LVAVVVAFFICWAPFHAQ 247
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
110-302 5.26e-04

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216  Cd Length: 278  Bit Score: 40.90  E-value: 5.26e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 110 AILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLcALFCVTPFLGFGKYVQYCPGT-WCFIDMDPSASEHkaFNI 188
Cdd:cd15088  89 YILTAMSVDRYLAVVHPIRSTKYRTRFVAKLVNVGLWAA-SFLSILPVWVYSSLIYFPDGTtFCYVSLPSPDDLY--WFT 165
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 189 IYASCL--LLMIVCTVLCNASVIYHISRMYRrlkahrsSVRRQRGHKRHRSMTKEVEHLVLLwfmtiaFVFCSLPL-VIQ 265
Cdd:cd15088 166 IYHFILgfAVPLVVITVCYILILHRLARGVA-------PGNQSHGSSRTKRVTKMVILIVVV------FIVCWLPFhVVQ 232
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 71834636 266 VyhnTLYHRDRHRNNVIPLLFLS-----ANPIIDPWVFIILS 302
Cdd:cd15088 233 L---VNLAMNRPTLAFEVAYFLSiclgyANSCLNPFVYILVS 271
7tmA_alpha1A_AR cd15325
alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G ...
29-209 5.84e-04

alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320448  Cd Length: 261  Bit Score: 40.65  E-value: 5.84e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  29 GVLGNVVALILLEMRRRKQpaSLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFFSVVT 108
Cdd:cd15325  14 GVLGNILVILSVACHRHLQ--TVTHYFIVNLAVADLLLTSTVLPFSAIFEILGYWAFG----RVFCNIWAAVDVLCCTAS 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 109 LAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGfgkYVQYCP--GTWCFIDMDPSASEHKAF 186
Cdd:cd15325  88 IMSLCIISIDRYIGVSYPLRYPSIMTERRGLLALLCVWVLSLVISIGPLFG---WKEPAPedETICQITEEPGYALFSAL 164
                       170       180
                ....*....|....*....|...
gi 71834636 187 NIIYascLLLMIVCTVLCNASVI 209
Cdd:cd15325 165 GSFY---LPLAIILVMYCRVYVV 184
7tmA_GPR15 cd15194
G protein-coupled receptor 15, member of the class A family of seven-transmembrane G ...
19-261 7.42e-04

G protein-coupled receptor 15, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR15, also called as Brother of Bonzo (BOB), is an orphan G-protein coupled receptor that was originally identified as a co-receptor for human immunodeficiency virus. GPR15 is upregulated in patients with rheumatoid arthritis and shares high sequence homology with angiotensin II type AT1 and AT2 receptors; however, its endogenous ligand is unknown. GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation.


Pssm-ID: 320322  Cd Length: 281  Bit Score: 40.61  E-value: 7.42e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVVALILLEMRRRKQpaSLFHVLVSSLVITDLLGTFSLsPL-----VLTAYFRNASLLgmnenrla 93
Cdd:cd15194   4 PILYCLVFLVGAVGNAILMGALVFKRGVR--RLIDIFISNLAASDFIFLVTL-PLwvdkeVVLGPWRSGSFL-------- 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  94 CGHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVtPFLGFGKYVQYCPGTWCf 173
Cdd:cd15194  73 CKGSSYIISVNMYCSVFLLTCMSLDRYLAIVLPLVSRKFRTKHNAKVCCTCVWMLSCLLGL-PTLLSRELKKYEEKEYC- 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 174 idmdpsaSEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHrssvrRQRGHKRHRSMTKEVEhlvLLWFMTI 253
Cdd:cd15194 151 -------NEDAGTPSKVIFSLVSLIVAFFLPLLSILTCYCTIIWKLCHH-----YQKSGKHQKKLRKSIK---IVFIVVA 215

                ....*...
gi 71834636 254 AFVFCSLP 261
Cdd:cd15194 216 AFVFSWMP 223
7tmA_VA_opsin cd15082
non-visual VA (vertebrate ancient) opsins, member of the class A family of seven-transmembrane ...
34-261 9.09e-04

non-visual VA (vertebrate ancient) opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; The vertebrate ancient (VA) opsin photopigments were originally identified in salmon and they appear to have diverged early in the evolution of vertebrate opsins. VA opsins are localized in the inner retina and the brain in teleosts. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extraretinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity, and body color change. The VA opsins belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320210  Cd Length: 291  Bit Score: 40.17  E-value: 9.09e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  34 VVALILLEMRRRKQPasLFHVLVSsLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFFSVVTLAILL 113
Cdd:cd15082  33 AVMLVTFRFKQLRQP--LNYIIVN-LSVADFLVSLTGGTISFLTNARGYFFLG----VWACVLEGFAVTFFGIVALWSLA 105
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 114 SMAVERWLSIGHPFFYEKYSSKRCGyITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASEHKAFNIIYasc 193
Cdd:cd15082 106 VLAFERFFVICRPLGNIRLQGKHAA-LGLLFVWTFSFIWTIPPVLGWSSYTVSKIGTTCEPNWYSGNMHDHTYIITF--- 181
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 71834636 194 lllMIVCTVLCNASVIYHISRMYRRLkahRSSVRRQRGHKRHRSMTKEVEHLVLLwfMTIAFVFCSLP 261
Cdd:cd15082 182 ---FTTCFILPLGVIFVSYGKLLQKL---RKVSNTQGRLGNARKPERQVTRMVVV--MIVAFMVCWTP 241
7tmA_NMU-R2 cd15357
neuromedin U receptor subtype 2, member of the class A family of seven-transmembrane G ...
23-168 9.13e-04

neuromedin U receptor subtype 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuromedin U (NMU) is a highly conserved neuropeptide with a common C-terminal heptapeptide sequence (FLFRPRN-amide) found at the highest levels in the gastrointestinal tract and pituitary gland of mammals. Disruption or replacement of residues in the conserved heptapeptide region can result in the reduced ability of NMU to stimulate smooth-muscle contraction. Two G-protein coupled receptor subtypes, NMU-R1 and NMU-R2, with a distinct expression pattern, have been identified to bind NMU. NMU-R1 is expressed primarily in the peripheral nervous system, while NMU-R2 is mainly found in the central nervous system. Neuromedin S, a 36 amino-acid neuropeptide that shares a conserved C-terminal heptapeptide sequence with NMU, is a highly potent and selective NMU-R2 agonist. Pharmacological studies have shown that both NMU and NMS inhibit food intake and reduce body weight, and that NMU increases energy expenditure.


Pssm-ID: 320479  Cd Length: 293  Bit Score: 40.23  E-value: 9.13e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFSTGVLGNV-VALILLEMRRRKQPASLFhvlVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmneNRLACghfAYAM 101
Cdd:cd15357   8 AVIFVVGVIGNLlVCLVILKHQNMKTPTNYY---LFSLAVSDLLVLLFGMPLEVYEMWSNYPFLF---GPVGC---YFKT 78
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 102 TFFSVVTLAILLSM---AVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCP 168
Cdd:cd15357  79 ALFETVCFASILSVttvSVERYVAILHPFRAKLNSTRERALKIIVVLWVLSVLFSIPNTSIHGIKLQYFP 148
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
19-230 1.00e-03

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 320296  Cd Length: 283  Bit Score: 39.99  E-value: 1.00e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVVALILLEMRRRKQPASLFHVLvsSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFA 98
Cdd:cd15168   4 PIVYGVVFLVGLLLNAVVLYRFIFSLKPWNSSAIYMF--NLAVSDLLYLLSLPFLIYYYANGDHWIFG----DFMCKLVR 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  99 YAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALfCVTPFLGFGKYVQYCPGTWCFidmDP 178
Cdd:cd15168  78 FLFYFNLYCSILFLTCISVHRYLGICHPMRSLRKLKKRHAVAVCVAVWILVLL-QLLPILFFATTGRPNNRTTCY---DT 153
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....
gi 71834636 179 SASEHKAFNIIYASCL-LLMIVCTVLCNASVIYHISR-MYRRLKAHRSSVRRQR 230
Cdd:cd15168 154 TSPEELNDYVPYSMVLtGLGFLLPLLIILACYGLIARtLLRSLGSGVTSALRRK 207
7tmA_OR52I-like cd15950
olfactory receptor subfamily 52I and related proteins, member of the class A family of ...
24-167 1.16e-03

olfactory receptor subfamily 52I and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52I and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320616  Cd Length: 275  Bit Score: 40.09  E-value: 1.16e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  24 FMFSTGVLGNVVALILLEM-RRRKQPASLFhvlVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNenrlACGHFAYAMT 102
Cdd:cd15950   9 SMYVIALLGNGTILLVIKLdPSLHEPMYYF---LCMLAVIDLVMSTSIVPKMLSIFWLGSAEISFE----ACFTQMFFVH 81
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 71834636 103 FFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCgYITIALIYLLCALFCVTPFLGFGKYVQYC 167
Cdd:cd15950  82 SFTAVESGVLLAMAFDRYVAICHPLRYSAILTSQV-IAQIGLAIVLRALLFMTPLTCLVTSLPYC 145
7tmA_SREB-like cd15005
super conserved receptor expressed in brain and related proteins, member of the class A family ...
29-163 1.46e-03

super conserved receptor expressed in brain and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The SREB (super conserved receptor expressed in brain) subfamily consists of at least three members, named SREB1 (GPR27), SREB2 (GPR85), and SREB3 (GPR173). They are very highly conserved G protein-coupled receptors throughout vertebrate evolution, however no endogenous ligands have yet been identified. SREB2 is greatly expressed in brain regions involved in psychiatric disorders and cognition, such as the hippocampal dentate gyrus. Genetic studies in both humans and mice have shown that SREB2 influences brain size and negatively regulates hippocampal adult neurogenesis and neurogenesis-dependent cognitive function, all of which are suggesting a potential link between SREB2 and schizophrenia. All three SREB genes are highly expressed in differentiated hippocampal neural stem cells. Furthermore, all GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320134  Cd Length: 329  Bit Score: 39.75  E-value: 1.46e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  29 GVLGNVVALILLEMRRRKQPASLFHVLvsSLVITDLLGTFSLSPLVLTAYFRNAsllGMNENRLACGHFAYAMTFFSVVT 108
Cdd:cd15005  14 SLAGNLLFSVLIVRDRSLHRAPYYFLL--DLCLADGLRSLACFPFVMASVRHGS---GWIYGALSCKVIAFLAVLFCFHS 88
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*
gi 71834636 109 LAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKY 163
Cdd:cd15005  89 AFTLFCIAVTRYMAIAHHRFYAKRMTFWTCLAVICMAWTLSVAMAFPPVFDVGTY 143
7tmA_CCR8 cd15187
CC chemokine receptor type 8, member of the class A family of seven-transmembrane G ...
19-214 1.73e-03

CC chemokine receptor type 8, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR8, the receptor for the CC chemokines CCL1 and CC16, is highly expressed on allergen-specific T-helper type 2 cells, and is implicated in the pathogenesis of human asthma. CCL1- and CCR8-expressing CD4+ effector T lymphocytes are shown to have a critical role in lung mucosal inflammatory responses. CCR8 is also a functional receptor for CCL16, a liver-expressed CC chemokine that involved in attracting lymphocytes, dendritic cells, and monocytes. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320315  Cd Length: 276  Bit Score: 39.40  E-value: 1.73e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNvvALILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSplVLTAYFRNASLLGMNENRLACGhfA 98
Cdd:cd15187   4 PVLYCLLFVFGLLGN--SLVIWVLVACKKLRSMTDVYLLNLAASDLLFVFSLP--FQAYYLLDQWVFGNAMCKIVSG--A 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  99 YAMTFFSVVTLAILlsMAVERWLSIGHPFFYEKYSSKRCGyITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDP 178
Cdd:cd15187  78 YYIGFYSSMFFITL--MSIDRYLAIVHAVYALKVRTASHG-TILSLALWLVAILASVPLLVFYQVASEDGRLQCIPFYPG 154
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 71834636 179 SASEHKAFNIIYASCLLLMIVCTVL--CNASVIYHISR 214
Cdd:cd15187 155 QGNSWKVFTNFEVNILGLLIPFSILifCYHNILRNLRR 192
7tmA_AKHR cd15382
adipokinetic hormone receptor, member of the class A family of seven-transmembrane G ...
25-298 1.89e-03

adipokinetic hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Adipokinetic hormone (AKH) is a lipid-mobilizing hormone that is involved in control of insect metabolism. Generally, AKH behaves as a typical stress hormone by mobilizing lipids, carbohydrates and/or certain amino acids such as proline. Thus, it utilizes the body's energy reserves to fight the immediate stress problems and subdue processes that are less important. Although AKH is known to responsible for regulating the energy metabolism during insect flight, it is also found in insects that have lost its functional wings and predominantly walk for their locomotion. AKH is structurally related to the mammalian gonadotropin-releasing hormone (GnRH) and they share a common ancestor. Both GnRH and AKH receptors are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320504  Cd Length: 298  Bit Score: 39.22  E-value: 1.89e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  25 MFSTGVLGNVVALILLEMRRRKQPASLFHVLVsSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTFF 104
Cdd:cd15382  10 LFLIAAVGNLTVLLILLRNRRRKRSRVNILLM-HLAIADLLVTFIMMPLEIGWAATVAWLAG----DFLCRLMLFFRAFG 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 105 SVVTLAILLSMAVERWLSIGHPFFyeKYSSKRCGYITIA---LIYLLCAL-----FCVTPFLGFGKYVQyCPgTWCFIDM 176
Cdd:cd15382  85 LYLSSFVLVCISLDRYFAILKPLR--LSDARRRGRIMLAvawVISFLCSIpqsfiFHVESHPCVTWFSQ-CV-TFNFFPS 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 177 DPSASEHKAFNIIYASCLLLMIvcTVLCNASVIYHISRMYRRLK----AHRSSVRRQR---GH-KRHRSMTkevehLVLL 248
Cdd:cd15382 161 HDHELAYNIFNMITMYALPLII--IVFCYSLILCEISRKSKEKKedvsEKSSSVRLRRssvGLlERARSRT-----LKMT 233
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 71834636 249 WFMTIAFVFCSLPLVIQvyhNTLYHRDRHRNNVIP-----LLFLSA--NPIIDPWVF 298
Cdd:cd15382 234 IVIVLVFIICWTPYFIM---SLWYWFDRESASKVDpriqkGLFLFAvsNSCMNPIVY 287
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
25-272 2.69e-03

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 38.99  E-value: 2.69e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636   25 MFSTGVLGNVVALILLEMRRRKQPASLFHVlvsSLVITDLLGTFSLsPLVLTAYFRNASLLGMNENRLACGhFAYAMTFF 104
Cdd:PHA03087  50 IFFFGLVGNIIVIYVLTKTKIKTPMDIYLL---NLAVSDLLFVMTL-PFQIYYYILFQWSFGEFACKIVSG-LYYIGFYN 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  105 SVVTLAIllsMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLcALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASEHK 184
Cdd:PHA03087 125 SMNFITV---MSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWII-SIIETTPILFVYTTKKDHETLICCMFYNNKTMNWK 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  185 AFnIIYASCLLLMIVCTVLcnasVIYHISRMYRRLKAHRSSVRRQRGHKrhrsmtkevehLVLLwfMTIAFVFCSLPLVI 264
Cdd:PHA03087 201 LF-INFEINIIGMLIPLTI----LLYCYSKILITLKGINKSKKNKKAIK-----------LVLI--IVILFVIFWLPFNV 262

                 ....*...
gi 71834636  265 QVYHNTLY 272
Cdd:PHA03087 263 SVFVYSLH 270
7tmA_SREB1_GPR27 cd15216
super conserved receptor expressed in brain 1 (or GPR27), member of the class A family of ...
23-162 2.69e-03

super conserved receptor expressed in brain 1 (or GPR27), member of the class A family of seven-transmembrane G protein-coupled receptors; The SREB (super conserved receptor expressed in brain) subfamily consists of at least three members, named SREB1 (GPR27), SREB2 (GPR85), and SREB3 (GPR173). They are very highly conserved G protein-coupled receptors throughout vertebrate evolution, however no endogenous ligands have yet been identified. SREB2 is greatly expressed in brain regions involved in psychiatric disorders and cognition, such as the hippocampal dentate gyrus. Genetic studies in both humans and mice have shown that SREB2 influences brain size and negatively regulates hippocampal adult neurogenesis and neurogenesis-dependent cognitive function, all of which are suggesting a potential link between SREB2 and schizophrenia. All three SREB genes are highly expressed in differentiated hippocampal neural stem cells. Furthermore, all GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320344  Cd Length: 332  Bit Score: 38.85  E-value: 2.69e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFSTGVLGNVVALILLEMRRRKQPASLFhvLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNENRLACGHFAYAMT 102
Cdd:cd15216   8 SLLLCVSLAGNVLFALLIVRERSLHRAPYY--LLLDLCLADGLRALACLPAVMLAARRAAAAAGTPPGALGCKLLAFLAA 85
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 71834636 103 FFSVVTLAILLSMAVERWLSIGHPFFY-EKYSSKRCGYITIALIYLLCALFCVTPFLGFGK 162
Cdd:cd15216  86 LFCFHAAFLLLGVGVTRYLAIAHHRFYaERLAGWPCAAMLVCAAWALALAAAFPPVLDGGG 146
7tmA_GPR61_GPR62-like cd15220
G protein-coupled receptors 61 and 62, member of the class A family of seven-transmembrane G ...
28-205 2.75e-03

G protein-coupled receptors 61 and 62, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes the orphan receptors GPR61 and GPR62, which are both constitutively active and predominantly expressed in the brain. While GPR61 couples to G(s) subtype of G proteins, the signaling pathway and function of GPR 62 are unknown. GPR61-deficient mice displayed significant hyperphagia and heavier body weight compared to wild-type mice, suggesting that GPR61 is involved in the regulation of food intake and body weight. GPR61 transcript expression was found in the caudate, putamen, and thalamus of human brain, whereas GPR62 transcript expression was found in the basal forebrain, frontal cortex, caudate, putamen, thalamus, and hippocampus. Both receptors share the highest sequence homology with each other and comprise a conserved subgroup within the class A family of GPCRs, which includes receptors for hormones, neurotransmitters, sensory stimuli, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, which then activate the heterotrimeric G proteins. Members of this subgroup contain [A/E]RY motif, a variant of the highly conserved Asp-Arg-Tyr (DRY) motif found in the third transmembrane helix (TM3) of the class A GPCRs and important for efficient G protein-coupled signal transduction.


Pssm-ID: 320348  Cd Length: 264  Bit Score: 38.56  E-value: 2.75e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  28 TGVLGN--VVALILlemrrrKQPASLFHVLVSSLVITDLLGTFSLSPLVL--TAYFRNASLLGMNENRLAcGHFAYAMTF 103
Cdd:cd15220  12 TALVGNtaVMAVIA------KTPQLRKFIFVFHLCVVDLLAALSLMPLGIlsSSPFFEGVVFGEAECRVY-IFLSVCLVS 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 104 FSVVTLAILlsmAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSASEH 183
Cdd:cd15220  85 ASILTVSVI---SVERYYYIVHPMRYEVKMTLGLVAAVLVGVWVKALLLALLPLLGWPSYSGPPPIAARHCSLHWSHGGH 161
                       170       180
                ....*....|....*....|....*.
gi 71834636 184 -KAFNIIYAS---CLLLMIVCTVLCN 205
Cdd:cd15220 162 rGVFAVLFAVvyfLLPALVILVVYGG 187
7tmA_OR52W-like cd15956
olfactory receptor subfamily 52W and related proteins, member of the class A family of ...
20-158 2.90e-03

olfactory receptor subfamily 52W and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52W and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320622  Cd Length: 275  Bit Score: 38.69  E-value: 2.90e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  20 TIP-AFMFSTGVLGNVVALILLEMRRR-KQPASLFhvlVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNenrlACGHF 97
Cdd:cd15956   4 SLPfCFIYVLSLLGNGVLLSVVWKEHRlHQPMFLF---LAMLAATDLVLALSTAPKLLAILWFGATAISSY----VCLSQ 76
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 71834636  98 AYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRC-GYITIALIYLLCALFCVTPFL 158
Cdd:cd15956  77 MFLVHAFSAMESGVLVAMALDRFVAICNPLHYATILTLEVvAKAGLLLALRGVAIVIPFPLL 138
7tmA_NPY5R cd15398
neuropeptide Y receptor type 5, member of the class A family of seven-transmembrane G ...
23-214 3.00e-03

neuropeptide Y receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.


Pssm-ID: 320520  Cd Length: 273  Bit Score: 38.60  E-value: 3.00e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFSTGVLGNVvaLILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMT 102
Cdd:cd15398   8 TFISLLGFLGNL--LILTALTKKWKQKTIINFLIGNLAFSDILVVLFCSPFTLTCVLLDQWIFG----EVMCHIVPFLQC 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 103 FFSVVTLAILLSMAVERWLSIGHPFfyEKYSSKRCGYITIALIYLLCALFCvTPFLGFGKYV--------QYCPGTWCFI 174
Cdd:cd15398  82 VSVMVSTLMLMSIAIVRYHMIKHPL--SNHLTANHGYFLLGTVWTLGFTIC-SPLPVFHKIVdlsetfnlESLKNKYLCI 158
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*
gi 71834636 175 DMDPSASEHKAFNIiyasCLLLM-----IVCTVLCNASVIYHISR 214
Cdd:cd15398 159 ESWPSDSYRIAFTI----SLLFVqyilpLVCLTVSHTSVCRSVKR 199
7TM_GPCR_Srw pfam10324
Serpentine type 7TM GPCR chemoreceptor Srw; Chemoreception is mediated in Caenorhabditis ...
113-264 3.21e-03

Serpentine type 7TM GPCR chemoreceptor Srw; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srw is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz.


Pssm-ID: 313536  Cd Length: 317  Bit Score: 38.73  E-value: 3.21e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636   113 LSMAVERWLSIGHPF--FYEKYSSKRCGYITIALIYLLCALFCVTPFLGFG---KYVQYCPGTWCF-------------- 173
Cdd:pfam10324  97 VFMALIRTLVVKNPMsnKIQKLSKPKFGLIIIIIVFILSLPISIFYYFRYEiveVGGIWKPPPNCAgfppnysetryvlv 176
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636   174 ---IDMDPSASEHKAFNIIYAS------CLLLMIVCTVLcnasvIYHIsrmyRRLKAHRSSVRRQrGHKRHRSmTKeveh 244
Cdd:pfam10324 177 vseLFTANDGLLLKIYLFINGIvskiipCILLPILTILL-----IIEL----RKAKKSRKNLSSS-SNKSDRT-TK---- 241
                         170       180
                  ....*....|....*....|
gi 71834636   245 LVLlwFMTIAFVFCSLPLVI 264
Cdd:pfam10324 242 LVI--FMTISFFIAEFPLGI 259
7tmA_Mel1C cd15401
melatonin receptor subtype 1C, member of the class A family of seven-transmembrane G ...
24-168 3.43e-03

melatonin receptor subtype 1C, member of the class A family of seven-transmembrane G protein-coupled receptors; Melatonin (N-acetyl-5-methoxytryptamine) is a naturally occurring sleep-promoting chemical found in vertebrates, invertebrates, bacteria, fungi, and plants. In mammals, melatonin is secreted by the pineal gland and is involved in regulation of circadian rhythms. Its production peaks during the nighttime, and is suppressed by light. Melatonin is shown to be synthesized in other organs and cells of many vertebrates, including the Harderian gland, leukocytes, skin, and the gastrointestinal (GI) tract, which contains several hundred times more melatonin than the pineal gland and is involved in the regulation of GI motility, inflammation, and sensation. Melatonin exerts its pleiotropic physiological effects through specific membrane receptors, named MT1A, MT1B, and MT1C, which belong to the class A rhodopsin-like G-protein coupled receptor family. MT1A and MT1B subtypes are present in mammals, whereas MT1C subtype has been found in amphibians and birds. The melatonin receptors couple to G proteins of the G(i/o) class, leading to the inhibition of adenylate cyclase.


Pssm-ID: 320523  Cd Length: 279  Bit Score: 38.35  E-value: 3.43e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  24 FMFSTGVLGNvvALILLEMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACGHFAYAMTF 103
Cdd:cd15401   9 FTIVVDVLGN--LLVILSVLRNKKLRNAGNIFVVSLSVADLVVAVYPYPLILLAIFHNGWTLG----NIHCQISGFLMGL 82
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 71834636 104 FSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFlgFGKYVQYCP 168
Cdd:cd15401  83 SVIGSVFNITAIAINRYCYICHSLRYDKLYNMKKTCCYVCLTWVLTLAAIVPNF--FVGSLQYDP 145
7tmA_CysLTR1 cd15158
cysteinyl leukotriene receptor 1, member of the class A family of seven-transmembrane G ...
20-295 3.54e-03

cysteinyl leukotriene receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320286  Cd Length: 285  Bit Score: 38.57  E-value: 3.54e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  20 TIPAFMFSTGVLGNVVALILLEMRRRKQPAslFHVLVSSLVITDLLGTFSLsPLVLTAYFRNASLLgmnENRLACGHFAY 99
Cdd:cd15158   5 TLYSVITVFGLVGNGFALYVLIKTYRQKSA--FHIYMLNLAVSDLLCVCTL-PLRVVYYVHKGQWL---FGDFLCRISSY 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 100 AMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALfCVTPFLGFGKYVQYCPGTWCFIDMDPS 179
Cdd:cd15158  79 ALYVNLYCSIYFMTAMSFTRFLAIVFPVQNLNLVTVKKARIVCVGIWIFVTL-TSSPFLMSGSHDTETNKTKCFEPPQSN 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 180 ASEHKAFNIIYASCLLLMIV---CTVLCNASVIyhisrmyrrlkahRSSVRRQRGHKRHRSMTKEVEHLVLLwfMTIAFV 256
Cdd:cd15158 158 QQLTKLLVLNYISLVVGFIIpflVILICYAMII-------------RTLLKNTMKARKQQSSRKKAIRMIII--VLLAFL 222
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|..
gi 71834636 257 FCSLPLVIQvyhNTLYHRDRHRNN-------------VIPLLFLSANPIIDP 295
Cdd:cd15158 223 VSFMPYHIQ---RTIHLHFLSRKDstceevlymqksvVITLCLAAANCCFDP 271
7tmA_LWS_opsin cd15081
long wave-sensitive opsins, member of the class A family of seven-transmembrane G ...
95-261 3.62e-03

long wave-sensitive opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; Long Wave-Sensitive opsin is also called red-sensitive opsin or red cone photoreceptor pigment, which mediates visual transduction in response to light at long wavelengths. Vertebrate cone opsins are expressed in cone photoreceptor cells of the retina and involved in mediating photopic vision, which allows color perception. The cone opsins can be classified into four classes according to their peak absorption wavelengths: SWS1 (ultraviolet sensitive), SWS2 (short wave-sensitive), MWS/LWS (medium/long wave-sensitive), and RH2 (medium wave-sensitive, rhodopsin-like opsins). Members of this group belong to the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320209  Cd Length: 292  Bit Score: 38.35  E-value: 3.62e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  95 GHFAYAMTFFSVVTLAI--LLSMAV---ERWLSIGHPFFYEKYSSKrCGYITIALIYLLCALFCVTPFLGFGKYVQYCPG 169
Cdd:cd15081  81 GHPMCVLEGFTVSVCGItgLWSLTIiswERWVVVCKPFGNIKFDGK-LAIVGIIFSWVWSAVWCAPPIFGWSRYWPHGLK 159
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 170 TWCFIDMDPSASEHKafniIYASCLLLMIVCTVLCNASVIYHISRMYRrlkAHRSSVRRQRGHKRHRSMTKEVEHLVLLw 249
Cdd:cd15081 160 TSCGPDVFSGSSDPG----VQSYMIVLMITCCIIPLAIIILCYLQVWL---AIRAVAQQQKESESTQKAEKEVSRMVVV- 231
                       170
                ....*....|..
gi 71834636 250 fMTIAFVFCSLP 261
Cdd:cd15081 232 -MIFAYCFCWGP 242
7tmA_Proton-sensing_R cd15160
proton-sensing G protein-coupled receptors, member of the class A family of ...
19-302 3.99e-03

proton-sensing G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Proton/pH-sensing G-protein coupled receptors sense pH of 7.6 to 6.0. They mediate a variety of biological activities in neutral and mildly acidic pH conditions, whereas the acid-sensing ionotropic ion channels typically sense strong acidic pH. The proton/pH-sensing receptor family includes the G2 accumulation receptor (G2A, also known as GPR132), the T cell death associated gene-8 (TDAG8, GPR65) receptor, ovarian cancer G-protein receptor 1 (OGR-1, GPR68), and G-protein-coupled receptor 4 (GPR4).


Pssm-ID: 320288  Cd Length: 280  Bit Score: 38.13  E-value: 3.99e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVVALILLemRRRKQPASLFHVLVSSLVITDLLGTFSLsPLVLtAYFRNAS--LLGMnenrLACGH 96
Cdd:cd15160   4 PVVYSFVFVVGLPANCLALWVL--YLQIKKENVLGVYLLNLSLSDLLYILTL-PLWI-DYTANHHnwTFGP----LSCKV 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  97 FAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFiDM 176
Cdd:cd15160  76 VGFFFYTNIYASIGFLCCIAVDRYLAVVHPLRFRGLRTRRFALKVSASIWVLELGTHSVFLGHDELFRDEPNHTLCY-EK 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636 177 DPSASEHKAFNII-----YASCLLLMIVCtvlcnasviYHisRMYRRLKAHRSSVRRQRghkrhrsmtKEVEHLVLLwfM 251
Cdd:cd15160 155 YPMEGWQASYNYArflvgFLIPLSLILFF---------YR--RVLRAVRQSPSLEREEK---------RKIIGLLLS--I 212
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 71834636 252 TIAFVFCSLPlviqvYHNTLYHRD--RHRNN-------------VIPLLFLSANPIIDPWVFIILS 302
Cdd:cd15160 213 VVIFLLCFLP-----YHVVLLVRSviELVQNglcgfekrvftayQISLCLTSLNCVADPILYIFVT 273
7tmA_Beta3_AR cd15959
beta-3 adrenergic receptors (adenoceptors), member of the class A family of ...
23-158 4.16e-03

beta-3 adrenergic receptors (adenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta-3 adrenergic receptor (beta-3 adrenoceptor), also known as beta-3 AR, is activated by adrenaline and plays important roles in regulating cardiac function and heart rate. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of beta-ARs can lead to cardiac dysfunction such as arrhythmias or heart failure.


Pssm-ID: 320625  Cd Length: 302  Bit Score: 38.35  E-value: 4.16e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  23 AFMFSTGVLGNVVALILLEMRRRKQpaSLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMnenrLACGHFAYAMT 102
Cdd:cd15959   8 SLAILVIVGGNLLVIVAIAKTPRLQ--TMTNVFVTSLACADLVMGLLVVPPGATILLTGHWPLGT----TVCELWTSVDV 81
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 71834636 103 FFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFL 158
Cdd:cd15959  82 LCVTASIETLCAIAVDRYLAITNPLRYEALVTKRRARTAVCLVWAISAAISFLPIM 137
7tmA_OR52P-like cd15953
olfactory receptor subfamily 52P and related proteins, member of the class A family of ...
20-199 4.47e-03

olfactory receptor subfamily 52P and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52P and related proteins in other mammals, sauropsids and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320619  Cd Length: 275  Bit Score: 38.01  E-value: 4.47e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  20 TIP-AFMFSTGVLGNVVALILLEMRRR-KQPASLFhvlVSSLVITDLLGTFSLSPLVLTAYFRNASLLGMNenrlACGHF 97
Cdd:cd15953   4 SIPfCLMYIVTLLGNCTILFVVGKEQSlHKPMYLL---LCMLALTDLVLSTSVLPKALCIFWFNLKEITFS----GCLTQ 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  98 AYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEK-YSSKRCGyiTIALIYLLCALFCVTPFLGFGKYVQYC-----PGTW 171
Cdd:cd15953  77 MFFIHTLSIMESAVLVAMAFDRYVAICNPLRYATiLTNSRIA--KLGLVGLIRGVLLILPLPLLLSRLPFCanriiPHTY 154
                       170       180
                ....*....|....*....|....*....
gi 71834636 172 C-FIDMDPSASEHKAFNIIYASCLLLMIV 199
Cdd:cd15953 155 CeHMAVVKLACGDTTVNRIYGLVVALLVV 183
7tmA_Gal2_Gal3_R cd15097
galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G ...
19-172 4.58e-03

galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320225  Cd Length: 279  Bit Score: 37.88  E-value: 4.58e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71834636  19 PTIPAFMFSTGVLGNVVALILLeMRRRKQPASLFHVLVSSLVITDLLGTFSLSPLVLTAYFRNASLLGmnenRLACG--H 96
Cdd:cd15097   4 PVVFSLIFLLGTVGNSLVLAVL-LRSGQSGHNTTNLFILNLSVADLCFILFCVPFQATIYSLEGWVFG----SFLCKavH 78
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 71834636  97 FAYAMTFF-SVVTLAillSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLL