NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|66932947|ref|NP_000005|]
View 

alpha-2-macroglobulin isoform a precursor [Homo sapiens]

Protein Classification

A2M and A2M_2 domain-containing protein (domain architecture ID 10486335)

protein containing domains A2M_N, A2M, A2M_2, and A2M_recep

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
A2M_2 cd02897
Proteins similar to alpha2-macroglobulin (alpha (2)-M). This group also contains the pregnancy ...
958-1264 1.01e-155

Proteins similar to alpha2-macroglobulin (alpha (2)-M). This group also contains the pregnancy zone protein (PZP). Alpha(2)-M and PZP are broadly specific proteinase inhibitors. Alpha (2)-M is a major carrier protein in serum. The structural thioester of alpha (2)-M, is involved in the immobilization and entrapment of proteases. PZP is a trace protein in the plasma of non-pregnant females and males which is elevated in pregnancy. Alpha (2)-M and PZ bind to placental protein-14 and may modulate its activity in T-cell growth and cytokine production contributing to fetal survival. It has been suggested that thioester bond cleavage promotes the binding of PZ and alpha (2)-M to the CD91 receptor clearing them from circulation.


:

Pssm-ID: 239227  Cd Length: 292  Bit Score: 476.69  E-value: 1.01e-155
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  958 AMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGrnQG 1037
Cdd:cd02897    1 ALQNLDNLLRMPYGCGEQNMVNFAPNIYVLDYLKATGQLTPEIESKALGFLRTGYQRQLTYKHSDGSYSAFGESDK--SG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1038 NTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVT 1117
Cdd:cd02897   79 STWLTAFVLKSFAQARPFIYIDENVLQQALTWLSSHQKSNGCFREVGRVFHKAMQGGVDDEVALTAYVLIALLEAGLPSE 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1118 HPVVRNALFCLESAWKTAqegdhgSHVYTKALLAYAFALAGnQDKRKEVLKSLNEEAVKKDNSVHWERPqkPKAPVGHFY 1197
Cdd:cd02897  159 RPVVEKALSCLEAALDSI------SDPYTLALAAYALTLAG-SEKRPEALKKLDELAISEDGTKHWSRP--PPSEEGPSY 229
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 66932947 1198 EPQAPSAEVEMTSYVLLAYLTAQPaptsEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKY 1264
Cdd:cd02897  230 YWQAPSAEVEMTAYALLALLSAGG----EDLAEALPIVKWLAKQRNSLGGFSSTQDTVVALQALAKY 292
A2M pfam00207
Alpha-2-macroglobulin family; This family includes the C-terminal region of the ...
738-828 4.70e-39

Alpha-2-macroglobulin family; This family includes the C-terminal region of the alpha-2-macroglobulin family.


:

Pssm-ID: 306673  Cd Length: 91  Bit Score: 143.49  E-value: 4.70e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    738 TWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNY 817
Cdd:pfam00207    1 TWLWDPVLVTDSGKATLSFTVPDSITTWRVTAFALSPDLGLGVAEPPEVTVFKPFFVDLNLPYSVRRGEQVEIPATVFNY 80
                           90
                   ....*....|.
gi 66932947    818 LPKCIRVSVQL 828
Cdd:pfam00207   81 LGKAIKVRVTL 91
A2M_recep pfam07677
A-macroglobulin receptor; This family includes the receptor domain region of the ...
1376-1463 1.56e-31

A-macroglobulin receptor; This family includes the receptor domain region of the alpha-2-macroglobulin family.


:

Pssm-ID: 311553  Cd Length: 86  Bit Score: 121.50  E-value: 1.56e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947   1376 SNMAIVDVKMVSGFIPLKPTvkmLERSNHVSRTE-VSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVKVYDYYE 1454
Cdd:pfam07677    1 SNMAILEVGLPSGFVPDEED---LKDDRLIKRVEtVDDGKVILYLDKLSKEETCVSFRAEQTFPVANLQPAPVKVYDYYE 77

                   ....*....
gi 66932947   1455 TDEFAIAEY 1463
Cdd:pfam07677   78 PERRATTFY 86
A2M_N pfam01835
MG2 domain; This is the MG2 (macroglobulin) domain of alpha-2-macroglobulin.
129-221 2.72e-26

MG2 domain; This is the MG2 (macroglobulin) domain of alpha-2-macroglobulin.


:

Pssm-ID: 307790  Cd Length: 96  Bit Score: 106.97  E-value: 2.72e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    129 VFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQ 208
Cdd:pfam01835    2 AFVYTDRGIYRPGETVHFRALLRDQDGRPLAGLPLTLTITDPDGNEVRRLTLTTDEFGGFSGSFPLPENAPTGTWTIVLK 81
                           90
                   ....*....|....*
gi 66932947    209 KKSGGR--TEHPFTV 221
Cdd:pfam01835   82 DDGDGGslGSGSFRV 96
A2M_N_2 pfam07703
Alpha-2-macroglobulin family N-terminal region; This family includes a region of the ...
459-607 6.22e-24

Alpha-2-macroglobulin family N-terminal region; This family includes a region of the alpha-2-macroglobulin family.


:

Pssm-ID: 311575  Cd Length: 133  Bit Score: 101.16  E-value: 6.22e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    459 VHLEPMSHELPCGHTQTVQAHYILNGGTLLGLKKlsfyYLIMAKGGIVRTGTHGllvkqedmkghFSISIPVKSDIAPVA 538
Cdd:pfam07703    1 LKLSPDKKEYKPGETAKVTVRSPFPGAALVTVEG----DGVLSKGVIVSGGVSS-----------TSFSIPVTADMAPNA 65
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    539 RLLIYAVLPTGDVIGDSAKYDVEnCLANKVDLSFSPSQS-LPASHAHLRVTAAPqSVCALRAVDQSVLLM 607
Cdd:pfam07703   66 YVSVVYYRPGPERVADSVWLPVE-CFENKLSVSLTAPKSyRPGETVTLKVKVKP-SLVALAAVDEGVLLL 133
 
Name Accession Description Interval E-value
A2M_2 cd02897
Proteins similar to alpha2-macroglobulin (alpha (2)-M). This group also contains the pregnancy ...
958-1264 1.01e-155

Proteins similar to alpha2-macroglobulin (alpha (2)-M). This group also contains the pregnancy zone protein (PZP). Alpha(2)-M and PZP are broadly specific proteinase inhibitors. Alpha (2)-M is a major carrier protein in serum. The structural thioester of alpha (2)-M, is involved in the immobilization and entrapment of proteases. PZP is a trace protein in the plasma of non-pregnant females and males which is elevated in pregnancy. Alpha (2)-M and PZ bind to placental protein-14 and may modulate its activity in T-cell growth and cytokine production contributing to fetal survival. It has been suggested that thioester bond cleavage promotes the binding of PZ and alpha (2)-M to the CD91 receptor clearing them from circulation.


Pssm-ID: 239227  Cd Length: 292  Bit Score: 476.69  E-value: 1.01e-155
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  958 AMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGrnQG 1037
Cdd:cd02897    1 ALQNLDNLLRMPYGCGEQNMVNFAPNIYVLDYLKATGQLTPEIESKALGFLRTGYQRQLTYKHSDGSYSAFGESDK--SG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1038 NTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVT 1117
Cdd:cd02897   79 STWLTAFVLKSFAQARPFIYIDENVLQQALTWLSSHQKSNGCFREVGRVFHKAMQGGVDDEVALTAYVLIALLEAGLPSE 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1118 HPVVRNALFCLESAWKTAqegdhgSHVYTKALLAYAFALAGnQDKRKEVLKSLNEEAVKKDNSVHWERPqkPKAPVGHFY 1197
Cdd:cd02897  159 RPVVEKALSCLEAALDSI------SDPYTLALAAYALTLAG-SEKRPEALKKLDELAISEDGTKHWSRP--PPSEEGPSY 229
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 66932947 1198 EPQAPSAEVEMTSYVLLAYLTAQPaptsEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKY 1264
Cdd:cd02897  230 YWQAPSAEVEMTAYALLALLSAGG----EDLAEALPIVKWLAKQRNSLGGFSSTQDTVVALQALAKY 292
A2M_comp pfam07678
A-macroglobulin complement component; This family includes the complement components region of ...
1010-1266 2.96e-124

A-macroglobulin complement component; This family includes the complement components region of the alpha-2-macroglobulin family.


Pssm-ID: 311554  Cd Length: 247  Bit Score: 389.70  E-value: 2.96e-124
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947   1010 TGYQRQLNYKHYDGSYSTFGERYgrnQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNN 1089
Cdd:pfam07678    1 IGYQRQLSYKHDDGSYSAFGSDG---PGSTWLTAFVLKVFSQARKFIFIDEEHICQSLRWLLSKQKEDGSFREVGPLLNR 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947   1090 AIKGGVEDEVTLSAYITIALLEI----PLTVTHPVVRNALFCLESAwktaqeGDHGSHVYTKALLAYAFALAGNQDKRKE 1165
Cdd:pfam07678   78 AMKGGVDDEVTLTAYVTIALLEAgdinLLPRVHPSIRKALFYLERA------LEGLTSPYTKAILAYALALAGKSPQAEE 151
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947   1166 VLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQpaptsEDLTSATNIVKWITKQQNAQ 1245
Cdd:pfam07678  152 ALKSLDALAQEEGNSRYWERDEKPKPPEKPLNWYWAPSLEVETTAYALLAYLSLE-----GDLTYADPIVKWLTSQRNSH 226
                          250       260
                   ....*....|....*....|.
gi 66932947   1246 GGFSSTQDTVVALHALSKYGA 1266
Cdd:pfam07678  227 GGFSSTQDTVVALQALSEYSA 247
A2M pfam00207
Alpha-2-macroglobulin family; This family includes the C-terminal region of the ...
738-828 4.70e-39

Alpha-2-macroglobulin family; This family includes the C-terminal region of the alpha-2-macroglobulin family.


Pssm-ID: 306673  Cd Length: 91  Bit Score: 143.49  E-value: 4.70e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    738 TWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNY 817
Cdd:pfam00207    1 TWLWDPVLVTDSGKATLSFTVPDSITTWRVTAFALSPDLGLGVAEPPEVTVFKPFFVDLNLPYSVRRGEQVEIPATVFNY 80
                           90
                   ....*....|.
gi 66932947    818 LPKCIRVSVQL 828
Cdd:pfam00207   81 LGKAIKVRVTL 91
A2M_recep pfam07677
A-macroglobulin receptor; This family includes the receptor domain region of the ...
1376-1463 1.56e-31

A-macroglobulin receptor; This family includes the receptor domain region of the alpha-2-macroglobulin family.


Pssm-ID: 311553  Cd Length: 86  Bit Score: 121.50  E-value: 1.56e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947   1376 SNMAIVDVKMVSGFIPLKPTvkmLERSNHVSRTE-VSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVKVYDYYE 1454
Cdd:pfam07677    1 SNMAILEVGLPSGFVPDEED---LKDDRLIKRVEtVDDGKVILYLDKLSKEETCVSFRAEQTFPVANLQPAPVKVYDYYE 77

                   ....*....
gi 66932947   1455 TDEFAIAEY 1463
Cdd:pfam07677   78 PERRATTFY 86
A2M_N pfam01835
MG2 domain; This is the MG2 (macroglobulin) domain of alpha-2-macroglobulin.
129-221 2.72e-26

MG2 domain; This is the MG2 (macroglobulin) domain of alpha-2-macroglobulin.


Pssm-ID: 307790  Cd Length: 96  Bit Score: 106.97  E-value: 2.72e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    129 VFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQ 208
Cdd:pfam01835    2 AFVYTDRGIYRPGETVHFRALLRDQDGRPLAGLPLTLTITDPDGNEVRRLTLTTDEFGGFSGSFPLPENAPTGTWTIVLK 81
                           90
                   ....*....|....*
gi 66932947    209 KKSGGR--TEHPFTV 221
Cdd:pfam01835   82 DDGDGGslGSGSFRV 96
A2M_N_2 pfam07703
Alpha-2-macroglobulin family N-terminal region; This family includes a region of the ...
459-607 6.22e-24

Alpha-2-macroglobulin family N-terminal region; This family includes a region of the alpha-2-macroglobulin family.


Pssm-ID: 311575  Cd Length: 133  Bit Score: 101.16  E-value: 6.22e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    459 VHLEPMSHELPCGHTQTVQAHYILNGGTLLGLKKlsfyYLIMAKGGIVRTGTHGllvkqedmkghFSISIPVKSDIAPVA 538
Cdd:pfam07703    1 LKLSPDKKEYKPGETAKVTVRSPFPGAALVTVEG----DGVLSKGVIVSGGVSS-----------TSFSIPVTADMAPNA 65
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    539 RLLIYAVLPTGDVIGDSAKYDVEnCLANKVDLSFSPSQS-LPASHAHLRVTAAPqSVCALRAVDQSVLLM 607
Cdd:pfam07703   66 YVSVVYYRPGPERVADSVWLPVE-CFENKLSVSLTAPKSyRPGETVTLKVKVKP-SLVALAAVDEGVLLL 133
YfaS COG2373
Uncharacterized conserved protein YfaS, alpha-2-macroglobulin family [General function ...
124-1071 2.25e-18

Uncharacterized conserved protein YfaS, alpha-2-macroglobulin family [General function prediction only];


