NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|66472852|ref|NP_001018308|]
View 

probable sodium-coupled neutral amino acid transporter 6 [Danio rerio]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SLC5-6-like_sbd super family cl00456
Solute carrier families 5 and 6-like; solute binding domain; This superfamily includes the ...
36-443 1.60e-49

Solute carrier families 5 and 6-like; solute binding domain; This superfamily includes the solute-binding domain of SLC5 proteins (also called the sodium/glucose cotransporters or solute sodium symporters), SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporters or Na+/Cl--dependent transporters), and nucleobase-cation-symport-1 (NCS1) transporters. SLC5s co-transport Na+ with sugars, amino acids, inorganic ions or vitamins. SLC6s include Na+/Cl--dependent plasma membrane transporters for the monoamine neurotransmitters serotonin, dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. NCS1s are essential components of salvage pathways for nucleobases and related metabolites; their known substrates include allantoin, uracil, thiamine, and nicotinamide riboside. Members of this superfamily are important in human physiology and disease. They contain a functional core of 10 transmembrane helices (TMs): an inverted structural repeat, TMs1-5 and TMs6-10; TMs numbered to conform to the SLC6 Aquifex aeolicus LeuT.


The actual alignment was detected with superfamily member pfam01490:

Pssm-ID: 320982  Cd Length: 410  Bit Score: 175.96  E-value: 1.60e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852    36 RGSSFMSSAFNLMNAIMGSGILGLSYAMANTGTVGFSILLLMVASLAAYSIHLLLLLCDKT-----GINSYEALGEKALN 110
Cdd:pfam01490   1 GTISAWQAVFNLINAIIGAGVLSLPYAFKQLGWIPGLILLLIVGLISLYTAHLLVRCSKEVpvtgkRNKSYGDLGYRLLG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   111 RPGKILVACTILIQNIGAMSSYLFILKTELPaAIIGFMRSDSETSGKWFengvtllILVTVIIVLPLALLPKIGFLGYTS 190
Cdd:pfam01490  81 PKGRLLILFAILLNLFGVCISYLIFAGDNLP-AIFDSFFDTCPISLVYF-------IIIFGLIFIPLSFIPNLSALSILS 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   191 SIAFLFMLFFTVVVVVKKWSIpcplpinsTLSLSLNTSECTAQLFVISSKSAYAVPTMAFSFLCHTAVFPIYCELHRPTK 270
Cdd:pfam01490 153 LLAAVSSLYYIVILVLSVAEG--------IVLTAQGVGHLGSKTNIKLAGTFLAIGIIVFAFEGHAVLLPIQNEMKNPSK 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   271 -RRMQRATNVSIFLSFVVYLISALFGYLTFYSHVGSELLLaynTYLPRDILVMSVRLAILLAVLLTVPLIHFPARKAVLM 349
Cdd:pfam01490 225 fKAMTKILLTAIIIATVLYILIGLVGYLAFGDNVKGNILL---NLPKSAWLIDIANLLLVLHVILSFPLQLFPIRQIVEN 301
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   350 L----------CRGEREFSWLSHTLSCFFILTLVLLLAIFVPDIKNVFGVVGSTTSTCLLFVYPGMFFLRISSEPIRSFN 419
Cdd:pfam01490 302 LlfrkeapfgaSGKNNPKSKLLRVVIRSGLVVITYLIAISVPFFGDLLSLVGATSCAPLSFILPPLFHLKLKKTKKKSQE 381
                         410       420
                  ....*....|....*....|....*....
gi 66472852   420 SV-----GAVFLLVIGLVVGVLSLSVIIV 443
Cdd:pfam01490 382 KLwkpdiLDVICIVIGLLLMAYGVAGLIL 410
 
Name Accession Description Interval E-value
Aa_trans pfam01490
Transmembrane amino acid transporter protein; This transmembrane region is found in many amino ...
36-443 1.60e-49

Transmembrane amino acid transporter protein; This transmembrane region is found in many amino acid transporters including UNC-47 and MTR. UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT). UNC-47 is predicted to have 10 transmembrane domains. MTR is a N system amino acid transporter system protein involved in methyltryptophan resistance. Other members of this family include proline transporters and amino acid permeases.


Pssm-ID: 279788  Cd Length: 410  Bit Score: 175.96  E-value: 1.60e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852    36 RGSSFMSSAFNLMNAIMGSGILGLSYAMANTGTVGFSILLLMVASLAAYSIHLLLLLCDKT-----GINSYEALGEKALN 110
Cdd:pfam01490   1 GTISAWQAVFNLINAIIGAGVLSLPYAFKQLGWIPGLILLLIVGLISLYTAHLLVRCSKEVpvtgkRNKSYGDLGYRLLG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   111 RPGKILVACTILIQNIGAMSSYLFILKTELPaAIIGFMRSDSETSGKWFengvtllILVTVIIVLPLALLPKIGFLGYTS 190
Cdd:pfam01490  81 PKGRLLILFAILLNLFGVCISYLIFAGDNLP-AIFDSFFDTCPISLVYF-------IIIFGLIFIPLSFIPNLSALSILS 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   191 SIAFLFMLFFTVVVVVKKWSIpcplpinsTLSLSLNTSECTAQLFVISSKSAYAVPTMAFSFLCHTAVFPIYCELHRPTK 270
Cdd:pfam01490 153 LLAAVSSLYYIVILVLSVAEG--------IVLTAQGVGHLGSKTNIKLAGTFLAIGIIVFAFEGHAVLLPIQNEMKNPSK 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   271 -RRMQRATNVSIFLSFVVYLISALFGYLTFYSHVGSELLLaynTYLPRDILVMSVRLAILLAVLLTVPLIHFPARKAVLM 349
Cdd:pfam01490 225 fKAMTKILLTAIIIATVLYILIGLVGYLAFGDNVKGNILL---NLPKSAWLIDIANLLLVLHVILSFPLQLFPIRQIVEN 301
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   350 L----------CRGEREFSWLSHTLSCFFILTLVLLLAIFVPDIKNVFGVVGSTTSTCLLFVYPGMFFLRISSEPIRSFN 419
Cdd:pfam01490 302 LlfrkeapfgaSGKNNPKSKLLRVVIRSGLVVITYLIAISVPFFGDLLSLVGATSCAPLSFILPPLFHLKLKKTKKKSQE 381
                         410       420
                  ....*....|....*....|....*....
gi 66472852   420 SV-----GAVFLLVIGLVVGVLSLSVIIV 443
Cdd:pfam01490 382 KLwkpdiLDVICIVIGLLLMAYGVAGLIL 410
SdaC COG0814
Amino acid permease [Amino acid transport and metabolism];
37-442 1.75e-25

Amino acid permease [Amino acid transport and metabolism];


Pssm-ID: 223884  Cd Length: 415  Bit Score: 107.35  E-value: 1.75e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852  37 GSSFMSSAFNLMNAIMGSGILGLSYAMANTGTVgFSILLLMVASLAAYSIHLLLLLC---DKTGINSYEALGEKALNRPG 113
Cdd:COG0814   8 TSSDLGGVLILAGTAIGAGVLFLPVAFGGGGFW-PGLLLLIIAWPLTYLSLLLLLEAllsSPNGKASITSLVEDYLGKKG 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852 114 KILVACTILIQNIGAMSSYLFILKTELPAAIIGFMRSDSETSgkwfengvTLLILVTVIIVLPLALLPKIGFLGYTSSIA 193
Cdd:COG0814  87 GILIGLSYFFALYGLLVAYIVGIGNLLASFLGNQFGLNPLPR--------KLGSLIFALVLAFLSWLGTLAVLKITSLLV 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852 194 FLFMLFFTVVVVVKkwsipcpLPINSTLSLSLNTSECTAQLFVISSksayAVPTMAFSFLCHTAVFPIYCELHRPTKRRM 273
Cdd:COG0814 159 FGKVIYLVLLVVYL-------IPHWNPANLFALPSASQSFWKYLLL----AIPVFVFSFGFHGNIPSLVNYMRKNSKKAV 227
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852 274 QRATNVSIFLSFVVYLISALFGYLTFYSHVGSELLLAYNT----------YLPRDILVMSVRLAILLAVL---LTVPLIH 340
Cdd:COG0814 228 RKAILIGSLIALVLYILVGFFVFGCFGSLVFGNILAAKEQnisllsalagVINSPILSIALNIFALFAIAtsfLGVYLGL 307
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852 341 FPARKAVLML--CRGEREFSWLSHTL-SCFFILTLVLLLAIFVPDIKNVFGVVGSTTSTCLLFVYPGMFFLRISSEPIRS 417
Cdd:COG0814 308 FEGLADLFKKsnSKPGRKKTGLLTFLpPLIFALLYPWGFAIALGYAGGLIATIGAPIIPALLFIKPRKLIYKLPALKVYG 387
                       410       420
                ....*....|....*....|....*
gi 66472852 418 FNSVGAVFLLVIGLVVGVLSLSVII 442
Cdd:COG0814 388 GNFLLLLLVLLFGILVILSPFLATF 412
PTZ00206 PTZ00206
amino acid transporter; Provisional
42-408 5.66e-25

amino acid transporter; Provisional


Pssm-ID: 240313  Cd Length: 467  Bit Score: 106.49  E-value: 5.66e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   42 SSAFNLMNAIMGSGILGLSYAMANTGTVGFSILLLMVASLAAYSIHLLLLLCDKTGINSYEALGEKALNRPGKILVACTI 121
Cdd:PTZ00206  64 ASAFNIASSTVGAGIVGLPSAANSSGLVMAMIYLIIITAMTIFSIYALGVAADKTNIRTYEGVARVLLGPWGSYYVAATR 143
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852  122 LIQNIGAMSSYLFILKTELPAAIIGFMRSD--SETSGKWFengvtLLILVTVIIVLPLALLPKIGFLGYTSSIAFLFMLF 199
Cdd:PTZ00206 144 AFHGFSACVAYVISVGDILSATLKGTNAPDflKQKSGNRL-----LTSLMWLCFMLPLVIPRHIDSLRYVSTIAVSFMVY 218
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852  200 FTVVVVVKKWSIPCPLPINSTLSLSLNTSECTaqLFVISSKSAYAVPTMAFSFLCHTAVFPIYCELHRPTKRRMQRATNV 279
Cdd:PTZ00206 219 LVIVIVVHSCMNGLPENIKNVSVGKDDNAEII--LFNSGNRAIEGLGVFIFAYVFQITAYEVYMDMTNRSVGKFVLASTI 296
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852  280 SIFLSFVVYLISALFGYLTFYSHVGSELLLAYNTYLPRDILVMSVrlAILLAVLLTVPLIHFPARKAVLMLCRGE-REFS 358
Cdd:PTZ00206 297 AMGMCFTMYVLTAFFGYMDFGRNVTGSVLLMYDPVNEPAIMVGFV--GVLVKLFVSYALLGMACRNALYDVIGWDaRKVA 374
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|
gi 66472852  359 WLSHTLSCFFILTLVLLLAIFVPDIKNVFGVVGSTTSTCLLFVYPGMFFL 408
Cdd:PTZ00206 375 FWKHCIAVVTLSVVMLLCGLFIPKINTVLGFAGSISGGLLGFILPALLFM 424
 
Name Accession Description Interval E-value
Aa_trans pfam01490
Transmembrane amino acid transporter protein; This transmembrane region is found in many amino ...
36-443 1.60e-49

Transmembrane amino acid transporter protein; This transmembrane region is found in many amino acid transporters including UNC-47 and MTR. UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT). UNC-47 is predicted to have 10 transmembrane domains. MTR is a N system amino acid transporter system protein involved in methyltryptophan resistance. Other members of this family include proline transporters and amino acid permeases.


Pssm-ID: 279788  Cd Length: 410  Bit Score: 175.96  E-value: 1.60e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852    36 RGSSFMSSAFNLMNAIMGSGILGLSYAMANTGTVGFSILLLMVASLAAYSIHLLLLLCDKT-----GINSYEALGEKALN 110
Cdd:pfam01490   1 GTISAWQAVFNLINAIIGAGVLSLPYAFKQLGWIPGLILLLIVGLISLYTAHLLVRCSKEVpvtgkRNKSYGDLGYRLLG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   111 RPGKILVACTILIQNIGAMSSYLFILKTELPaAIIGFMRSDSETSGKWFengvtllILVTVIIVLPLALLPKIGFLGYTS 190
Cdd:pfam01490  81 PKGRLLILFAILLNLFGVCISYLIFAGDNLP-AIFDSFFDTCPISLVYF-------IIIFGLIFIPLSFIPNLSALSILS 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   191 SIAFLFMLFFTVVVVVKKWSIpcplpinsTLSLSLNTSECTAQLFVISSKSAYAVPTMAFSFLCHTAVFPIYCELHRPTK 270
Cdd:pfam01490 153 LLAAVSSLYYIVILVLSVAEG--------IVLTAQGVGHLGSKTNIKLAGTFLAIGIIVFAFEGHAVLLPIQNEMKNPSK 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   271 -RRMQRATNVSIFLSFVVYLISALFGYLTFYSHVGSELLLaynTYLPRDILVMSVRLAILLAVLLTVPLIHFPARKAVLM 349
Cdd:pfam01490 225 fKAMTKILLTAIIIATVLYILIGLVGYLAFGDNVKGNILL---NLPKSAWLIDIANLLLVLHVILSFPLQLFPIRQIVEN 301
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   350 L----------CRGEREFSWLSHTLSCFFILTLVLLLAIFVPDIKNVFGVVGSTTSTCLLFVYPGMFFLRISSEPIRSFN 419
Cdd:pfam01490 302 LlfrkeapfgaSGKNNPKSKLLRVVIRSGLVVITYLIAISVPFFGDLLSLVGATSCAPLSFILPPLFHLKLKKTKKKSQE 381
                         410       420
                  ....*....|....*....|....*....
gi 66472852   420 SV-----GAVFLLVIGLVVGVLSLSVIIV 443
Cdd:pfam01490 382 KLwkpdiLDVICIVIGLLLMAYGVAGLIL 410
SdaC COG0814
Amino acid permease [Amino acid transport and metabolism];
37-442 1.75e-25

Amino acid permease [Amino acid transport and metabolism];


Pssm-ID: 223884  Cd Length: 415  Bit Score: 107.35  E-value: 1.75e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852  37 GSSFMSSAFNLMNAIMGSGILGLSYAMANTGTVgFSILLLMVASLAAYSIHLLLLLC---DKTGINSYEALGEKALNRPG 113
Cdd:COG0814   8 TSSDLGGVLILAGTAIGAGVLFLPVAFGGGGFW-PGLLLLIIAWPLTYLSLLLLLEAllsSPNGKASITSLVEDYLGKKG 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852 114 KILVACTILIQNIGAMSSYLFILKTELPAAIIGFMRSDSETSgkwfengvTLLILVTVIIVLPLALLPKIGFLGYTSSIA 193
Cdd:COG0814  87 GILIGLSYFFALYGLLVAYIVGIGNLLASFLGNQFGLNPLPR--------KLGSLIFALVLAFLSWLGTLAVLKITSLLV 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852 194 FLFMLFFTVVVVVKkwsipcpLPINSTLSLSLNTSECTAQLFVISSksayAVPTMAFSFLCHTAVFPIYCELHRPTKRRM 273
Cdd:COG0814 159 FGKVIYLVLLVVYL-------IPHWNPANLFALPSASQSFWKYLLL----AIPVFVFSFGFHGNIPSLVNYMRKNSKKAV 227
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852 274 QRATNVSIFLSFVVYLISALFGYLTFYSHVGSELLLAYNT----------YLPRDILVMSVRLAILLAVL---LTVPLIH 340
Cdd:COG0814 228 RKAILIGSLIALVLYILVGFFVFGCFGSLVFGNILAAKEQnisllsalagVINSPILSIALNIFALFAIAtsfLGVYLGL 307
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852 341 FPARKAVLML--CRGEREFSWLSHTL-SCFFILTLVLLLAIFVPDIKNVFGVVGSTTSTCLLFVYPGMFFLRISSEPIRS 417
Cdd:COG0814 308 FEGLADLFKKsnSKPGRKKTGLLTFLpPLIFALLYPWGFAIALGYAGGLIATIGAPIIPALLFIKPRKLIYKLPALKVYG 387
                       410       420
                ....*....|....*....|....*
gi 66472852 418 FNSVGAVFLLVIGLVVGVLSLSVII 442
Cdd:COG0814 388 GNFLLLLLVLLFGILVILSPFLATF 412
PTZ00206 PTZ00206
amino acid transporter; Provisional
42-408 5.66e-25

amino acid transporter; Provisional


Pssm-ID: 240313  Cd Length: 467  Bit Score: 106.49  E-value: 5.66e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852   42 SSAFNLMNAIMGSGILGLSYAMANTGTVGFSILLLMVASLAAYSIHLLLLLCDKTGINSYEALGEKALNRPGKILVACTI 121
Cdd:PTZ00206  64 ASAFNIASSTVGAGIVGLPSAANSSGLVMAMIYLIIITAMTIFSIYALGVAADKTNIRTYEGVARVLLGPWGSYYVAATR 143
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852  122 LIQNIGAMSSYLFILKTELPAAIIGFMRSD--SETSGKWFengvtLLILVTVIIVLPLALLPKIGFLGYTSSIAFLFMLF 199
Cdd:PTZ00206 144 AFHGFSACVAYVISVGDILSATLKGTNAPDflKQKSGNRL-----LTSLMWLCFMLPLVIPRHIDSLRYVSTIAVSFMVY 218
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852  200 FTVVVVVKKWSIPCPLPINSTLSLSLNTSECTaqLFVISSKSAYAVPTMAFSFLCHTAVFPIYCELHRPTKRRMQRATNV 279
Cdd:PTZ00206 219 LVIVIVVHSCMNGLPENIKNVSVGKDDNAEII--LFNSGNRAIEGLGVFIFAYVFQITAYEVYMDMTNRSVGKFVLASTI 296
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66472852  280 SIFLSFVVYLISALFGYLTFYSHVGSELLLAYNTYLPRDILVMSVrlAILLAVLLTVPLIHFPARKAVLMLCRGE-REFS 358
Cdd:PTZ00206 297 AMGMCFTMYVLTAFFGYMDFGRNVTGSVLLMYDPVNEPAIMVGFV--GVLVKLFVSYALLGMACRNALYDVIGWDaRKVA 374
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|
gi 66472852  359 WLSHTLSCFFILTLVLLLAIFVPDIKNVFGVVGSTTSTCLLFVYPGMFFL 408
Cdd:PTZ00206 375 FWKHCIAVVTLSVVMLLCGLFIPKINTVLGFAGSISGGLLGFILPALLFM 424
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH