NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6678037|ref|NP_033242|]
View 

somatostatin receptor type 1 [Mus musculus]

Protein Classification

7tmA_SSTR1 domain-containing protein (domain architecture ID 11610476)

7tmA_SSTR1 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_SSTR1 cd15970
somatostatin receptor type 1, member of the class A family of seven-transmembrane G ...
59-334 0e+00

somatostatin receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR1 is coupled to a Na/H exchanger, voltage-dependent calcium channels, and AMPA/kainate glutamate channels. SSTR1 is expressed in the normal human pituitary and in nearly half of all pituitary adenoma subtypes.


:

Pssm-ID: 320636  Cd Length: 276  Bit Score: 524.86  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15970   1 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGSLLCRLVLSVDA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQR 218
Cdd:cd15970  81 INMFTSIYCLTVLSIDRYIAVVHPIKAARYRRPTVAKMVNLGVWVFSILVILPIIIFSNTAPNSDGSVACNMQMPEPSQR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAE 298
Cdd:cd15970 161 WLAVFVVYTFLMGFLLPVIAICLCYILIIVKMRVVALKAGWQQRKRSERKITLMVMMVVTVFVICWMPFYVVQLVSVFVG 240
                       250       260       270
                ....*....|....*....|....*....|....*.
gi 6678037  299 QDDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15970 241 QHDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 276
 
Name Accession Description Interval E-value
7tmA_SSTR1 cd15970
somatostatin receptor type 1, member of the class A family of seven-transmembrane G ...
59-334 0e+00

somatostatin receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR1 is coupled to a Na/H exchanger, voltage-dependent calcium channels, and AMPA/kainate glutamate channels. SSTR1 is expressed in the normal human pituitary and in nearly half of all pituitary adenoma subtypes.


Pssm-ID: 320636  Cd Length: 276  Bit Score: 524.86  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15970   1 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGSLLCRLVLSVDA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQR 218
Cdd:cd15970  81 INMFTSIYCLTVLSIDRYIAVVHPIKAARYRRPTVAKMVNLGVWVFSILVILPIIIFSNTAPNSDGSVACNMQMPEPSQR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAE 298
Cdd:cd15970 161 WLAVFVVYTFLMGFLLPVIAICLCYILIIVKMRVVALKAGWQQRKRSERKITLMVMMVVTVFVICWMPFYVVQLVSVFVG 240
                       250       260       270
                ....*....|....*....|....*....|....*.
gi 6678037  299 QDDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15970 241 QHDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 276
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
75-323 7.21e-70

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 223.34  E-value: 7.21e-70
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037     75 GNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSV-PFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSV 153
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLTlPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037    154 DRYVAVVHPIKAarYRRPTVAKVVNLGVWVLSLLVILPIVVFS-RTAANSDGTVACNMLMPEPAqrWLVGFVLYTFLMGF 232
Cdd:pfam00001  81 DRYLAIVHPLRY--RRIMRRAKAIILLIWVLALLLSLPPLLGWnTLDIPSNGVTSCLITFPESL--WPVSYLLFSTVVGF 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037    233 LLPVGAICLCYVLIIAKMRMVALKagWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDA---------T 303
Cdd:pfam00001 157 LLPLLVILVCYTRIIRTLRKQARS--RRRSVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIiscvvtpprT 234
                         250       260
                  ....*....|....*....|
gi 6678037    304 VSQLSVILGYANSCANPILY 323
Cdd:pfam00001 235 LLQLTVWLAYSNSCLNPIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
61-341 2.65e-37

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 139.53  E-value: 2.65e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037    61 ISFIYSVVCLVGLCGNSMVIYViLRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVN 140
Cdd:PHA03087  43 LIVVYSTIFFFGLVGNIIVIYV-LTKTKIKTPMDIYLLNLAVSDLLFVMTLPFQIYYYILFQWSFGEFACKIVSGLYYIG 121
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   141 MFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANsDGTVACNMLMPEPAQRWL 220
Cdd:PHA03087 122 FYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKD-HETLICCMFYNNKTMNWK 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   221 VGFVLYTFLMGFLLPVGAICLCYVLIIAKMRmvalkaGWQQRKRSERKITLmVMMVVMVFVICWMPFYVV------QLVN 294
Cdd:PHA03087 201 LFINFEINIIGMLIPLTILLYCYSKILITLK------GINKSKKNKKAIKL-VLIIVILFVIFWLPFNVSvfvyslHILH 273
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 6678037   295 VFAEQDDATVSQLSV----ILGYANSCANPILYGFLSDNFKRSFQRILCLS 341
Cdd:PHA03087 274 FKSGCKAVKYIQYALhvteIISLSHCCINPLIYAFVSEFFNKHKKKSLKLM 324
 
Name Accession Description Interval E-value
7tmA_SSTR1 cd15970
somatostatin receptor type 1, member of the class A family of seven-transmembrane G ...
59-334 0e+00

somatostatin receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR1 is coupled to a Na/H exchanger, voltage-dependent calcium channels, and AMPA/kainate glutamate channels. SSTR1 is expressed in the normal human pituitary and in nearly half of all pituitary adenoma subtypes.


Pssm-ID: 320636  Cd Length: 276  Bit Score: 524.86  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15970   1 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGSLLCRLVLSVDA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQR 218
Cdd:cd15970  81 INMFTSIYCLTVLSIDRYIAVVHPIKAARYRRPTVAKMVNLGVWVFSILVILPIIIFSNTAPNSDGSVACNMQMPEPSQR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAE 298
Cdd:cd15970 161 WLAVFVVYTFLMGFLLPVIAICLCYILIIVKMRVVALKAGWQQRKRSERKITLMVMMVVTVFVICWMPFYVVQLVSVFVG 240
                       250       260       270
                ....*....|....*....|....*....|....*.
gi 6678037  299 QDDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15970 241 QHDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 276
7tmA_SSTR cd15093
somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
59-334 4.44e-161

somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. They share common signaling cascades such as inhibition of adenylyl cyclase, activation of phosphotyrosine phosphatase activity, and G-protein-dependent regulation of MAPKs.


Pssm-ID: 320221  Cd Length: 280  Bit Score: 457.69  E-value: 4.44e-161
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15093   1 VLIPCIYAVVCLVGLCGNSLVIYVVLRYAKMKTVTNIYILNLAIADELFMLGLPFLAASNALRHWPFGSVLCRLVLSVDG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQR 218
Cdd:cd15093  81 INMFTSIFCLTVMSVDRYLAVVHPIKSARWRRPRVAKVVNLAVWVASLLVILPVVVFAGTRENQDGSSACNMQWPEPAAA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFA- 297
Cdd:cd15093 161 WSAGFIIYTFVLGFLLPLLIICLCYLLIVIKVKSAGLRAGWQQRKRSERKVTRMVVMVVVVFVICWLPFYVLQLVNVFVq 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 6678037  298 ---EQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15093 241 lpeTPALVGVYHFVVILSYANSCANPILYGFLSDNFKKSF 280
7tmA_SSTR4 cd15973
somatostatin receptor type 4, member of the class A family of seven-transmembrane G ...
59-334 4.10e-147

somatostatin receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR4 plays a critical role in mediating inflammation. Unlike other SSTRs, SSTR4 subtype is not detected in all pituitary adenomas while it is expressed in the normal human pituitary.


Pssm-ID: 320639  Cd Length: 274  Bit Score: 421.96  E-value: 4.10e-147
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15973   1 VVIQFIYALVCLVGLIGNSMVIFVILRYAKMKTATNIYILNLAIADELFMLSVPFLAASAALQHWPFGSAMCRTVLSVDG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAqr 218
Cdd:cd15973  81 INMFTSVFCLTVLSVDRYIAVVHPLRAARYRRPTVAKMINICVWILSLLVISPIIIFADTATRKGQAVACNLIWPHPA-- 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAE 298
Cdd:cd15973 159 WSAAFVIYTFLLGFLLPVLAIGLCYILIIGKMRAVALKAGWQQRRKSEKKITRMVLMVVTVFVICWMPFYVVQLLNLFLP 238
                       250       260       270
                ....*....|....*....|....*....|....*.
gi 6678037  299 QDDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15973 239 RLDATVNHASLILSYANSCANPILYGFLSDNFRRSF 274
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
59-334 3.55e-119

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101  Cd Length: 282  Bit Score: 351.21  E-value: 3.55e-119
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd14970   1 IVIPAVYSVVCVVGLTGNSLVIYVILRYSKMKTVTNIYILNLAVADELFLLGLPFLATSYLLGYWPFGEVMCKIVLSVDA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQR 218
Cdd:cd14970  81 YNMFTSIFCLTVMSVDRYLAVVHPVKSLRFRTPRKAKLVSLCVWALSLVLGLPVIIFARTLQEEGGTISCNLQWPDPPDY 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGW--QQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVF 296
Cdd:cd14970 161 WGRVFTIYTFVLGFAVPLLVITVCYSLIIRRLRSSRNLSTSgaREKRRARRKVTRLVLVVVAVFVVCWLPFHVFQIVRLL 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 6678037  297 AEQDDATVSQLS----VILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd14970 241 IDPPETLTVVGVflfcIALSYANSCLNPILYAFLDENFRKSF 282
7tmA_SSTR2 cd15971
somatostatin receptor type 2, member of the class A family of seven-transmembrane G ...
59-334 2.63e-109

somatostatin receptor type 2, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin, a polypeptide hormone that regulates a wide variety of physiological such as neurotransmission, endocrine secretion, cell proliferation, and smooth muscle contractility. SSTRs are composed of five distinct subtypes (SSTR1-5) which are encoded by separate genes on different chromosomes. SSTR2 plays critical roles in growth hormone secretion, glucagon secretion, and immune responses. SSTR2 is expressed in the normal human pituitary and in nearly all pituitary growth hormone adenomas.


Pssm-ID: 320637  Cd Length: 279  Bit Score: 326.03  E-value: 2.63e-109
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15971   1 AFLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTVTNIYILNLAIADELFMLGLPFLAIQVALVHWPFGKAICRVVMTVDG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTvACNMLMPEPAQR 218
Cdd:cd15971  81 INQFTSIFCLTVMSIDRYLAVVHPIKSAKWRKPRTAKMINMAVWGVSLLVILPIMIYAGVQTKHGRS-SCTIIWPGESSA 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAE 298
Cdd:cd15971 160 WYTGFIIYTFILGFFVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFVFCWLPFYIFNVSSVSVS 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 6678037  299 QDDATVSQ----LSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15971 240 ISPTPGLKgmfdFVVVLSYANSCANPILYAFLSDNFKKSF 279
7tmA_SSTR5 cd15974
somatostatin receptor type 5, member of the class A family of seven-transmembrane G ...
59-334 2.63e-106

somatostatin receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR5 is coupled to inward rectifying K channels and phospholipase C, and plays critical roles in growth hormone and insulin secretion. SSTR5 acts as a negative regulator of PDX-1 (pancreatic and duodenal homeobox-1) expression, which is a conserved homeodomain-containing beta cell-specific transcription factor essentially involved in pancreatic development, among many other functions.


Pssm-ID: 320640  Cd Length: 277  Bit Score: 318.28  E-value: 2.63e-106
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15974   1 VLIPVIYLLVCAIGLSGNTLVIYVVLRYAKMKTVTNIYILNLAVADELFMLGLPFLATQNAISYWPFGSFLCRLVMTVDG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTaanSDGTVACNMLMPEPAQR 218
Cdd:cd15974  81 VNQFTSIFCLTVMSIDRYLAVVHPIKSTKWRRPRVAKLINATVWTLSFLVVLPVIIFSDV---QPDLNTCNISWPEPVSV 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVN--VF 296
Cdd:cd15974 158 WSTAFIIYTAVLGFFGPLLVICLCYLLIVIKVKSSGLRVGSTKRRKSERKVTRMVVIIVVVFVFCWLPFYMLNIVNliVI 237
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 6678037  297 AEQDDATVSQ--LSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15974 238 LPEEPAFVGVyfFVVVLSYANSCANPILYGFLSDNFKQSF 277
7tmA_SSTR3 cd15972
somatostatin receptor type 3, member of the class A family of seven-transmembrane G ...
59-334 6.24e-103

somatostatin receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR3 is coupled to inward rectifying potassium channels. SSTR3 plays critical roles in growth hormone secretion, endothelial cell cycle arrest and apoptosis. Furthermore, SSTR3 is expressed in the normal human pituitary and in nearly half of pituitary growth hormone adenomas.


Pssm-ID: 320638  Cd Length: 279  Bit Score: 309.43  E-value: 6.24e-103
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15972   1 VLIPLVYLVVCVVGLGGNTLVIYVVLRYSASESVTNIYILNLALADELFMLGLPFLAAQNALSYWPFGSFMCRLVMTVDA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAAnsdGTVACNMLMPEPAQR 218
Cdd:cd15972  81 INQFTSIFCLTVMSVDRYLAVVHPIRSSKWRKPPVAKTVNATVWALSFLVVLPVVIFSGVPG---GMGTCHIAWPEPAQV 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVA--LKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVF 296
Cdd:cd15972 158 WRAGFIIYTATLGFFCPLLVICLCYLLIVVKVRSSGrrVRATSTKRRGSERKVTRMVVIVVAAFVLCWLPFYALNIVNLV 237
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 6678037  297 A----EQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15972 238 CplpeEPSLFGLYFFVVVLSYANSCANPIIYGFLSDNFKQGF 279
7tmA_AstC_insect cd15094
somatostatin-like receptor for allatostatin C, member of the class A family of ...
64-334 3.89e-89

somatostatin-like receptor for allatostatin C, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. In Drosophila melanogaster and other insects, a 15-amino-acid peptide named allatostatin C(AstC) binds the somatostatin-like receptors. Two AstC receptors have been identified in Drosophila with strong sequence homology to human somatostatin and opioid receptors.


Pssm-ID: 320222  Cd Length: 282  Bit Score: 274.35  E-value: 3.89e-89
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   64 IYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVNMFT 143
Cdd:cd15094   6 LYGLICIVGLVGNGLVIYVVLRYAKMKTVTNLYILNLAVADECFLIGLPFLIVTMILKYWPFGAAMCKIYMVLTSINQFT 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  144 SIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSdGTVACNMLMPE-PAQRWLVG 222
Cdd:cd15094  86 SSFTLTVMSADRYLAVCHPIRSMRYRTPFIAKVVCATTWSISFLVMLPIILYASTVPDS-GRYSCTIVWPDsSAVNGQKA 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  223 FVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDA 302
Cdd:cd15094 165 FTLYTFLLGFAIPLLLISVFYTLVILRLRTVGPKNKSKEKRRSHRKVTRLVLTVISVYIICWLPYWAFQVHLIFLPPGTD 244
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 6678037  303 ------TVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15094 245 mpkweiLMFLLLTVLSYANSMVNPLLYAFLSENFRKSF 282
7tmA_Delta_opioid_R cd15089
opioid receptor subtype delta, member of the class A family of seven-transmembrane G ...
59-334 1.98e-81

opioid receptor subtype delta, member of the class A family of seven-transmembrane G protein-coupled receptors; The delta-opioid receptor binds the endogenous pentapeptide ligands such as enkephalins and produces antidepressant-like effects. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320217  Cd Length: 281  Bit Score: 254.49  E-value: 1.98e-81
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15089   1 IAITALYSVVCVVGLLGNVLVMYGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKVVLSIDY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQR 218
Cdd:cd15089  81 YNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLSSGVGVPIMVMAVTKTPRDGTVVCMLQFPDPSWY 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAE 298
Cdd:cd15089 161 WDTVTKICVFIFAFVVPILVITVCYGLMILRLRSVRLLSGSKEKDRNLRRITRMVLVVVAAFIICWTPIHIFVIVWTLVD 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 6678037  299 QDD-----ATVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15089 241 IDKrnplvVASLHLCIALGYTNSSLNPVLYAFLDENFKRCF 281
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
59-332 2.59e-79

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216  Cd Length: 278  Bit Score: 248.91  E-value: 2.59e-79
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLV-TSTLLRHWPFGALLCRLVLSVD 137
Cdd:cd15088   1 VIMPSVFGCICVVGLVGNGIVLYVLVRCSKLRTAPDIFIFNLAVADLLFMLGMPFLIhQFAIDGQWYFGEVMCKIITALD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  138 AVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQ 217
Cdd:cd15088  81 ANNQFTSTYILTAMSVDRYLAVVHPIRSTKYRTRFVAKLVNVGLWAASFLSILPVWVYSSLIYFPDGTTFCYVSLPSPDD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  218 rwLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFA 297
Cdd:cd15088 161 --LYWFTIYHFILGFAVPLVVITVCYILILHRLARGVAPGNQSHGSSRTKRVTKMVILIVVVFIVCWLPFHVVQLVNLAM 238
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 6678037  298 EQDDATVS---QLSVILGYANSCANPILYGFLSDNFKR 332
Cdd:cd15088 239 NRPTLAFEvayFLSICLGYANSCLNPFVYILVSENFRK 276
7tmA_NOFQ_opioid_R cd15092
nociceptin/orphanin FQ peptide receptor, member of the class A family of seven-transmembrane G ...
59-334 1.19e-78

nociceptin/orphanin FQ peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The nociceptin (NOP) receptor binds nociceptin or orphanin FQ, a 17 amino acid endogenous neuropeptide. The NOP receptor is involved in the modulation of various brain activities including instinctive and emotional behaviors. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320220  Cd Length: 279  Bit Score: 247.09  E-value: 1.19e-78
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15092   1 VTIVVVYLIVCVVGLVGNCLVMYVIVRYTKMKTATNIYIFNLALADTLVLLTLPFQGTDIFLGFWPFGNALCKIVIAIDY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSrTAANSDGTVACNMLMPEPAQR 218
Cdd:cd15092  81 YNMFTSTFTLTMMSVDRYVAICHPIKALDIRTPHKAKVVNVCIWALASVIGVPVMVMG-SAQVENEEIECLVEIPTPQDY 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAE 298
Cdd:cd15092 160 WDPVFGICVFLFSFIIPVLIISVCYSLMIRRLRGVRVLSGSKEKDRNLRRITRLVLVVVAVFVICWTPIQIFVLAQSLGA 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 6678037  299 QDDA----TVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15092 240 KPSSelavAILHFCTALGYVNSSLNPVLYAFLDENFKACF 279
7tmA_Kappa_opioid_R cd15091
opioid receptor subtype kappa, member of the class A family of seven-transmembrane G ...
59-334 2.24e-77

opioid receptor subtype kappa, member of the class A family of seven-transmembrane G protein-coupled receptors; The kappa-opioid receptor binds the opioid peptide dynorphin as the primary endogenous ligand. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320219  Cd Length: 282  Bit Score: 244.09  E-value: 2.24e-77
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15091   1 VIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAAN-SDGTVACNMLMPEPAQ 217
Cdd:cd15091  81 YNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVReDVDSTECSLQFPDDDY 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  218 RWLVGFV-LYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVF 296
Cdd:cd15091 161 SWWDTFMkICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEAL 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 6678037  297 AEQDDATVSQLS----VILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15091 241 GSVSHSTAAVSSyyfcIALGYTNSSLNPILYAFLDENFKRCF 282
7tmA_NPBWR cd15087
neuropeptide B/W receptors, member of the class A family of seven-transmembrane G ...
59-334 2.53e-76

neuropeptide B/W receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide B/W receptor 1 and 2 are members of the class A G-protein coupled receptors that bind the neuropeptides B and W, respectively. NPBWR1 (previously known as GPR7) is expressed predominantly in cerebellum and frontal cortex, while NPBWR2 (previously known as GPR8) is located mostly in the frontal cortex and is present in human, but not in rat and mice. These receptors are suggested to be involved in the regulation of food intake, neuroendocrine function, and modulation of inflammatory pain, among many others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320215  Cd Length: 282  Bit Score: 241.18  E-value: 2.53e-76
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15087   1 VALPVIYSVICAVGLTGNTAVIYVILRAPKMKTVTNVFILNLAIADDLFTLVLPINIAEHLLQQWPFGELLCKLILSIDH 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAAR--YRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPA 216
Cdd:cd15087  81 YNIFSSIYFLTVMSVDRYLVVLATVRSRRmpYRTYRAAKIVSLCVWLLVTIIVLPFTVFAGVYSNELGRKSCVLSFPSPE 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  217 QRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVF 296
Cdd:cd15087 161 SLWFKASRIYTLVLGFAIPVSTICILYTMMLYKLRNMRLNSNAKALDKAKKKVTLMVLVVLAVCLFCWTPFHLSTVVALT 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 6678037  297 AEQDDAT----VSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15087 241 TDLPQTPlvigISYFITSLSYANSCLNPFLYAFLDDSFRKSF 282
7tmA_Mu_opioid_R cd15090
opioid receptor subtype mu, member of the class A family of seven-transmembrane G ...
59-334 3.80e-75

opioid receptor subtype mu, member of the class A family of seven-transmembrane G protein-coupled receptors; The mu-opioid receptor binds endogenous opioids such as beta-endorphin and endomorphin. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320218  Cd Length: 279  Bit Score: 237.97  E-value: 3.80e-75
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd15090   1 ITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPiVVFSRTAANSDGTVACNMLMPEPAQR 218
Cdd:cd15090  81 YNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLP-VMFMATTKYRQGSIDCTLTFSHPSWY 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAE 298
Cdd:cd15090 160 WENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVT 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 6678037  299 QDDATVSQLS----VILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15090 240 IPETTFQTVSwhfcIALGYTNSCLNPVLYAFLDENFKRCF 279
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
75-323 7.21e-70

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 223.34  E-value: 7.21e-70
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037     75 GNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSV-PFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSV 153
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLTlPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037    154 DRYVAVVHPIKAarYRRPTVAKVVNLGVWVLSLLVILPIVVFS-RTAANSDGTVACNMLMPEPAqrWLVGFVLYTFLMGF 232
Cdd:pfam00001  81 DRYLAIVHPLRY--RRIMRRAKAIILLIWVLALLLSLPPLLGWnTLDIPSNGVTSCLITFPESL--WPVSYLLFSTVVGF 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037    233 LLPVGAICLCYVLIIAKMRMVALKagWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDA---------T 303
Cdd:pfam00001 157 LLPLLVILVCYTRIIRTLRKQARS--RRRSVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIiscvvtpprT 234
                         250       260
                  ....*....|....*....|
gi 6678037    304 VSQLSVILGYANSCANPILY 323
Cdd:pfam00001 235 LLQLTVWLAYSNSCLNPIIY 254
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
61-327 4.00e-63

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320086  Cd Length: 274  Bit Score: 206.74  E-value: 4.00e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   61 ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLML-SVPFLVTSTLLRHWPFGALLCRLVLSVDAV 139
Cdd:cd00637   1 LAVLYILIFVVGLVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVGLlVIPFSLVSLLLGGWWFGDALCKLLGFLQTV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  140 NMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRW 219
Cdd:cd00637  81 SLTASILTLTAISVDRYLAIVHPLRYRRRFTKRRAKLVIALIWLLSLLLALPPLLGWKVYEYGGYCCCCLCWPDLTLSKA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  220 lvgFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQ------QRKRSERKITLMVMMVVMVFVICWMPFYVVQLV 293
Cdd:cd00637 161 ---YTIFLFVLLFLLPLLVIIVCYVRIFRKLRRHRKRISSSsnssrrRRRRRERKVTKMLLIVVVVFLLCWLPYFILFLL 237
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 6678037  294 NVFAEQDDA---TVSQLSVILGYANSCANPILYGFLS 327
Cdd:cd00637 238 DVFGPDPSPlprILYFLALLLAYLNSAINPIIYAFFN 274
7tmA_KiSS1R cd15095
KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of ...
59-334 2.24e-62

KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled KiSS1-derived peptide receptor (GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (previously known as metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. The KiSS1 receptor is coupled to G proteins of the G(q/11) family, which lead to activation of phospholipase C and increase of intracellular calcium. This signaling cascade plays an important role in reproduction by regulating the secretion of gonadotropin-releasing hormone.


Pssm-ID: 320223  Cd Length: 288  Bit Score: 205.21  E-value: 2.24e-62
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIAD-ELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVD 137
Cdd:cd15095   1 WLVPLIFAIIFLVGLAGNSLVIYVVSRHREMRTVTNYYIVNLAVTDlAFLVCCVPFTAALYATPSWVFGDFMCKFVNYMM 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  138 AVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRT-AANSDGTVA-CnmLMPEP 215
Cdd:cd15095  81 QVTVQATCLTLTALSVDRYYAIVHPIRSLRFRTPRVAVVVSACIWIVSFLLSIPVAIYYRLeEGYWYGPQTyC--REVWP 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  216 AQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSE------RKITLMVMMVVMVFVICWMPFYV 289
Cdd:cd15095 159 SKAFQKAYMIYTVLLTYVIPLAIIAVCYGLILRRLWRRSVDGNNQSEQLSEralrqkRKVTRMVIVVVVLFAICWLPNHV 238
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|
gi 6678037  290 VQLVNVFAEQDDATVSQLSV-----ILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15095 239 LNLWQRFDPNFPETYATYALkiaalCLSYANSAVNPFVYAFMGENFRKYF 288
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
65-334 5.01e-61

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320113  Cd Length: 283  Bit Score: 201.34  E-value: 5.01e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   65 YSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLR-HWPFGALLCRLVLSVDAVNMFT 143
Cdd:cd14982   7 YSLIFILGLLGNILALWVFLRKMKKRSPTTIYMINLALADLLFVLTLPFRIYYYLNGgWWPFGDFLCRLTGLLFYINMYG 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  144 SIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQrWLVGF 223
Cdd:cd14982  87 SILFLTCISVDRYLAVVHPLKSRRLRRKRYAVGVCAGVWILVLAASVPLLLLRSTIAKENNSTTCFEFLSEWLA-SAAPL 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  224 VLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKagwQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDAT 303
Cdd:cd14982 166 VLIALVVGFLIPLLIILVCYSLIIRALRRRSKQ---SQKSVRKRKALRMILIVLAVFLVCFLPYHVTRILYLLVRLSVIA 242
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 6678037  304 VS----------QLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd14982 243 DCsarnslykayRITLCLASLNSCLDPLIYYFLSKTFRKRL 283
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
64-334 5.01e-59

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320115  Cd Length: 278  Bit Score: 195.90  E-value: 5.01e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   64 IYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTStLLRHWPFGALLCRLVLSVDAVNMFT 143
Cdd:cd14984   6 LYSLVFVLGLVGNSLVLLVLLYYKKLRSMTDVYLLNLALSDLLFVLTLPFWAVY-AAHGWVFGSFLCKLVSALYTINFYS 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  144 SIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVaCNMLMPE-PAQRWLVG 222
Cdd:cd14984  85 GILFLACISIDRYLAIVHAVSALRARTLLHGKLTCLAVWALALLLSLPEFIFSQVYEENGSSR-CSYIYPEdTATTWKTL 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  223 FVLYTFLMGFLLPVGAICLCYVLIIAKMrmvaLKAGWQQRKRSERKITLmvmmVVMVFVICWMPFYVVQLVNVFAE---- 298
Cdd:cd14984 164 LRLLQNILGFLLPLLVMLFCYSRIIRTL----LRARNHKKHRALRLIFA----VVVVFFLCWLPYNIVLLLDTLQRlgvi 235
                       250       260       270       280
                ....*....|....*....|....*....|....*....|...
gi 6678037  299 QDDATVSQ-----LSV--ILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd14984 236 IRSCELSKrldyaLQVteTLAFSHCCLNPVLYAFVGEKFRKYL 278
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
59-334 6.85e-59

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 320116  Cd Length: 284  Bit Score: 196.07  E-value: 6.85e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLR-HWPFGALLCRLVLSVD 137
Cdd:cd14985   1 VVIPAFYIAIFLVGLLGNLFVVWLFLLPRGPKRVADIFIANLAAADLVFVLTLPLWATYTANQyDWPFGDFLCKVSSYAI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  138 AVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTV-ACNMLMPEPA 216
Cdd:cd14985  81 TVNMFASVFLLTCMSVDRYLAIVHPVASRRLRRRRQARVTCALIWVVACLLSLPTFLLRSLQALPDLNKtACIELYPHEA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  217 qrWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRseRKITLMVMMVVMVFVICWMPFYVVQLVNVF 296
Cdd:cd14985 161 --WHVGLSLVLNILGFVLPLVIILTCYCHIARTLRTHYERTGKGGRKR--RKSLKIIFAVVVAFLVCWLPFHVFKFLDFL 236
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
gi 6678037  297 A--------EQDDA--TVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd14985 237 AqlgairpcFWEAFldLGLPIATCLAFTNSCLNPFIYVFFDRRFRQKV 284
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
59-334 1.43e-58

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124  Cd Length: 296  Bit Score: 195.51  E-value: 1.43e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADelLMLSVpFLVTSTLLRH----WPFGALLCRLVL 134
Cdd:cd14993   1 IVLIVLYVVVFLLALVGNSLVIAVVLRNKHMRTVTNYFLVNLAVAD--LLVSL-FCMPLTLLENvyrpWVFGEVLCKAVP 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  135 SVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAAN------SDGTVAC 208
Cdd:cd14993  78 YLQGVSVSASVLTLVAISIDRYLAICYPLKARRVSTKRRARIIIVAIWVIAIIIMLPLLVVYELEEIissepgTITIYIC 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  209 NMLMPEPAQRWLVGFVLYTFLmgFLLPVGAICLCYVLIIAK--------MRMVALKAGWQQRKRSERKITLMVMMVVMVF 280
Cdd:cd14993 158 TEDWPSPELRKAYNVALFVVL--YVLPLLIISVAYSLIGRRlwrrkppgDRGSANSTSSRRILRSKKKVARMLIVVVVLF 235
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 6678037  281 VICWMPFYVVQLVNVFAE-------QDDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd14993 236 ALSWLPYYVLSILLDFGPlsseesdENFLLILPFAQLLGYSNSAINPIIYCFMSKKFRRGF 296
7tmA_MCHR1 cd15338
melanin concentrating hormone receptor 1, member of the class A family of seven-transmembrane ...
59-334 2.06e-58

melanin concentrating hormone receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320460  Cd Length: 282  Bit Score: 194.65  E-value: 2.06e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMK---TATNIYILNLAIADELLMLSVPFLVTSTLLRH-WPFGALLCRLVL 134
Cdd:cd15338   1 VIMPSVFGVICFLGIIGNSIVIYTIVKKSKFRcqqTVPDIFIFNLSIVDLLFLLGMPFLIHQLLGNGvWHFGETMCTLIT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  135 SVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPE 214
Cdd:cd15338  81 ALDTNSQITSTYILTVMTLDRYLATVHPIRSTKIRTPRVAVAVICLVWILSLLSITPVWMYAGLMPLPDGSVGCALLLPN 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  215 PAQRwLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVN 294
Cdd:cd15338 161 PETD-TYWFTLYQFFLAFALPLVVICVVYFKILQNMASTVAPLPQRSLRVRTKKVTRMAVAICLAFFICWAPFYILQLAH 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|...
gi 6678037  295 VFAEQDDAT---VSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15338 240 LSIDRPSLAflyAYNVAISMGYANSCINPFLYIMLSETFKRQF 282
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
59-334 1.10e-57

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331  Cd Length: 293  Bit Score: 192.82  E-value: 1.10e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLML-SVPFLVTSTLLRHWPFGALLCRLVLSVD 137
Cdd:cd15203   1 IILILLYGLIIVLGVVGNLLVIYVVLRNKSMQTVTNIFILNLAVSDLLLCLvSLPFTLIYTLTKNWPFGSILCKLVPSLQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  138 AVNMFTSIYCLTVLSVDRYVAVVHPIKaaRYRRPTVAKVVNLGVWVLSLLVILPIVVFS------RTAANSDGTVaCNML 211
Cdd:cd15203  81 GVSIFVSTLTLTAIAIDRYQLIVYPTR--PRMSKRHALLIIALIWILSLLLSLPLAIFQelsdvpIEILPYCGYF-CTES 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  212 MPEPAQRWLVGFVlyTFLMGFLLPVGAICLCYVLIIAKMR-----MVALKAGWQQRKRSE----RKITLMVMMVVMVFVI 282
Cdd:cd15203 158 WPSSSSRLIYTIS--VLVLQFVIPLLIISFCYFRISLKLRkrvkkKRGKRTLSSRRRRSElrrkRRTNRLLIAMVVVFAV 235
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 6678037  283 CWMPFYVVQLVNVFAEQDDATVSQLSVI------LGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15203 236 CWLPLNLFNLLRDFEPLPQIDGRHFYLIflichlIAMSSACVNPLLYGWLNDNFRKEF 293
7tm_GPCRs cd14964
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
61-327 1.49e-55

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320095  Cd Length: 270  Bit Score: 186.84  E-value: 1.49e-55
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   61 ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADeLLMLSV--PFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd14964   1 LFVLLLLIFLLGLLGNLLVLLVILRSRRLRTPTNLFLLNLALAD-LLFSLVvvPFLLLGLLSGEWSFGFAGCKLVLFFFY 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANsDGTVACNMLMPEPAQR 218
Cdd:cd14964  80 LFGFASIFLLTAMAIDRYLAICHPLKYTVLMTPRRARLLILGIWVLSLLLSLPPLLGWGTLPF-CGPNVPLLTLSCSDTA 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLII-AKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFA 297
Cdd:cd14964 159 WNIAYTLGLLILGFLLPLLLILVSYARIVrALLRRKRITRSAISSARRERKAFKTLLIVVLVFLLCWLPYHIVYLLPALL 238
                       250       260       270
                ....*....|....*....|....*....|..
gi 6678037  298 EQDDATV--SQLSVILGYANSCANPILYGFLS 327
Cdd:cd14964 239 QLSNSLPllLLLSVLLAVLNSCLNPLIYSLRN 270
7tmA_AT1R cd15192
type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
59-334 1.62e-55

type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 320320  Cd Length: 285  Bit Score: 187.25  E-value: 1.62e-55
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLR-HWPFGALLCRLVLSVD 137
Cdd:cd15192   1 IMIPTVYSIIFVIGIFGNSLVVIVIYCYMKLKTVANIFLLNLALADLCFLITLPLWAAYTAMGyHWPFGNFLCKISSTLV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  138 AVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRT--AANSDGTVaCNMLMPEP 215
Cdd:cd15192  81 SFNLYASVFLLTCLSIDRYLAIVHPMKSRIRRTLVVARVTCIVIWLLAGVASLPAIIFRDVffYENWNKTV-CAFHYPNQ 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  216 AQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAkmrmvALKAGWQQRKRSER--KITLMVMMVVMVFVICWMPFYVVQLV 293
Cdd:cd15192 160 NKQLLVGMGLMKNLLGFLIPFLIILTCYTLIGK-----TLKQAYQIQRSKSRndEIFKMIMAVVLFFFFCWIPHQVFTFL 234
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|.
gi 6678037  294 NVFAEQDDATVSQLSVI----------LGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15192 235 DVLIQLKVIQNCHILEIvdtampfticIAYFNSCLNPILYGFVGKNFRKKF 285
7tmA_Gal1_R cd15098
galanin receptor subtype 1, member of the class A family of seven-transmembrane G ...
59-334 3.98e-55

galanin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320226  Cd Length: 282  Bit Score: 186.09  E-value: 3.98e-55
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMK--TATNIYILNLAIADEL-LMLSVPFLVTSTLLRHWPFGALLCRLVLS 135
Cdd:cd15098   1 VIVPVVFGLIFCLGVLGNSLVITVLARVKPGKrrSTTNVFILNLSIADLFfLLFCVPFQATIYSLPEWVFGAFMCKFVHY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  136 VDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRT--AANSDGTVACNMLMP 213
Cdd:cd15098  81 FFTVSMLVSIFTLVAMSVDRYIAVVHSRTSSSLRTRRNALLGVLVIWVLSLAMASPVAVHQDLvhHWTASNQTFCWENWP 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  214 EPAQRwlVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVaLKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLv 293
Cdd:cd15098 161 EKQQK--PVYVVCTFVFGYLLPLLLITFCYAKVLNHLHKK-LKNMSKKSERSKKKTAQTVLVVVVVFGISWLPHHIIHL- 236
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
gi 6678037  294 nvFAEQDDATVSQLSVI-------LGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15098 237 --WVEFGDFPLTQASFVlritahcLAYANSCVNPIIYAFLSENFRKAY 282
7tmA_Galanin_R-like cd14971
galanin receptor and related proteins, member of the class A family of seven-transmembrane G ...
60-334 1.34e-54

galanin receptor and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled galanin receptors, kisspeptin receptor and allatostatin-A receptor (AstA-R) in insects. These receptors, which are members of the class A of seven transmembrane GPCRs, share a high degree of sequence homology among themselves. The galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, eating disorders, and epilepsy, among many others. KiSS1-derived peptide receptor (also known as GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. AstA-R is a G-protein coupled receptor that binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320102  Cd Length: 281  Bit Score: 184.59  E-value: 1.34e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   60 LISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLML-SVPFLVTSTLLRHWPFGALLCRLVLSVDA 138
Cdd:cd14971   2 IVPLFFALIFLLGLVGNSLVILVVARNKPMRSTTNLFILNLAVADLTFLLfCVPFTATIYPLPGWVFGDFMCKFVHYFQQ 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVA-CNMLMPEPAQ 217
Cdd:cd14971  82 VSMHASIFTLVAMSLDRFLAVVYPLRSLHIRTPRNALAASGCIWVVSLAVAAPVLALHRLRNYTPGNRTvCSEAWPSRAH 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  218 RwlVGFVLYTFLMGFLLPVGAICLCYVLIIAKM-RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMP---FYVVQLV 293
Cdd:cd14971 162 R--RAFALCTFLFGYLLPLLLICVCYAAMLRHLwRVAVRPVLSEGSRRAKRKVTRLVLVVVVLFAACWGPihaILLLVAL 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 6678037  294 NVFAEQDDATVSQ-LSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd14971 240 GPFPLTYATYALRiWAHCLAYSNSAVNPVLYAFLSEHFRKAF 281
7tmA_Anaphylatoxin_R-like cd14974
anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class ...
59-334 2.71e-54

anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes anaphylatoxin receptors, formyl peptide receptors (FPR), prostaglandin D2 receptor 2, GPR1, and related chemokine receptors. The anaphylatoxin receptors are a group of G-protein coupled receptors that bind anaphylatoxins. The members of this group include C3a and C5a receptors. The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed mainly on polymorphonuclear and mononuclear phagocytes and bind N-formyl-methionyl peptides (FMLP), which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Chemokine receptor-like 1 (also known as chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. Prostaglandin D2 receptor, also known as CRTH2, is a chemoattractant G-protein coupled receptor expressed on T helper type 2 cells that binds prostaglandin D2 (PGD2). PGD2 functions as a mast cell-derived mediator to trigger asthmatic responses and also causes vasodilation. PGD2 exerts its inflammatory effects by binding to two G-protein coupled receptors, the D-type prostanoid receptor (DP) and PD2R2 (CRTH2). PD2R2 couples to the G protein G(i/o) type which leads to a reduction in intracellular cAMP levels and an increase in intracellular calcium. GPR1 is an orphan receptor that can be activated by the leukocyte chemattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1.


Pssm-ID: 320105  Cd Length: 274  Bit Score: 183.66  E-value: 2.71e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYViLRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL-RHWPFGALLCRLVLSVD 137
Cdd:cd14974   1 IVSLVLYALIFLLGLPGNGLVIWV-AGFKMKRTVNTVWFLNLALADFLFCLFLPFLIVYIAMgHHWPFGSVLCKLNSFVI 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  138 AVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFsRTAANSDGTVACNMLMPEP-- 215
Cdd:cd14974  80 SLNMFASVFLLTAISLDRCLLVLHPVWAQNHRTVRLASVVCVGIWILALVLSVPYFVF-RDTVTHHNGRSCNLTCVEDyd 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  216 ----AQRWLVGFvlyTFLMGFLLPVGAICLCYVLIIAKMRmvalKAGWQQRKRSERKITlmvmMVVMVFVICWMPFYVVQ 291
Cdd:cd14974 159 lrrsRHKALTVI---RFLCGFLLPLLIIAICYSVIAVKLR----RKRLAKSSKPLRVLL----AVVVAFFLCWLPYHVFA 227
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*..
gi 6678037  292 LVNVFAEQDDATVSQ----LSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd14974 228 LLELVAAAGLPEVVLlglpLATGLAYFNSCLNPILYVFMGQDFRKRL 274
7tmA_AstA_R_insect cd15096
allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G ...
59-334 1.26e-52

allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled AstA receptor binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320224  Cd Length: 284  Bit Score: 179.41  E-value: 1.26e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADEL-LMLSVPFLVTSTLLRHWPFGALLCRLVLSVD 137
Cdd:cd15096   1 IVVPVIFGLIFIVGLIGNSLVILVVLSNQQMRSTTNILILNLAVADLLfVVFCVPFTATDYVLPTWPFGDVWCKIVQYLV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  138 AVNMFTSIYCLTVLSVDRYVAVVHPIKAARYR--RPTVAKVVnlGVWVLSLLVILPIVVFSR---TAANSDGTVACNML- 211
Cdd:cd15096  81 YVTAYASVYTLVLMSLDRYLAVVHPITSMSIRteRNTLIAIV--GIWIVILVANIPVLFLHGvvsYGFSSEAYSYCTFLt 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  212 -MPEPAQRWLVGFvlytFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRK--RSERKITLMVMMVVMVFVICWMPFY 288
Cdd:cd15096 159 eVGTAAQTFFTSF----FLFSYLIPLTLICVLYMLMLRRLRRQKSPGGRRSAEsqRGKRRVTRLVVVVVVVFAICWLPIH 234
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|
gi 6678037  289 VVQLVNVFAEQDDATVSQ----LSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15096 235 IILLLKYYGVLPETVLYVviqiLSNCLAYGNSCVNPILYAFLSQNFRKAF 284
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
60-334 3.19e-52

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098  Cd Length: 259  Bit Score: 177.76  E-value: 3.19e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   60 LISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADeLLM--LSVPFLVTSTLLRHWPFGALLCRLVLSVD 137
Cdd:cd14967   1 LLAVFLSLIILVTVFGNLLVILAVYRNRRLRTVTNYFIVSLAVAD-LLValLVMPFSAVYTLLGYWPFGPVLCRFWIALD 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  138 AVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLV-ILPIVVFSRTAANSDGTVACNmLMPEPa 216
Cdd:cd14967  80 VLCCTASILNLCAISLDRYLAITRPLRYRQLMTKKRALIMIAAVWVYSLLIsLPPLVGWRDETQPSVVDCECE-FTPNK- 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  217 qrwlvGFVLYTFLMGFLLPVGAICLCYVLIIAkmrmVAlkagwqqrkRSERKITLMVMMVVMVFVICWMPFYVVQLVNVF 296
Cdd:cd14967 158 -----IYVLVSSVISFFIPLLIMIVLYARIFR----VA---------RRELKAAKTLAIIVGAFLLCWLPFFIIYLVSAF 219
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 6678037  297 AEQD--DATVSQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd14967 220 CPPDcvPPILYAVFFWLGYLNSALNPIIYALFNRDFRRAF 259
7tmA_CXCR1_2 cd15178
CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G ...
59-334 9.34e-51

CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR1 and CXCR2 are closely related chemotactic receptors for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. Expression of CXCR1 and CXCR2 is strictly controlled in neutrophils by external stimuli such as lipopolysaccharide (LPS), tumor necrosis factor (TNF)-alpha, Toll-like receptor agonists, and nitric oxide. CXCL8 (formerly known as interleukin-8) binds with high-affinity and activates both receptors. CXCR1 also binds CXCL7 (neutrophil-activating protein-2), whereas CXCR2 non-selectively binds to all seven ELR-positive chemokines (CXCL1-7). Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320306  Cd Length: 279  Bit Score: 174.38  E-value: 9.34e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTlLRHWPFGALLCRLVLSVDA 138
Cdd:cd15178   1 LALCVIYVLVFLLSLPGNSLVVLVILYNRRSRSSTDVYLLHLAIADLLFALTLPFWAVSV-VKGWIFGTFMCKLVSLLQE 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVaKVVNLGVWVLSLLVILPIVVFsRTAA---NSDGTVACNMLMPEP 215
Cdd:cd15178  80 ANFYSGILLLACISVDRYLAIVHATRALTQKRHLV-KFVCAGVWLLSLLLSLPALLN-RDAFkppNSGRTVCYENLGNES 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  216 AQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMrmvaLKAGWQQRKRSERKItlmvMMVVMVFVICWMPFYVV----- 290
Cdd:cd15178 158 ADKWRVVLRILRHTLGFLLPLVVMLFCYGFTIKTL----LQTRSFQKHRAMRVI----FAVVLAFLLCWLPYNVTvlidt 229
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|
gi 6678037  291 ----QLVNVFAEQDDATVSQLSV--ILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15178 230 lmrtKLITETCELRNHVDVALYVtqILGFLHSCINPVLYAFIGQKFRNNL 279
7tmA_MCHR2 cd15339
melanin concentrating hormone receptor 2, member of the class A family of seven-transmembrane ...
64-332 4.47e-50

melanin concentrating hormone receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320461  Cd Length: 283  Bit Score: 172.69  E-value: 4.47e-50
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   64 IYSVVCLVGLCGNSMVIYVILRYAKmKTATNIYILNLAIADELLMLSVPFLVTSTLL-RHWPFGALLCRLVLSVDAVNMF 142
Cdd:cd15339   6 FIGILCSTGLVGNILVLFTIIRSRK-KTVPDIYVCNLAVADLVHIIVMPFLIHQWARgGEWVFGSPLCTIITSLDTCNQF 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  143 TSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQrwLVG 222
Cdd:cd15339  85 ACSAIMTAMSLDRYIALVHPFRLTSLRTRSKTIRINLLVWAASFILVLPVWVYAKVIKFRDGLESCAFNLTSPDD--VLW 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  223 FVLYTFLMGFLLPVGAICLCYVLIIA---KMRMVALKAG-WQQRKRSER--KITLMVMMVVMVFVICWMPFYVVQLVNVF 296
Cdd:cd15339 163 YTLYQTITTFFFPLPLILICYILILCytwEMYRKNKKAGrYNTSIPRQRvmRLTKMVLVLVGVFLVSAAPYHVIQLVNLS 242
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 6678037  297 AEQDDATVS---QLSVILGYANSCANPILYGFLSDNFKR 332
Cdd:cd15339 243 VSQPTLAFYvsyYLSICLSYASSSINPFLYILLSGNFRK 281
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
59-332 1.13e-48

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 320296  Cd Length: 283  Bit Score: 169.03  E-value: 1.13e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLR-HWPFGALLCRLVLSVD 137
Cdd:cd15168   1 IFLPIVYGVVFLVGLLLNAVVLYRFIFSLKPWNSSAIYMFNLAVSDLLYLLSLPFLIYYYANGdHWIFGDFMCKLVRFLF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  138 AVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTaANSDGTVACNMLMPEPAQ 217
Cdd:cd15168  81 YFNLYCSILFLTCISVHRYLGICHPMRSLRKLKKRHAVAVCVAVWILVLLQLLPILFFATT-GRPNNRTTCYDTTSPEEL 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  218 RWLVGFVLYTFLMGFLLPVGAICLCYVLIIakmRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFA 297
Cdd:cd15168 160 NDYVPYSMVLTGLGFLLPLLIILACYGLIA---RTLLRSLGSGVTSALRRKSIRLVIVVLALFAVCFLPFHVTRTIYLAA 236
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*
gi 6678037  298 EQDDAT--VSQLSVILGY--------ANSCANPILYGFLSDNFKR 332
Cdd:cd15168 237 RLLSGTscATLNGIYVAYkvtrplasLNSCLNPLLYFLTGDKFRR 281
7tmA_UII-R cd14999
urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled ...
60-331 3.36e-48

urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The urotensin-II receptor (UII-R, also known as the hypocretin receptor) is a member of the class A rhodopsin-like G-protein coupled receptors, which binds the peptide hormone urotensin-II. Urotensin II (UII) is a vasoactive somatostatin-like or cortistatin-like peptide hormone. However, despite the apparent structural similarity to these peptide hormones, they are not homologous to UII. Urotensin II was first identified in fish spinal cord, but later found in humans and other mammals. In fish, UII is secreted at the back part of the spinal cord, in a neurosecretory centre called uroneurapophysa, and is involved in the regulation of the renal and cardiovascular systems. In mammals, urotensin II is the most potent mammalian vasoconstrictor identified to date and causes contraction of arterial blood vessels, including the thoracic aorta. The urotensin II receptor is a rhodopsin-like G-protein coupled receptor, which binds urotensin-II. The receptor was previously known as GPR14, or sensory epithelial neuropeptide-like receptor (SENR). The UII receptor is expressed in the CNS (cerebellum and spinal cord), skeletal muscle, pancreas, heart, endothelium and vascular smooth muscle. It is involved in the pathophysiological control of cardiovascular function and may also influence CNS and endocrine functions. Binding of urotensin II to the receptor leads to activation of phospholipase C, through coupling to G(q/11) family proteins. The resulting increase in intracellular calcium may cause the contraction of vascular smooth muscle.


Pssm-ID: 320130  Cd Length: 282  Bit Score: 167.62  E-value: 3.36e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   60 LISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAV 139
Cdd:cd14999   1 AIGTVLSLMCVVGVAGNVYTLVVMCLSMRPRASMYVYILNLALADLLYLLTIPFYVSTYFLKKWYFGDVGCRLLFSLDFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  140 NMFTSIYCLTVLSVDRYVAVVHPIKAARyRRPTVAKVVNLGVWVLSLLVILPIVVFSR-TAANSDGTVACNMLMPEPAQR 218
Cdd:cd14999  81 TMHASIFTLTVMSTERYLAVVKPLDTVK-RSKSYRKLLAGVIWLLSLLLTLPMAIMIRlVTVEDKSGGSKRICLPTWSEE 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  219 WLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRS-ERKITLMVMMVVMVFVICWMPFYVVQLVNVFA 297
Cdd:cd14999 160 SYKVYLTLLFSTSIVIPGLVIGYLYIRLARKYWLSQAAASNSSRKRLpKQKVLKMIFTIVLVFWACFLPFWIWQLLYLYS 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 6678037  298 EQDDAT------VSQLSVILGYANSCANPILYGFLSDNFK 331
Cdd:cd14999 240 PSLSLSprtttyVNYLLTCLTYSNSCINPFLYTLLTKNYK 279
7tmA_RNL3R cd14976
relaxin-3 like peptide receptors, member of the class A family of seven-transmembrane G ...
59-334 3.59e-48

relaxin-3 like peptide receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This G protein-coupled receptor subfamily is composed of the relaxin-3 like peptide receptors, RNL3R1 and RNL3R2, and similar proteins. The relaxin-3 like peptide family includes relaxin-1, -2, -3, as well as insulin-like (INSL) peptides 3 to 6. RNL3/relaxin-3 and INSL5 are the endogenous ligands for RNL3R1 and RNL3R2, respectively. RNL3R1, also called GPCR135 or RXFP3, is predominantly expressed in the brain and is implicated in stress, anxiety, feeding, and metabolism. Insulin-like peptide 5 (INSL5), the endogenous ligand for RNL3R2 (also called GPCR142 or RXFP4), plays a role in fat and glucose metabolism. INSL5 is highly expressed in human rectal and colon tissues. Both RNL3R1 and RNL3R2 signal through G(i) protein and inhibit adenylate cyclase, thereby inhibit cAMP accumulation. RNL3R1 is shown to activate Erk1/2 signaling pathway.


Pssm-ID: 320107  Cd Length: 290  Bit Score: 167.68  E-value: 3.59e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTA--TNIYILNLAIADELLMLSVPFLVTSTLLRH-WPFGALLCRLVLS 135
Cdd:cd14976   1 NLVSVVYMVVFTVGLLGNLLVLYLLKSNKKLRQQseSNKFVFNLALTDLIFVLTLPFWAVEYALDFvWPFGTAMCKVVRY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  136 VDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEP 215
Cdd:cd14976  81 VTKLNMYSSIFFLTALSVTRYIAVARALKHGWIRKAFGAFATTIAIWAAAALAAIPEAIFSTDTWSSVNHTLCLLRFPKN 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  216 A-----QRWLVGFVLYTFLMGFLLPVGAICLCYVLIIakmRMVALKAGwqQRKRSERKITLMVMMVVMVFVICWMPFYVV 290
Cdd:cd14976 161 SsvtrwYNWLGMYQLQKVVLGFFLPLGIITLSYLLLL---RFLQRKRG--GSKRRKSRVTKSVFIVVLSFFICWLPNQAL 235
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*
gi 6678037  291 QLVNVFAEQDDATVSQ-----------LSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd14976 236 SLWSALIKFDDVPFSDaffafqtyafpVAICLAHSNSCLNPVLYCLVRREFRDAL 290
7tmA_CXCR4 cd15179
CXC chemokine receptor type 4, member of the class A family of seven-transmembrane G ...
59-333 1.04e-46

CXC chemokine receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR4 is the only known G protein-coupled chemokine receptor for the key homeostatic ligand CXCL12, which is constitutively secreted by bone marrow stromal cells. Atypical chemokine receptor CXCR7 (ACKR3) also binds CXCL12, but activates signaling in a G protein-independent manner. CXCR4 is also a co-receptor for HIV infection and plays critical roles in the development of immune system during both lymphopoiesis and myelopoiesis. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320307  Cd Length: 278  Bit Score: 163.40  E-value: 1.04e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLrHWPFGALLCRLVLSVDA 138
Cdd:cd15179   1 IFLPTVYSIIFLLGIVGNGLVILVMGYQKKSRTMTDKYRLHLSVADLLFVLTLPFWAVDAAA-NWYFGNFLCKAVHVIYT 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTaANSDGTVACNMLMPEPA-Q 217
Cdd:cd15179  80 VNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWLPALLLTVPDLVFAKV-SELDGRYICDRIYPEDTfE 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  218 RWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKmrmvaLKAGWQQRKRSERKITLmvmMVVMVFVICWMPFYVVQLVNVFA 297
Cdd:cd15179 159 LWLVAFRFQHILVGLVLPGLVILTCYCIIISK-----LSHSKGHQKRKALKTTV---ILILAFFACWLPYYIGILIDTFM 230
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*..
gi 6678037  298 -----------EQDDATVSQLSVILGYANSCANPILYGFLSDNFKRS 333
Cdd:cd15179 231 llevikhscemEQTVHKWISITEALAFFHCCLNPILYAFLGAKFKTS 277
7tmA_Apelin_R cd15190
apelin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
60-331 8.88e-46

apelin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Apelin (APJ) receptor is a G protein-coupled receptor that binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake.


Pssm-ID: 320318  Cd Length: 292  Bit Score: 161.46  E-value: 8.88e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   60 LISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLR-HWPFGALLCRLVLSVDA 138
Cdd:cd15190   2 LIPVIYMLVFVLGLSGNGLVIWTVFRSKAKRRSADTFIANLALADLTFVVTLPLWAVYTALGyHWPFGSFLCKLSSYLVF 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  139 VNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFsRTAANSDGT--VACNM-----L 211
Cdd:cd15190  82 VNMYASVFCLTCLSFDRYLAIVRSLASAKLRSRTSGIVALGVIWLLAGLLALPALIL-RTTRELDGSnkTICDMdfsgvV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  212 MPEPAQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRseRKITLMVMMVVMVFVICWMPFYVVQ 291
Cdd:cd15190 161 SNEAELFWIAGLGLSSTVLGFLLPFLVMLTCYFFIGRTVARHFSKERKELKKK--RRLLKIIITLVVTFALCWLPFHLVK 238
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|.
gi 6678037  292 LVNVFAEQDDATVS-----------QLSVILGYANSCANPILYGFLSDNFK 331
Cdd:cd15190 239 TIYALMYLGILPFScgfdqflvnahPYATCLAYVNSCLNPFLYAFFDPRFR 289
7tmA_CMKLR1 cd15116
chemokine-like receptor 1, member of the class A family of seven-transmembrane G ...
59-334 2.32e-45

chemokine-like receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokine receptor-like 1 (also known as Chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. CMKLR1 is prominently expressed in dendritic cells and macrophages.


Pssm-ID: 320244  Cd Length: 284  Bit Score: 160.31  E-value: 2.32e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILryAKMKTATN-IYILNLAIADELLMLSVPFLVTSTLLR-HWPFGALLCRLVLSV 136
Cdd:cd15116   1 ILSMVIYSVVFVLGVLGNGLVIFITG--FKMKKTVNtVWFLNLAVADFLFTFFLPFSIAYTAMDfHWPFGRFMCKLNSFL 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  137 DAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTA-ANSDGTVAC--NMLMP 213
Cdd:cd15116  79 LFLNMFTSVFLLTVISIDRCISVVFPVWSQNHRSVRLASLVSLAVWVVAFFLSSPSFIFRDTApSQNNNKIICfnNFSLS 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  214 EPAQRWLVGFVLYT---------FLMGFLLPVGAICLCYVLIIAKMRmvalkagwQQRKRSERKITLMVMMVVMVFVICW 284
Cdd:cd15116 159 GDNSSPEVNQLRNMrhqvmtitrFLLGFLIPFTIIICCYAAIVLKLK--------RNRLAKSSKPFKIIAAVIVTFFLCW 230
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....
gi 6678037  285 MPFYVVQLVNVFAEQDDATV----SQLSVILGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15116 231 APYHILNLLEMEATRSPASVfkigLPITSSLAFINSCLNPILYVFMGQDFKKFK 284
7tmA_leucokinin-like cd15393
leucokinin-like peptide receptor from tick and related proteins, member of the class A family ...
59-334 2.70e-45

leucokinin-like peptide receptor from tick and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a leucokinin-like peptide receptor from the Southern cattle tick, Boophilus microplus, a pest of cattle world-wide. Leucokinins are invertebrate neuropeptides that exhibit myotropic and diuretic activity. This receptor is the first neuropeptide receptor known from the Acari and the second known in the subfamily of leucokinin-like peptide G-protein-coupled receptors. The other known leucokinin-like peptide receptor is a lymnokinin receptor from the mollusc Lymnaeastagnalis.


Pssm-ID: 320515  Cd Length: 288  Bit Score: 160.27  E-value: 2.70e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037   59 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELL-MLSVPFLVTSTLLRHWPFGALLCRLVLSVD 137
Cdd:cd15393   1 VLLSILYGIISLVAVVGNFLVIWVVAKNRRMRTVTNIFIANLAVADIIIgLFSIPFQFQAALLQRWVLPRFMCPFCPFVQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  138 AVNMFTSIYCLTVLSVDRYVAVVHPIKAarYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSD--GTVACNMLMPE- 214
Cdd:cd15393  81 VLSVNVSVFTLTVIAVDRYRAVIHPLKA--RCSKKSAKIIILIIWILALLVALPVALALRVEELTDktNNGVKPFCLPVg 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6678037  215 PAQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMV-----ALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYV 289
Cdd:cd15393 159 PSDDWWKIYNLYLVCVQYFVPLVIICYAYTRIAVKIWGTkapgnAQDVRDDEILKNKKKVIKMLIIVVALFALCWLPLQT 238
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|.
gi 6678037  290 VQLVNVFAEQDDaTVSQLSVI------LGYANSCANPILYGFLSDNFKRSF 334
Cdd:cd15393 239 YNLLNEIKPEIN-KYKYINI