Pssm-ID: 225248  Cd Length: 1621  Bit Score: 91.71  E-value: 2.25e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  124 NEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPL-VYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGS 202
Cdd:COG2373  391 GYGLKVYLFTDRGLYRPGETVHVNALLRDFDGKTALDNQPLkLRVLDPDGSVLRTLTITLDEEGLYELSFPLPENALTGG 470
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  203 YKVVVQKKSGGRT-EHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGE 281
Cdd:COG2373  471 YTLELYTGGKSAViSMSFRVEDFIPDRFKINLTLDKTEWVPGKDVKIKVDLRYLYGAPAAGLTVQGELDLRPTRFSVPGF 550
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  282 DSQAFcekfsgqlnshGCFYQQVKTKVFQLK--------RKEYEMKL-----HTEAQIQEEG-TVVELTGRQSSE----- 342
Cdd:COG2373  551 PGFTF-----------GLADEEPNSLTFEEEleltvtdgKGKASLDLdlaetPSPYQLLVASsEVEEDGGRAVTRslsvr 619
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  343 ITRTITKLSF-VKVDSHFRQGI-PFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQF------------S 408
Cdd:COG2373  620 VSPLDELIGVrPKFAADYVKDItPAKFSIIAVSADGSKVALKGLKLVLIEVKRNYNWTYSEGESWKYesveietviledT 699
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  409 INTTNVMGTSLTVRVNYKDRSPCygyqwVSEEHEEAHhtAYLVFSPSKSFVHLEPMSHELP--CGHTQTVQAHYILnggt 486
Cdd:COG2373  700 LDISANETTIITVPVGWGDYRLE-----VEDSDGGIL--ASVSFDVGGSGNDTVTGTPDVLklKLDKPEYQPGDTA---- 768
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  487 llgLKKLSFYYLImaKGGIVRTGTHGLLVKQ----------------EDMKGHFSISIPVKSDIAPVA---RLLIYAVLP 547
Cdd:COG2373  769 ---KLLITTPYAG--EEALITVESDKVIQVQllkvpangltleipvpAAWEHNAYVSVSFVRPGDASQsftPARAYGFVP 843
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  548 tgdvigdsAKYDVENclaNKVDLSF-SPSQSLPASHAHLRVTAA----PQSVCAL-RAVDQSVLlmkpdaelsassvynl 621
Cdd:COG2373  844 --------LPVDVKD---RRLDVQLkTPKKVKPGEPLTIKLSVSgaggPKSAYVTvAAVDEGIL---------------- 896
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  622 lpekDLTGFPGPlndqddedciNRHNVYINGITYtpvsSTNEKDMYSFLEDMGLKAftnskirkpkmcpqlqqyemhgpe 701
Cdd:COG2373  897 ----NLTGYEAP----------DPVKFFFGQRRL----GVETRDIYGRIIDGFQGV------------------------ 934
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  702 GLRVGFyesdvmGRGHARLVHVEEPHTetvRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAgLGiS 781
Cdd:COG2373  935 AKPLRT------GGDGGRAAKQGEPPT---RREKPVAAFSGIVETDAQGKATVTFPIPDFNGRLRVMAVAWTDGA-VG-Q 1003
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  782 STASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVsvqLEASPaflAVPVEKEQAPHCI--CANGRQTVSWA 859
Cdd:COG2373 1004 AEAELIVRKPVIVEASMPRFLAPGDRSSAGLDVFNLTGKAGDV---LTVEG---TLKFNGKEAPQTLtlAEGSATTLFFP 1077
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  860 VTPK-SLGNVNFTVSAEALESqelcgtevpsvpehgrkDTVIKPLLVEPEGLEKETTFNSLLCPsGGEVSEELSLKLPPN 938
Cdd:COG2373 1078 LRALdGSGKIDATLSVSGQVG-----------------DKLERHLNVRPAVPPQTQVKTVVLAP-GFTISGDLLAGLSPQ 1139
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  939 VVEESARASVSVLGDILGsamqNTQNLLQMPYGCGEQ-NMVLFApniyvLDYLNETQQLTPEIKSKAIGYLNTGYQRQLN 1017
Cdd:COG2373 1140 AVNAQLQLSGTPAADIAA----LLDVLDDYPYGCAEQtASRLLP-----LLYAQKATADPGAADNDLRARLQDAIGRLLS 1210
                        970       980       990      1000      1010
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 66932947 1018 YKHYDGSystFGERYGRNQGNTWLTAFVLKTFAQARA-YIFIDEAHITQALIWLS 1071
Cdd:COG2373 1211 LQGSNGA---FGLWGGNGSGDPWLTAYAVDFLLRAREqGYSVPSDALNQMLERLL 1262
 
Name Accession Description Interval E-value
A2M_2 cd02897
Proteins similar to alpha2-macroglobulin (alpha (2)-M). This group also contains the pregnancy ...
958-1264 1.01e-155

Proteins similar to alpha2-macroglobulin (alpha (2)-M). This group also contains the pregnancy zone protein (PZP). Alpha(2)-M and PZP are broadly specific proteinase inhibitors. Alpha (2)-M is a major carrier protein in serum. The structural thioester of alpha (2)-M, is involved in the immobilization and entrapment of proteases. PZP is a trace protein in the plasma of non-pregnant females and males which is elevated in pregnancy. Alpha (2)-M and PZ bind to placental protein-14 and may modulate its activity in T-cell growth and cytokine production contributing to fetal survival. It has been suggested that thioester bond cleavage promotes the binding of PZ and alpha (2)-M to the CD91 receptor clearing them from circulation.


Pssm-ID: 239227  Cd Length: 292  Bit Score: 476.69  E-value: 1.01e-155
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  958 AMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGrnQG 1037
Cdd:cd02897    1 ALQNLDNLLRMPYGCGEQNMVNFAPNIYVLDYLKATGQLTPEIESKALGFLRTGYQRQLTYKHSDGSYSAFGESDK--SG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1038 NTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVT 1117
Cdd:cd02897   79 STWLTAFVLKSFAQARPFIYIDENVLQQALTWLSSHQKSNGCFREVGRVFHKAMQGGVDDEVALTAYVLIALLEAGLPSE 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1118 HPVVRNALFCLESAWKTAqegdhgSHVYTKALLAYAFALAGnQDKRKEVLKSLNEEAVKKDNSVHWERPqkPKAPVGHFY 1197
Cdd:cd02897  159 RPVVEKALSCLEAALDSI------SDPYTLALAAYALTLAG-SEKRPEALKKLDELAISEDGTKHWSRP--PPSEEGPSY 229
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 66932947 1198 EPQAPSAEVEMTSYVLLAYLTAQPaptsEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKY 1264
Cdd:cd02897  230 YWQAPSAEVEMTAYALLALLSAGG----EDLAEALPIVKWLAKQRNSLGGFSSTQDTVVALQALAKY 292
A2M_comp pfam07678
A-macroglobulin complement component; This family includes the complement components region of ...
1010-1266 2.96e-124

A-macroglobulin complement component; This family includes the complement components region of the alpha-2-macroglobulin family.


Pssm-ID: 311554  Cd Length: 247  Bit Score: 389.70  E-value: 2.96e-124
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947   1010 TGYQRQLNYKHYDGSYSTFGERYgrnQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNN 1089
Cdd:pfam07678    1 IGYQRQLSYKHDDGSYSAFGSDG---PGSTWLTAFVLKVFSQARKFIFIDEEHICQSLRWLLSKQKEDGSFREVGPLLNR 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947   1090 AIKGGVEDEVTLSAYITIALLEI----PLTVTHPVVRNALFCLESAwktaqeGDHGSHVYTKALLAYAFALAGNQDKRKE 1165
Cdd:pfam07678   78 AMKGGVDDEVTLTAYVTIALLEAgdinLLPRVHPSIRKALFYLERA------LEGLTSPYTKAILAYALALAGKSPQAEE 151
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947   1166 VLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQpaptsEDLTSATNIVKWITKQQNAQ 1245
Cdd:pfam07678  152 ALKSLDALAQEEGNSRYWERDEKPKPPEKPLNWYWAPSLEVETTAYALLAYLSLE-----GDLTYADPIVKWLTSQRNSH 226
                          250       260
                   ....*....|....*....|.
gi 66932947   1246 GGFSSTQDTVVALHALSKYGA 1266
Cdd:pfam07678  227 GGFSSTQDTVVALQALSEYSA 247
A2M_like cd02891
Proteins similar to alpha2-macroglobulin (alpha (2)-M). Alpha (2)-M is a major carrier ...
958-1264 3.70e-106

Proteins similar to alpha2-macroglobulin (alpha (2)-M). Alpha (2)-M is a major carrier protein in serum. It is a broadly specific proteinase inhibitor. The structural thioester of alpha (2)-M, is involved in the immobilization and entrapment of proteases. This group contains another broadly specific proteinase inhibitor: pregnancy zone protein (PZP). PZP is a trace protein in the plasma of non-pregnant females and males which is elevated in pregnancy. Alpha (2)-M and PZ bind to placental protein-14 and may modulate its activity in T-cell growth and cytokine production thereby protecting the allogeneic fetus from attack by the maternal immune system. This group also contains C3, C4 and C5 of vertebrate complement. The vertebrate complement is an effector of both the acquired and innate immune systems The point of convergence of the classical, alternative and lectin pathways of the complement system is the proteolytic activation of C3. C4 plays a key role in propagating the classical and lectin pathways. C5 participates in the classical and alternative pathways. The thioester bond located within the structure of C3 and C4 is central to the function of complement. C5 does not contain an active thioester bond.


Pssm-ID: 239221  Cd Length: 282  Bit Score: 340.52  E-value: 3.70e-106
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  958 AMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGeryGRNQG 1037
Cdd:cd02891    1 SLGNLDYLLRYPYGCGEQTMSRAAPNLYVLKYLDATGQLTPEIREKALEYIRKGYQRLLTYQRSDGSFSAWG---NSDSG 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1038 NTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVt 1117
Cdd:cd02891   78 STWLTAYVVKFLSQARKYIDVDENVLARALGWLVPQQKEDGSFRELGPVIHREMKGGVDDSVSLTAYVLIALAEAGKAC- 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1118 HPVVRNALFCLESAWktaqegDHGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERpqkpkapvgHFY 1197
Cdd:cd02891  157 DASIEKALAYLETQL------DGLLDPYALAILAYALALAGDSTRADEALKKLLEAAREKGGTAHWSL---------SWP 221
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 66932947 1198 EPQAPSAEVEMTSYVLLAYLTAqpaptsEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKY 1264
Cdd:cd02891  222 GDYGSSLRVEATAYALLALLKL------GDLEEAGPIAKWLAQQRNSGGGFLSTQDTVVALQALAAY 282
complement_C3_C4_C5 cd02896
Proteins similar to C3, C4 and C5 of vertebrate complement. The vertebrate complement system, ...
961-1264 3.19e-70

Proteins similar to C3, C4 and C5 of vertebrate complement. The vertebrate complement system, comprised of a large number of distinct plasma proteins, is an effector of both the acquired and innate immune systems. The point of convergence of the classical, alternative and lectin pathways of the complement system is the proteolytic activation of C3. C4 plays a key role in propagating the classical and lectin pathways. C5 participates in the classical and alternative pathways. The thioester bond located within the structure of C3 and C4 is central to the function of complement. C5 does not contain an active thioester bond.


Pssm-ID: 239226  Cd Length: 297  Bit Score: 240.25  E-value: 3.19e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  961 NTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQ---LTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERygrnQG 1037
Cdd:cd02896    4 GLEKLIRLPTGCGEQTMIKLAPTVYALRYLDTTNQwekLGPERRDEALKYIRQGYQRQLSYRKPDGSYAAWKNR----PS 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1038 NTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGV---EDEVTLSAYITIALLEIpL 1114
Cdd:cd02896   80 STWLTAFVVKVFSLARKYIPVDQNVICGSVNWLISNQKPDGSFQEPSPVIHREMTGGVegsEGDVSLTAFVLIALQEA-R 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1115 TVTHPVVRNalfcLESAWKTAQE-----GDHGSHVYTKALLAYAFALAgNQDKRKEVLKSLNEEAVKKDNSVHWERPQKP 1189
Cdd:cd02896  159 SICPPEVQN----LDQSIRKAISylenqLPNLQRPYALAITAYALALA-DSPLSHAANRKLLSLAKRDGNGWYWWTIDSP 233
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 66932947 1190 kapvgHFYEPQAPSAEVEMTSYVLLAYLtaqpapTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKY 1264
Cdd:cd02896  234 -----YWPVPGPSAITVETTAYALLALL------KLGDIEYANPIARWLTEQRNYGGGFGSTQDTVVALQALAEY 297
ISOPREN_C2_like cd00688
This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two ...
958-1264 5.60e-60

This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement. Class II terpene cyclases include squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY), these integral membrane proteins catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. The protein prenyltransferases include protein farnesyltransferase (FTase) and geranylgeranyltransferase types I and II (GGTase-I and GGTase-II) which catalyze the carboxyl-terminal lipidation of Ras, Rab, and several other cellular signal transduction proteins, facilitating membrane associations and specific protein-protein interactions. Alpha (2)-M is a major carrier protein in serum and involved in the immobilization and entrapment of proteases. PZP is a pregnancy associated protein. Alpha (2)-M and PZP are known to bind to and, may modulate, the activity of placental protein-14 in T-cell growth and cytokine production thereby protecting the allogeneic fetus from attack by the maternal immune system.


Pssm-ID: 238362  Cd Length: 300  Bit Score: 211.26  E-value: 5.60e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  958 AMQNTQNLLQMPYG--------CGEQNMVLFAPNIYVLDYLNETqqltpEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFG 1029
Cdd:cd00688    1 IEKHLKYLLRYPYGdghwyqslCGEQTWSTAWPLLALLLLLAAT-----GIRDKADENIEKGIQRLLSYQLSDGGFSGWG 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1030 eryGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNaiKGGVEDEVTLSAYITIAL 1109
Cdd:cd00688   76 ---GNDYPSLWLTAYALKALLLAGDYIAVDRIDLARALNWLLSLQNEDGGFREDGPGNHR--IGGDESDVRLTAYALIAL 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1110 LEIPLTVTHPVVRNALFCLESawktAQEGDHG------SHVYTKALLAYAFALAG--NQDKRKEVLKSLNEEAVKKDNSV 1181
Cdd:cd00688  151 ALLGKLDPDPLIEKALDYLLS----CQNYDGGfgpggeSHGYGTACAAAALALLGdlDSPDAKKALRWLLSRQRPDGGWG 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947 1182 HWERPqkpkapvghfYEPQAPSAEVEMTSYVLLAYLTAqpaptsEDLTSATNIVKWITKQQNAQGGFSS-------TQDT 1254
Cdd:cd00688  227 EGRDR----------TNKLSDSCYTEWAAYALLALGKL------GDLEDAEKLVKWLLSQQNEDGGFSSkpgksydTQHT 290
                        330
                 ....*....|
gi 66932947 1255 VVALHALSKY 1264
Cdd:cd00688  291 VFALLALSLY 300
A2M pfam00207
Alpha-2-macroglobulin family; This family includes the C-terminal region of the ...
738-828 4.70e-39

Alpha-2-macroglobulin family; This family includes the C-terminal region of the alpha-2-macroglobulin family.


Pssm-ID: 306673  Cd Length: 91  Bit Score: 143.49  E-value: 4.70e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    738 TWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNY 817
Cdd:pfam00207    1 TWLWDPVLVTDSGKATLSFTVPDSITTWRVTAFALSPDLGLGVAEPPEVTVFKPFFVDLNLPYSVRRGEQVEIPATVFNY 80
                           90
                   ....*....|.
gi 66932947    818 LPKCIRVSVQL 828
Cdd:pfam00207   81 LGKAIKVRVTL 91
A2M_recep pfam07677
A-macroglobulin receptor; This family includes the receptor domain region of the ...
1376-1463 1.56e-31

A-macroglobulin receptor; This family includes the receptor domain region of the alpha-2-macroglobulin family.


Pssm-ID: 311553  Cd Length: 86  Bit Score: 121.50  E-value: 1.56e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947   1376 SNMAIVDVKMVSGFIPLKPTvkmLERSNHVSRTE-VSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVKVYDYYE 1454
Cdd:pfam07677    1 SNMAILEVGLPSGFVPDEED---LKDDRLIKRVEtVDDGKVILYLDKLSKEETCVSFRAEQTFPVANLQPAPVKVYDYYE 77

                   ....*....
gi 66932947   1455 TDEFAIAEY 1463
Cdd:pfam07677   78 PERRATTFY 86
A2M_N pfam01835
MG2 domain; This is the MG2 (macroglobulin) domain of alpha-2-macroglobulin.
129-221 2.72e-26

MG2 domain; This is the MG2 (macroglobulin) domain of alpha-2-macroglobulin.


Pssm-ID: 307790  Cd Length: 96  Bit Score: 106.97  E-value: 2.72e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    129 VFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQ 208
Cdd:pfam01835    2 AFVYTDRGIYRPGETVHFRALLRDQDGRPLAGLPLTLTITDPDGNEVRRLTLTTDEFGGFSGSFPLPENAPTGTWTIVLK 81
                           90
                   ....*....|....*
gi 66932947    209 KKSGGR--TEHPFTV 221
Cdd:pfam01835   82 DDGDGGslGSGSFRV 96
A2M_N_2 pfam07703
Alpha-2-macroglobulin family N-terminal region; This family includes a region of the ...
459-607 6.22e-24

Alpha-2-macroglobulin family N-terminal region; This family includes a region of the alpha-2-macroglobulin family.


Pssm-ID: 311575  Cd Length: 133  Bit Score: 101.16  E-value: 6.22e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    459 VHLEPMSHELPCGHTQTVQAHYILNGGTLLGLKKlsfyYLIMAKGGIVRTGTHGllvkqedmkghFSISIPVKSDIAPVA 538
Cdd:pfam07703    1 LKLSPDKKEYKPGETAKVTVRSPFPGAALVTVEG----DGVLSKGVIVSGGVSS-----------TSFSIPVTADMAPNA 65
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947    539 RLLIYAVLPTGDVIGDSAKYDVEnCLANKVDLSFSPSQS-LPASHAHLRVTAAPqSVCALRAVDQSVLLM 607
Cdd:pfam07703   66 YVSVVYYRPGPERVADSVWLPVE-CFENKLSVSLTAPKSyRPGETVTLKVKVKP-SLVALAAVDEGVLLL 133
YfaS COG2373
Uncharacterized conserved protein YfaS, alpha-2-macroglobulin family [General function ...
124-1071 2.25e-18

Uncharacterized conserved protein YfaS, alpha-2-macroglobulin family [General function prediction only];


Pssm-ID: 225248  Cd Length: 1621  Bit Score: 91.71  E-value: 2.25e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  124 NEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPL-VYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGS 202
Cdd:COG2373  391 GYGLKVYLFTDRGLYRPGETVHVNALLRDFDGKTALDNQPLkLRVLDPDGSVLRTLTITLDEEGLYELSFPLPENALTGG 470
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  203 YKVVVQKKSGGRT-EHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGE 281
Cdd:COG2373  471 YTLELYTGGKSAViSMSFRVEDFIPDRFKINLTLDKTEWVPGKDVKIKVDLRYLYGAPAAGLTVQGELDLRPTRFSVPGF 550
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  282 DSQAFcekfsgqlnshGCFYQQVKTKVFQLK--------RKEYEMKL-----HTEAQIQEEG-TVVELTGRQSSE----- 342
Cdd:COG2373  551 PGFTF-----------GLADEEPNSLTFEEEleltvtdgKGKASLDLdlaetPSPYQLLVASsEVEEDGGRAVTRslsvr 619
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  343 ITRTITKLSF-VKVDSHFRQGI-PFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQF------------S 408
Cdd:COG2373  620 VSPLDELIGVrPKFAADYVKDItPAKFSIIAVSADGSKVALKGLKLVLIEVKRNYNWTYSEGESWKYesveietviledT 699
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  409 INTTNVMGTSLTVRVNYKDRSPCygyqwVSEEHEEAHhtAYLVFSPSKSFVHLEPMSHELP--CGHTQTVQAHYILnggt 486
Cdd:COG2373  700 LDISANETTIITVPVGWGDYRLE-----VEDSDGGIL--ASVSFDVGGSGNDTVTGTPDVLklKLDKPEYQPGDTA---- 768
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  487 llgLKKLSFYYLImaKGGIVRTGTHGLLVKQ----------------EDMKGHFSISIPVKSDIAPVA---RLLIYAVLP 547
Cdd:COG2373  769 ---KLLITTPYAG--EEALITVESDKVIQVQllkvpangltleipvpAAWEHNAYVSVSFVRPGDASQsftPARAYGFVP 843
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  548 tgdvigdsAKYDVENclaNKVDLSF-SPSQSLPASHAHLRVTAA----PQSVCAL-RAVDQSVLlmkpdaelsassvynl 621
Cdd:COG2373  844 --------LPVDVKD---RRLDVQLkTPKKVKPGEPLTIKLSVSgaggPKSAYVTvAAVDEGIL---------------- 896
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  622 lpekDLTGFPGPlndqddedciNRHNVYINGITYtpvsSTNEKDMYSFLEDMGLKAftnskirkpkmcpqlqqyemhgpe 701
Cdd:COG2373  897 ----NLTGYEAP----------DPVKFFFGQRRL----GVETRDIYGRIIDGFQGV------------------------ 934
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  702 GLRVGFyesdvmGRGHARLVHVEEPHTetvRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAgLGiS 781
Cdd:COG2373  935 AKPLRT------GGDGGRAAKQGEPPT---RREKPVAAFSGIVETDAQGKATVTFPIPDFNGRLRVMAVAWTDGA-VG-Q 1003
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  782 STASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVsvqLEASPaflAVPVEKEQAPHCI--CANGRQTVSWA 859
Cdd:COG2373 1004 AEAELIVRKPVIVEASMPRFLAPGDRSSAGLDVFNLTGKAGDV---LTVEG---TLKFNGKEAPQTLtlAEGSATTLFFP 1077
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  860 VTPK-SLGNVNFTVSAEALESqelcgtevpsvpehgrkDTVIKPLLVEPEGLEKETTFNSLLCPsGGEVSEELSLKLPPN 938
Cdd:COG2373 1078 LRALdGSGKIDATLSVSGQVG-----------------DKLERHLNVRPAVPPQTQVKTVVLAP-GFTISGDLLAGLSPQ 1139
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66932947  939 VVEESARASVSVLGDILGsamqNTQNLLQMPYGCGEQ-NMVLFApniyvLDYLNETQQLTPEIKSKAIGYLNTGYQRQLN 1017
Cdd:COG2373 1140 AVNAQLQLSGTPAADIAA----LLDVLDDYPYGCAEQtASRLLP-----LLYAQKATADPGAADNDLRARLQDAIGRLLS 1210
                        970       980       990      1000      1010
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 66932947 1018 YKHYDGSystFGERYGRNQGNTWLTAFVLKTFAQARA-YIFIDEAHITQALIWLS 1071
Cdd:COG2373 1211 LQGSNGA---FGLWGGNGSGDPWLTAYAVDFLLRAREqGYSVPSDALNQMLERLL 1262
Thiol-ester_cl pfam10569
Alpha-macro-globulin thiol-ester bond-forming region; This short highly conserved region of ...
964-990 1.91e-13

Alpha-macro-globulin thiol-ester bond-forming region; This short highly conserved region of proteinase-binding alpha-macro-globulins contains the cysteine and a glutamine of a thiol-ester bond that is cleaved at the moment of proteinase binding, and mediates the covalent binding of the alpha-macro-globulin to the proteinase. The GCGEQ motif is highly conserved.


Pssm-ID: 313733  Cd Length: 27  Bit Score: 68.18  E-value: 1.91e-13
                           10        20
                   ....*....|....*....|....*..
gi 66932947    964 NLLQMPYGCGEQNMVLFAPNIYVLDYL 990
Cdd:pfam10569    1 SLLRMPYGCGEQNMILFAPNVYVLDYL 27
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH