NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6754934|ref|NP_036180|]
View 

osteomodulin precursor [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
NEL super family cl26018
C-terminal novel E3 ligase, LRR-interacting; This NEL or novel E3 ligase domain is found at ...
68-302 6.90e-18

C-terminal novel E3 ligase, LRR-interacting; This NEL or novel E3 ligase domain is found at the C-terminus of bacterial virulence factors. Its sequence is different from those of the eukaryotic HECT and RING-finger E3 ligases, and it subverts the host ubiquitination process. At the N-terminus of the family-members there is a series of LRR repeats, and the NEL domain interacts with the most N-terminal repeat. The key residue for the ligation step is the cysteine, eg found at position 386 in UniProtKB:E7K2H2. The LRR section sequesters this active site until invasion has occurred.


The actual alignment was detected with superfamily member PRK15370:

Pssm-ID: 330839  Cd Length: 754  Bit Score: 85.90  E-value: 6.90e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934    68 CPTNFPTSMYCDNRKLKTIP-IIPMHIQQLNLQFNDIEAVTANSFINathLKEINLSHNKIKSqkidygVFAKLSN-LQQ 145
Cdd:PRK15370 175 CLKNNKTELRLKILGLTTIPaCIPEQITTLILDNNELKSLPENLQGN---IKTLYANSNQLTS------IPATLPDtIQE 245
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   146 LHLEHNNLEEFPFPLPKSLERLLLGYNEISILPTNAMDGLvnvTMLDLCYNHLsdSMLKEKTLSkmeKLMQLNLCNNRLE 225
Cdd:PRK15370 246 MELSINRITELPERLPSALQSLDLFHNKISCLPENLPEEL---RYLSVYDNSI--RTLPAHLPS---GITHLNVQSNSLT 317
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 6754934   226 SMPLGLPSSLMYLSLENNSISSIPDNYfdkLPKLHALRISHNKLEDIPYDIfnLSNLIELNVGHNKLKQafyIPRNL 302
Cdd:PRK15370 318 ALPETLPPGLKTLEAGENALTSLPASL---PPELQVLDVSKNQITVLPETL--PPTITTLDVSRNALTN---LPENL 386
 
Name Accession Description Interval E-value
PRK15370 PRK15370
E3 ubiquitin-protein ligase SlrP; Provisional
68-302 6.90e-18

E3 ubiquitin-protein ligase SlrP; Provisional


Pssm-ID: 185268  Cd Length: 754  Bit Score: 85.90  E-value: 6.90e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934    68 CPTNFPTSMYCDNRKLKTIP-IIPMHIQQLNLQFNDIEAVTANSFINathLKEINLSHNKIKSqkidygVFAKLSN-LQQ 145
Cdd:PRK15370 175 CLKNNKTELRLKILGLTTIPaCIPEQITTLILDNNELKSLPENLQGN---IKTLYANSNQLTS------IPATLPDtIQE 245
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   146 LHLEHNNLEEFPFPLPKSLERLLLGYNEISILPTNAMDGLvnvTMLDLCYNHLsdSMLKEKTLSkmeKLMQLNLCNNRLE 225
Cdd:PRK15370 246 MELSINRITELPERLPSALQSLDLFHNKISCLPENLPEEL---RYLSVYDNSI--RTLPAHLPS---GITHLNVQSNSLT 317
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 6754934   226 SMPLGLPSSLMYLSLENNSISSIPDNYfdkLPKLHALRISHNKLEDIPYDIfnLSNLIELNVGHNKLKQafyIPRNL 302
Cdd:PRK15370 318 ALPETLPPGLKTLEAGENALTSLPASL---PPELQVLDVSKNQITVLPETL--PPTITTLDVSRNALTN---LPENL 386
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
109-312 9.07e-16

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223  Cd Length: 394  Bit Score: 78.47  E-value: 9.07e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  109 NSFINATHLKEINLSHNKIKSqkiDYGVFAKLSNLQQLHLEHNN---LEEFPFPLPKSLERLLLGYNEISILPTNaMDGL 185
Cdd:COG4886  87 ENLLNLLPLPSLDLNLNRLRS---NISELLELTNLTSLDLDNNNitdIPPLIGLLKSNLKELDLSDNKIESLPSP-LRNL 162
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  186 VNVTMLDLCYNHLSDsmlKEKTLSKMEKLMQLNLCNNRLESMP--LGLPSSLMYLSLENNSISSIPDNYFdKLPKLHALR 263
Cdd:COG4886 163 PNLKNLDLSFNDLSD---LPKLLSNLSNLNNLDLSGNKISDLPpeIELLSALEELDLSNNSIIELLSSLS-NLKNLSGLE 238
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|.
gi 6754934  264 ISHNKLEDIPYDIFNLSNLIELNVGHNKLKQAFYIP--RNLEHLYLQNNEI 312
Cdd:COG4886 239 LSNNKLEDLPESIGNLSNLETLDLSNNQISSISSLGslTNLRELDLSGNSL 289
LRR_8 pfam13855
Leucine rich repeat;
96-153 2.46e-09

Leucine rich repeat;


Pssm-ID: 316378  Cd Length: 61  Bit Score: 54.46  E-value: 2.46e-09
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 6754934     96 LNLQFNDIEAVTANSFINATHLKEINLSHNKIKSqkIDYGVFAKLSNLQQLHLEHNNL 153
Cdd:pfam13855   6 LDLSNNRLTVLDDGAFKGLSNLKVLDLSNNLLTT--LSPGAFSGLPSLRYLDLSGNRL 61
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
136-342 4.94e-07

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064  Cd Length: 319  Bit Score: 51.20  E-value: 4.94e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  136 VFAKLSNLQQLHLEHNNL--EEFPF-----PLPKSLERLLLGYNEISILPTN---AMDGL---VNVTMLDLCYNHLS-DS 201
Cdd:cd00116  18 LLPKLLCLQVLRLEGNTLgeEAAKAlasalRPQPSLKELCLSLNETGRIPRGlqsLLQGLtkgCGLQELDLSDNALGpDG 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  202 MLKEKTLSKMEKLMQLNLCNNRLESMPL-----GLPSSLMYLS---LENNSISSIP----DNYFDKLPKLHALRISHNKL 269
Cdd:cd00116  98 CGVLESLLRSSSLQELKLNNNGLGDRGLrllakGLKDLPPALEklvLGRNRLEGAScealAKALRANRDLKELNLANNGI 177
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 6754934  270 ED--IPYdifnlsnlielnvghnkLKQAFYIPRNLEHLYLQNNEIESINVTMICPSPDpvHHHHLTYLRVDQNKL 342
Cdd:cd00116 178 GDagIRA-----------------LAEGLKANCNLEVLDLNNNGLTDEGASALAETLA--SLKSLEVLNLGDNNL 233
LRRNT smart00013
Leucine rich repeat N-terminal domain;
61-94 1.94e-05

Leucine rich repeat N-terminal domain;


Pssm-ID: 214470  Cd Length: 33  Bit Score: 42.69  E-value: 1.94e-05
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 6754934      61 GCAKECFCPtnfPTSMYCDNRKLKTIPI-IPMHIQ 94
Cdd:smart00013   1 ACPAPCNCS---GTAVDCSGRGLTEVPLdLPPDTT 32
 
Name Accession Description Interval E-value
PRK15370 PRK15370
E3 ubiquitin-protein ligase SlrP; Provisional
68-302 6.90e-18

E3 ubiquitin-protein ligase SlrP; Provisional


Pssm-ID: 185268  Cd Length: 754  Bit Score: 85.90  E-value: 6.90e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934    68 CPTNFPTSMYCDNRKLKTIP-IIPMHIQQLNLQFNDIEAVTANSFINathLKEINLSHNKIKSqkidygVFAKLSN-LQQ 145
Cdd:PRK15370 175 CLKNNKTELRLKILGLTTIPaCIPEQITTLILDNNELKSLPENLQGN---IKTLYANSNQLTS------IPATLPDtIQE 245
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   146 LHLEHNNLEEFPFPLPKSLERLLLGYNEISILPTNAMDGLvnvTMLDLCYNHLsdSMLKEKTLSkmeKLMQLNLCNNRLE 225
Cdd:PRK15370 246 MELSINRITELPERLPSALQSLDLFHNKISCLPENLPEEL---RYLSVYDNSI--RTLPAHLPS---GITHLNVQSNSLT 317
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 6754934   226 SMPLGLPSSLMYLSLENNSISSIPDNYfdkLPKLHALRISHNKLEDIPYDIfnLSNLIELNVGHNKLKQafyIPRNL 302
Cdd:PRK15370 318 ALPETLPPGLKTLEAGENALTSLPASL---PPELQVLDVSKNQITVLPETL--PPTITTLDVSRNALTN---LPENL 386
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
109-312 9.07e-16

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223  Cd Length: 394  Bit Score: 78.47  E-value: 9.07e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  109 NSFINATHLKEINLSHNKIKSqkiDYGVFAKLSNLQQLHLEHNN---LEEFPFPLPKSLERLLLGYNEISILPTNaMDGL 185
Cdd:COG4886  87 ENLLNLLPLPSLDLNLNRLRS---NISELLELTNLTSLDLDNNNitdIPPLIGLLKSNLKELDLSDNKIESLPSP-LRNL 162
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  186 VNVTMLDLCYNHLSDsmlKEKTLSKMEKLMQLNLCNNRLESMP--LGLPSSLMYLSLENNSISSIPDNYFdKLPKLHALR 263
Cdd:COG4886 163 PNLKNLDLSFNDLSD---LPKLLSNLSNLNNLDLSGNKISDLPpeIELLSALEELDLSNNSIIELLSSLS-NLKNLSGLE 238
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|.
gi 6754934  264 ISHNKLEDIPYDIFNLSNLIELNVGHNKLKQAFYIP--RNLEHLYLQNNEI 312
Cdd:COG4886 239 LSNNKLEDLPESIGNLSNLETLDLSNNQISSISSLGslTNLRELDLSGNSL 289
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
92-307 7.90e-14

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223  Cd Length: 394  Bit Score: 72.69  E-value: 7.90e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   92 HIQQLNLQFNDIEAVTANSFINATHLKEINLSHNKIKSQKIDygvFAKLSNLQQLHLEHNNLEEFPF--PLPKSLERLLL 169
Cdd:COG4886 117 NLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSP---LRNLPNLKNLDLSFNDLSDLPKllSNLSNLNNLDL 193
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  170 GYNEISILPTNaMDGLVNVTMLDLCYNHLSDSMLKEKTLSKMEklmQLNLCNNRLESMP--LGLPSSLMYLSLENNSISS 247
Cdd:COG4886 194 SGNKISDLPPE-IELLSALEELDLSNNSIIELLSSLSNLKNLS---GLELSNNKLEDLPesIGNLSNLETLDLSNNQISS 269
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  248 IPdnYFDKLPKLHALRISHNKLEDIPYDIFNLSNLIELNVGHNKLKQAFYIPRNLEHLYL 307
Cdd:COG4886 270 IS--SLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLLNLLLTLKALELKLNSILLNN 327
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
92-310 4.57e-10

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061  Cd Length: 968  Bit Score: 61.40  E-value: 4.57e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934    92 HIQQLNLQFNDIEAVTANSFINATHLKEINLSHNKIkSQKIDYGVFAKLSNLQQLHLEHNNleeFPFPLPKS----LERL 167
Cdd:PLN00113  70 RVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQL-SGPIPDDIFTTSSSLRYLNLSNNN---FTGSIPRGsipnLETL 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   168 LLG--------YNEISI--------LPTNAMDG-----LVNVTMLD---LCYNHLSDSMLKEktLSKMEKLMQLNLCNNR 223
Cdd:PLN00113 146 DLSnnmlsgeiPNDIGSfsslkvldLGGNVLVGkipnsLTNLTSLEfltLASNQLVGQIPRE--LGQMKSLKWIYLGYNN 223
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   224 LE-SMP--LGLPSSLMYLSL-ENNSISSIPDNyFDKLPKLHALRISHNKLED-IPYDIFNLSNLIELNVGHNKLKQAfyI 298
Cdd:PLN00113 224 LSgEIPyeIGGLTSLNHLDLvYNNLTGPIPSS-LGNLKNLQYLFLYQNKLSGpIPPSIFSLQKLISLDLSDNSLSGE--I 300
                        250
                 ....*....|....*...
gi 6754934   299 P------RNLEHLYLQNN 310
Cdd:PLN00113 301 PelviqlQNLEILHLFSN 318
LRR_8 pfam13855
Leucine rich repeat;
96-153 2.46e-09

Leucine rich repeat;


Pssm-ID: 316378  Cd Length: 61  Bit Score: 54.46  E-value: 2.46e-09
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 6754934     96 LNLQFNDIEAVTANSFINATHLKEINLSHNKIKSqkIDYGVFAKLSNLQQLHLEHNNL 153
Cdd:pfam13855   6 LDLSNNRLTVLDDGAFKGLSNLKVLDLSNNLLTT--LSPGAFSGLPSLRYLDLSGNRL 61
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
213-349 3.58e-09

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223  Cd Length: 394  Bit Score: 58.06  E-value: 3.58e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  213 KLMQLNLCNNRLESMPLGLP--SSLMYLSLENNSISSIPDNYFDKLPKLHALRISHNKLEDIPYDIFNLSNLIELNVGHN 290
Cdd:COG4886  94 PLPSLDLNLNRLRSNISELLelTNLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFN 173
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 6754934  291 KLKQAF---YIPRNLEHLYLQNNEIESINVTMICPSpdpvhhhHLTYLRVDQNKLKEPISSY 349
Cdd:COG4886 174 DLSDLPkllSNLSNLNNLDLSGNKISDLPPEIELLS-------ALEELDLSNNSIIELLSSL 228
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
92-292 7.30e-09

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061  Cd Length: 968  Bit Score: 57.55  E-value: 7.30e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934    92 HIQQLNLQFNDIEAVTANSFINATHLKEINLSHNKIkSQKIDYGvFAKLSNLQQLHLEHNNL----EEFPFPLPkSLERL 167
Cdd:PLN00113 381 NLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSF-SGELPSE-FTKLPLVYFLDISNNNLqgriNSRKWDMP-SLQML 457
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   168 LLGYNEIS-ILPTNAmdGLVNVTMLDLCYNHLSDSMlkEKTLSKMEKLMQLNLCNNRLES-MPLGLPS--SLMYLSLENN 243
Cdd:PLN00113 458 SLARNKFFgGLPDSF--GSKRLENLDLSRNQFSGAV--PRKLGSLSELMQLKLSENKLSGeIPDELSSckKLVSLDLSHN 533
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 6754934   244 SIS-SIPDNyFDKLPKLHALRISHNKLE-DIPYDIFNLSNLIELNVGHNKL 292
Cdd:PLN00113 534 QLSgQIPAS-FSEMPVLSQLDLSQNQLSgEIPKNLGNVESLVQVNISHNHL 583
PRK15370 PRK15370
E3 ubiquitin-protein ligase SlrP; Provisional
141-319 7.69e-09

E3 ubiquitin-protein ligase SlrP; Provisional


Pssm-ID: 185268  Cd Length: 754  Bit Score: 57.40  E-value: 7.69e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   141 SNLQQLHLEHNNLEEFPFPLPKSLERLLLGYNEISILPTNAMdglVNVTMLDLCYNHLSDSmlkEKTLSKMEKLMQLNLc 220
Cdd:PRK15370 178 NNKTELRLKILGLTTIPACIPEQITTLILDNNELKSLPENLQ---GNIKTLYANSNQLTSI---PATLPDTIQEMELSI- 250
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   221 nNRLESMPLGLPSSLMYLSLENNSISSIPDNyfdkLPK-LHALRISHNKLEDIPYdifnlsnlielnvghnklkqafYIP 299
Cdd:PRK15370 251 -NRITELPERLPSALQSLDLFHNKISCLPEN----LPEeLRYLSVYDNSIRTLPA----------------------HLP 303
                        170       180
                 ....*....|....*....|
gi 6754934   300 RNLEHLYLQNNEIESINVTM 319
Cdd:PRK15370 304 SGITHLNVQSNSLTALPETL 323
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
89-312 7.58e-08

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061  Cd Length: 968  Bit Score: 54.47  E-value: 7.58e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934    89 IPMHIQQL-NLQF-----NDIEAVTANSFINATHLKEINLSHNKIKSQKIDygVFAKLSNLQQLHLEHNNLE-EFPFPLp 161
Cdd:PLN00113 252 IPSSLGNLkNLQYlflyqNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPE--LVIQLQNLEILHLFSNNFTgKIPVAL- 328
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   162 KSLERLllgynEISILPTNAMDGLV--------NVTMLDLCYNHLSDSMlkEKTLSKMEKLMQLNLCNNRLES-MP--LG 230
Cdd:PLN00113 329 TSLPRL-----QVLQLWSNKFSGEIpknlgkhnNLTVLDLSTNNLTGEI--PEGLCSSGNLFKLILFSNSLEGeIPksLG 401
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   231 LPSSLMYLSLENNSISSIPDNYFDKLPKLHALRISHNKLE-DIPYDIFNLSNLIELNVGHNK----LKQAFYiPRNLEHL 305
Cdd:PLN00113 402 ACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQgRINSRKWDMPSLQMLSLARNKffggLPDSFG-SKRLENL 480

                 ....*..
gi 6754934   306 YLQNNEI 312
Cdd:PLN00113 481 DLSRNQF 487
LRR_8 pfam13855
Leucine rich repeat;
213-269 2.51e-07

Leucine rich repeat;


Pssm-ID: 316378  Cd Length: 61  Bit Score: 48.68  E-value: 2.51e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 6754934    213 KLMQLNLCNNRLESMP----LGLPSsLMYLSLENNSISSIPDNYFDKLPKLHALRISHNKL 269
Cdd:pfam13855   2 NLRSLDLSNNRLTVLDdgafKGLSN-LKVLDLSNNLLTTLSPGAFSGLPSLRYLDLSGNRL 61
LRR_8 pfam13855
Leucine rich repeat;
233-292 3.58e-07

Leucine rich repeat;


Pssm-ID: 316378  Cd Length: 61  Bit Score: 48.29  E-value: 3.58e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 6754934    233 SSLMYLSLENNSISSIPDNYFDKLPKLHALRISHNKLEDI-PYDIFNLSNLIELNVGHNKL 292
Cdd:pfam13855   1 PNLRSLDLSNNRLTVLDDGAFKGLSNLKVLDLSNNLLTTLsPGAFSGLPSLRYLDLSGNRL 61
PRK15387 PRK15387
E3 ubiquitin-protein ligase SspH2; Provisional
141-348 3.86e-07

E3 ubiquitin-protein ligase SspH2; Provisional


Pssm-ID: 185285  Cd Length: 788  Bit Score: 52.09  E-value: 3.86e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   141 SNLQQLHLEHNNLEEFPfPLPKSLERLLLGYNEISILPTnAMDGLVNVTMLDLCYNHLSdsmlkektlSKMEKLMQLNLC 220
Cdd:PRK15387 222 AHITTLVIPDNNLTSLP-ALPPELRTLEVSGNQLTSLPV-LPPGLLELSIFSNPLTHLP---------ALPSGLCKLWIF 290
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   221 NNRLESMPLgLPSSLMYLSLENNSISSIPdnyfdKLP-KLHALRISHNKLEDIPYdifNLSNLIELNVGHNKLKQAFYIP 299
Cdd:PRK15387 291 GNQLTSLPV-LPPGLQELSVSDNQLASLP-----ALPsELCKLWAYNNQLTSLPT---LPSGLQELSVSDNQLASLPTLP 361
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 6754934   300 RNLEHLYLQNNEIESINVTMICPSPDPVHHHHLTYLRVDQNKLKEPISS 348
Cdd:PRK15387 362 SELYKLWAYNNRLTSLPALPSGLKELIVSGNRLTSLPVLPSELKELMVS 410
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
136-342 4.94e-07

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064  Cd Length: 319  Bit Score: 51.20  E-value: 4.94e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  136 VFAKLSNLQQLHLEHNNL--EEFPF-----PLPKSLERLLLGYNEISILPTN---AMDGL---VNVTMLDLCYNHLS-DS 201
Cdd:cd00116  18 LLPKLLCLQVLRLEGNTLgeEAAKAlasalRPQPSLKELCLSLNETGRIPRGlqsLLQGLtkgCGLQELDLSDNALGpDG 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  202 MLKEKTLSKMEKLMQLNLCNNRLESMPL-----GLPSSLMYLS---LENNSISSIP----DNYFDKLPKLHALRISHNKL 269
Cdd:cd00116  98 CGVLESLLRSSSLQELKLNNNGLGDRGLrllakGLKDLPPALEklvLGRNRLEGAScealAKALRANRDLKELNLANNGI 177
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 6754934  270 ED--IPYdifnlsnlielnvghnkLKQAFYIPRNLEHLYLQNNEIESINVTMICPSPDpvHHHHLTYLRVDQNKL 342
Cdd:cd00116 178 GDagIRA-----------------LAEGLKANCNLEVLDLNNNGLTDEGASALAETLA--SLKSLEVLNLGDNNL 233
LRR_8 pfam13855
Leucine rich repeat;
141-198 5.10e-07

Leucine rich repeat;


Pssm-ID: 316378  Cd Length: 61  Bit Score: 47.91  E-value: 5.10e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 6754934    141 SNLQQLHLEHNNLEEFP---FPLPKSLERLLLGYNEISILPTNAMDGLVNVTMLDLCYNHL 198
Cdd:pfam13855   1 PNLRSLDLSNNRLTVLDdgaFKGLSNLKVLDLSNNLLTTLSPGAFSGLPSLRYLDLSGNRL 61
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
93-342 3.57e-06

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061  Cd Length: 968  Bit Score: 49.08  E-value: 3.57e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934    93 IQQLNLQFNDIEAVTANSFInaTHLKEINLSHNKIkSQKI--DYGVF---------------------AKLSNLQQLHLE 149
Cdd:PLN00113 120 LRYLNLSNNNFTGSIPRGSI--PNLETLDLSNNML-SGEIpnDIGSFsslkvldlggnvlvgkipnslTNLTSLEFLTLA 196
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   150 HNNLE-EFPFPLP--KSLERLLLGYNEISILPTNAMDGLVNVTMLDLCYNHLSDSMlkektlskmeklmqlnlcnnrleS 226
Cdd:PLN00113 197 SNQLVgQIPRELGqmKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPI-----------------------P 253
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   227 MPLGLPSSLMYLSLENNSIS-SIPDNYFDkLPKLHALRISHNKLE-DIPYDIFNLSNLIELNVGHNKLKQAfyIPRNLEH 304
Cdd:PLN00113 254 SSLGNLKNLQYLFLYQNKLSgPIPPSIFS-LQKLISLDLSDNSLSgEIPELVIQLQNLEILHLFSNNFTGK--IPVALTS 330
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 6754934   305 L-YLQNNEIESINVTMICPSpDPVHHHHLTYLRVDQNKL 342
Cdd:PLN00113 331 LpRLQVLQLWSNKFSGEIPK-NLGKHNNLTVLDLSTNNL 368
LRRNT smart00013
Leucine rich repeat N-terminal domain;
61-94 1.94e-05

Leucine rich repeat N-terminal domain;


Pssm-ID: 214470  Cd Length: 33  Bit Score: 42.69  E-value: 1.94e-05
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 6754934      61 GCAKECFCPtnfPTSMYCDNRKLKTIPI-IPMHIQ 94
Cdd:smart00013   1 ACPAPCNCS---GTAVDCSGRGLTEVPLdLPPDTT 32
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
93-246 2.64e-05

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061  Cd Length: 968  Bit Score: 46.38  E-value: 2.64e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934    93 IQQLNLQFNDIEAVTANSFINATHLKEINLSHNKIKSQKIDYgvFAKLSNLQQLHLEHNNLE-EFPfplpkslerllLGY 171
Cdd:PLN00113 477 LENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDE--LSSCKKLVSLDLSHNQLSgQIP-----------ASF 543
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 6754934   172 NEISILptnamdglvnvTMLDLCYNHLSDSMlkEKTLSKMEKLMQLNLCNNRLESmplGLPSSLMYLSLENNSIS 246
Cdd:PLN00113 544 SEMPVL-----------SQLDLSQNQLSGEI--PKNLGNVESLVQVNISHNHLHG---SLPSTGAFLAINASAVA 602
PRK15387 PRK15387
E3 ubiquitin-protein ligase SspH2; Provisional
82-251 5.44e-05

E3 ubiquitin-protein ligase SspH2; Provisional


Pssm-ID: 185285  Cd Length: 788  Bit Score: 45.15  E-value: 5.44e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934    82 KLKTIPIIPMHIQQLNLQFNDIEAVTANSfinaTHLKEINLSHNKIKSqkidygVFAKLSNLQQLHLEHNNLEEFPfPLP 161
Cdd:PRK15387 293 QLTSLPVLPPGLQELSVSDNQLASLPALP----SELCKLWAYNNQLTS------LPTLPSGLQELSVSDNQLASLP-TLP 361
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   162 KSLERLLLGYNEISILPTNAmdglvnvtmldlcyNHLSDSMLKEKTLSKM----EKLMQLNLCNNRLESMPLgLPSSLMY 237
Cdd:PRK15387 362 SELYKLWAYNNRLTSLPALP--------------SGLKELIVSGNRLTSLpvlpSELKELMVSGNRLTSLPM-LPSGLLS 426
                        170
                 ....*....|....
gi 6754934   238 LSLENNSISSIPDN 251
Cdd:PRK15387 427 LSVYRNQLTRLPES 440
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
142-302 9.02e-05

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061  Cd Length: 968  Bit Score: 44.84  E-value: 9.02e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   142 NLQQLHLEHNNLE-EFPFPLP--KSLERLLLGYNEIS----------------ILPTNAMDGLVN--------VTMLDLC 194
Cdd:PLN00113 381 NLFKLILFSNSLEgEIPKSLGacRSLRRVRLQDNSFSgelpseftklplvyflDISNNNLQGRINsrkwdmpsLQMLSLA 460
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   195 YNHLSDSMlkeKTLSKMEKLMQLNLCNNRL-ESMPLGLP--SSLMYLSLENNSISS-IPDNyFDKLPKLHALRISHNKLE 270
Cdd:PLN00113 461 RNKFFGGL---PDSFGSKRLENLDLSRNQFsGAVPRKLGslSELMQLKLSENKLSGeIPDE-LSSCKKLVSLDLSHNQLS 536
                        170       180       190
                 ....*....|....*....|....*....|...
gi 6754934   271 -DIPYDIFNLSNLIELNVGHNKLKQAfyIPRNL 302
Cdd:PLN00113 537 gQIPASFSEMPVLSQLDLSQNQLSGE--IPKNL 567
PRK15387 PRK15387
E3 ubiquitin-protein ligase SspH2; Provisional
217-317 5.44e-04

E3 ubiquitin-protein ligase SspH2; Provisional


Pssm-ID: 185285  Cd Length: 788  Bit Score: 42.07  E-value: 5.44e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934   217 LNLCNNRLESMPLGLPSSLMYLSLENNSISSIPdnyfDKLPKLHALRISHNKLEDIPydiFNLSNLIELNVGHNKLKQAF 296
Cdd:PRK15387 206 LNVGESGLTTLPDCLPAHITTLVIPDNNLTSLP----ALPPELRTLEVSGNQLTSLP---VLPPGLLELSIFSNPLTHLP 278
                         90       100
                 ....*....|....*....|.
gi 6754934   297 YIPRNLEHLYLQNNEIESINV 317
Cdd:PRK15387 279 ALPSGLCKLWIFGNQLTSLPV 299
LRRNT pfam01462
Leucine rich repeat N-terminal domain; Leucine Rich Repeats pfam00560 are short sequence ...
61-90 7.49e-04

Leucine rich repeat N-terminal domain; Leucine Rich Repeats pfam00560 are short sequence motifs present in a number of proteins with diverse functions and cellular locations. Leucine Rich Repeats are often flanked by cysteine rich domains. This domain is often found at the N-terminus of tandem leucine rich repeats.


Pssm-ID: 279764  Cd Length: 28  Bit Score: 38.37  E-value: 7.49e-04
                          10        20        30
                  ....*....|....*....|....*....|.
gi 6754934     61 GCAKECFCPtnfPTSMYCDNRKLKTIPI-IP 90
Cdd:pfam01462   1 ACPVPCHCS---ATVVNCSDRGLTAVPSdLP 28
LRR_8 pfam13855
Leucine rich repeat;
187-245 9.03e-04

Leucine rich repeat;


Pssm-ID: 316378  Cd Length: 61  Bit Score: 38.28  E-value: 9.03e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 6754934    187 NVTMLDLCYNHLSDsmLKEKTLSKMEKLMQLNLCNNRLESMPL----GLPsSLMYLSLENNSI 245
Cdd:pfam13855   2 NLRSLDLSNNRLTV--LDDGAFKGLSNLKVLDLSNNLLTTLSPgafsGLP-SLRYLDLSGNRL 61
LRR_8 pfam13855
Leucine rich repeat;
163-224 2.79e-03

Leucine rich repeat;


Pssm-ID: 316378  Cd Length: 61  Bit Score: 36.74  E-value: 2.79e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 6754934    163 SLERLLLGYNEISILPTNAMDGLVNVTMLDLCYNHLSDsmLKEKTLSKMEKLMQLNLCNNRL 224
Cdd:pfam13855   2 NLRSLDLSNNRLTVLDDGAFKGLSNLKVLDLSNNLLTT--LSPGAFSGLPSLRYLDLSGNRL 61
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
107-224 8.42e-03

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064  Cd Length: 319  Bit Score: 37.72  E-value: 8.42e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754934  107 TANSFINATHLKEINLSHNKIKSQKIDYGV--FAKLSNLQQLHLEHNNLEE-------FPFPLPKSLERLLLGYNEISIL 177
Cdd:cd00116 157 LAKALRANRDLKELNLANNGIGDAGIRALAegLKANCNLEVLDLNNNGLTDegasalaETLASLKSLEVLNLGDNNLTDA 236
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*
gi 6754934  178 PTNAMD-----GLVNVTMLDLCYNHLSDS---MLKEkTLSKMEKLMQLNLCNNRL 224
Cdd:cd00116 237 GAAALAsallsPNISLLTLSLSCNDITDDgakDLAE-VLAEKESLLELDLRGNKF 290
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH