NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|62955443|ref|NP_001017737|]
View 

long-chain fatty acid transport protein 4 [Danio rerio]

Protein Classification

hsFATP4_like domain-containing protein (domain architecture ID 10149284)

hsFATP4_like domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
hsFATP4_like cd05939
Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins; Fatty ...
99-608 0e+00

Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins; Fatty acid transport protein (FATP) transports long-chain or very-long-chain fatty acids across the plasma membrane. At least five copies of FATPs are identified in mammalian cells. This family includes FATP4, FATP1, and homologous proteins. Each FATP has unique patterns of tissue distribution. FATP4 is mainly expressed in the brain, testis, colon and kidney. FATPs also have fatty acid CoA synthetase activity, thus playing dual roles as fatty acid transporters and its activation enzymes. FATPs are the key players in the trafficking of exogenous fatty acids into the cell and in intracellular fatty acid homeostasis.


:

Pssm-ID: 213305  Cd Length: 474  Bit Score: 968.82  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  99 DEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVV 178
Cdd:cd05939   1 DRHWTFRELNEYSNKVANFFQAQGYRSGDVVALFMENRLEFVALWLGLAKIGVETALINSNLRLESLLHCITVSKAKALI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 179 FgselteamcevhssmgktvklfvsgewdpkrvpvgtEHLDPLLETTSTIQPKQPDRSFTDRLFYIYTSGTTGMPKAAIV 258
Cdd:cd05939  81 F------------------------------------NLLDPLLTQSSTEPPSQDDVNFRDKLFYIYTSGTTGLPKAAVI 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 259 VHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEIC 338
Cdd:cd05939 125 VHSRYYRIAAGAYYAFGMRPEDVVYDCLPLYHSAGGIMGVGQALLHGSTVVIRKKFSASNFWDDCVKYNCTIVQYIGEIC 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 339 RYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPQIAEFYGATECNCSLGNFDNKTGACGFNSRILPYVYPIRL 418
Cdd:cd05939 205 RYLLAQPPSEEEQKHNVRLAVGNGLRPQIWEQFVRRFGIPQIGEFYGATEGNSSLVNIDNHVGACGFNSRILPSVYPIRL 284
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 419 VKVDEETMELIRGPDGVCIPCGPGEPGQLVGRIIQNDPLRRFDGYVNQTATNKKIAQDVFKKGDSAYLSGDVLVMDDFGY 498
Cdd:cd05939 285 IKVDEDTGELIRDSDGLCIPCQPGEPGLLVGKIIQNDPLRRFDGYVNEGATNKKIARDVFKKGDSAFLSGDVLVMDELGY 364
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 499 MYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAEGKAGMAAIADPENNTDLAKFSRDLEKALPPYAR 578
Cdd:cd05939 365 LYFKDRTGDTFRWKGENVSTTEVEGILSNVLGLEDVVVYGVEVPGVEGRAGMAAIVDPERKVDLDRFSAVLAKSLPPYAR 444
                       490       500       510
                ....*....|....*....|....*....|
gi 62955443 579 PVFLRFLPEVDKTGTFKFQKTDMRRDGFDP 608
Cdd:cd05939 445 PQFIRLLPEVDKTGTFKLQKTDLQKEGYDP 474
 
Name Accession Description Interval E-value
hsFATP4_like cd05939
Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins; Fatty ...
99-608 0e+00

Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins; Fatty acid transport protein (FATP) transports long-chain or very-long-chain fatty acids across the plasma membrane. At least five copies of FATPs are identified in mammalian cells. This family includes FATP4, FATP1, and homologous proteins. Each FATP has unique patterns of tissue distribution. FATP4 is mainly expressed in the brain, testis, colon and kidney. FATPs also have fatty acid CoA synthetase activity, thus playing dual roles as fatty acid transporters and its activation enzymes. FATPs are the key players in the trafficking of exogenous fatty acids into the cell and in intracellular fatty acid homeostasis.


Pssm-ID: 213305  Cd Length: 474  Bit Score: 968.82  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  99 DEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVV 178
Cdd:cd05939   1 DRHWTFRELNEYSNKVANFFQAQGYRSGDVVALFMENRLEFVALWLGLAKIGVETALINSNLRLESLLHCITVSKAKALI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 179 FgselteamcevhssmgktvklfvsgewdpkrvpvgtEHLDPLLETTSTIQPKQPDRSFTDRLFYIYTSGTTGMPKAAIV 258
Cdd:cd05939  81 F------------------------------------NLLDPLLTQSSTEPPSQDDVNFRDKLFYIYTSGTTGLPKAAVI 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 259 VHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEIC 338
Cdd:cd05939 125 VHSRYYRIAAGAYYAFGMRPEDVVYDCLPLYHSAGGIMGVGQALLHGSTVVIRKKFSASNFWDDCVKYNCTIVQYIGEIC 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 339 RYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPQIAEFYGATECNCSLGNFDNKTGACGFNSRILPYVYPIRL 418
Cdd:cd05939 205 RYLLAQPPSEEEQKHNVRLAVGNGLRPQIWEQFVRRFGIPQIGEFYGATEGNSSLVNIDNHVGACGFNSRILPSVYPIRL 284
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 419 VKVDEETMELIRGPDGVCIPCGPGEPGQLVGRIIQNDPLRRFDGYVNQTATNKKIAQDVFKKGDSAYLSGDVLVMDDFGY 498
Cdd:cd05939 285 IKVDEDTGELIRDSDGLCIPCQPGEPGLLVGKIIQNDPLRRFDGYVNEGATNKKIARDVFKKGDSAFLSGDVLVMDELGY 364
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 499 MYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAEGKAGMAAIADPENNTDLAKFSRDLEKALPPYAR 578
Cdd:cd05939 365 LYFKDRTGDTFRWKGENVSTTEVEGILSNVLGLEDVVVYGVEVPGVEGRAGMAAIVDPERKVDLDRFSAVLAKSLPPYAR 444
                       490       500       510
                ....*....|....*....|....*....|
gi 62955443 579 PVFLRFLPEVDKTGTFKFQKTDMRRDGFDP 608
Cdd:cd05939 445 PQFIRLLPEVDKTGTFKLQKTDLQKEGYDP 474
PRK08279 PRK08279
long-chain-acyl-CoA synthetase; Validated
73-643 0e+00

long-chain-acyl-CoA synthetase; Validated


Pssm-ID: 236217  Cd Length: 600  Bit Score: 720.12  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   73 RNTVPKLFAKSVKKYGNKTALIFEgtDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVE 152
Cdd:PRK08279  36 KRSLGDVFEEAAARHPDRPALLFE--DQSISYAELNARANRYAHWAAARGVGKGDVVALLMENRPEYLAAWLGLAKLGAV 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  153 AALINFNLRLEALVHCVNISSAKAVVFGSELTEAMCEVHSSMGKTVKLFVSGEwDPKRVPVGTEHLDPLLETTSTIQPKQ 232
Cdd:PRK08279 114 VALLNTQQRGAVLAHSLNLVDAKHLIVGEELVEAFEEARADLARPPRLWVAGG-DTLDDPEGYEDLAAAAAGAPTTNPAS 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  233 PDRSFT-DRLFYIYTSGTTGMPKAAIVVHSRYYRMAAlvyyGF----RMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMT 307
Cdd:PRK08279 193 RSGVTAkDTAFYIYTSGTTGLPKAAVMSHMRWLKAMG----GFggllRLTPDDVLYCCLPLYHNTGGTVAWSSVLAAGAT 268
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  308 VVIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPQIAEFYGAT 387
Cdd:PRK08279 269 LALRRKFSASRFWDDVRRYRATAFQYIGELCRYLLNQPPKPTDRDHRLRLMIGNGLRPDIWDEFQQRFGIPRILEFYAAS 348
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  388 ECNCSLGNFDNKTGACGFNSRILPyvYPIRLVKVDEETMELIRGPDGVCIPCGPGEPGQLVGRIiqnDPLRRFDGYVNQT 467
Cdd:PRK08279 349 EGNVGFINVFNFDGTVGRVPLWLA--HPYAIVKYDVDTGEPVRDADGRCIKVKPGEVGLLIGRI---TDRGPFDGYTDPE 423
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  468 ATNKKIAQDVFKKGDSAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAEGK 547
Cdd:PRK08279 424 ASEKKILRDVFKKGDAWFNTGDLMRDDGFGHAQFVDRLGDTFRWKGENVATTEVENALSGFPGVEEAVVYGVEVPGTDGR 503
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  548 AGMAAI-ADPENNTDLAKFSRDLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRDGFDPNIVSDKLYFLDRTKGQYV 626
Cdd:PRK08279 504 AGMAAIvLADGAEFDLAALAAHLYERLPAYAVPLFVRLVPELETTGTFKYRKVDLRKEGFDPSKVDDPLYVLDPGSGGYV 583
                        570
                 ....*....|....*..
gi 62955443  627 ELNAELHRNIVSGKQKL 643
Cdd:PRK08279 584 PLTAELYAEIAAGKFRL 600
CaiC COG0318
Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Lipid transport and metabolism, ...
75-603 1.30e-98

Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Lipid transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism];


Pssm-ID: 223395  Cd Length: 534  Bit Score: 315.55  E-value: 1.30e-98
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  75 TVPKLFAKSVKKYGNKTALIFEGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAA 154
Cdd:COG0318  12 TLASLLERAARRNPDRPALIFLGRGGRLTYRELDRRANRLAAALQALGVKPGDRVAILLPNSPEFLIAFLAALRAGAVAV 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 155 LINFNLRLEALVHCVNISSAKaVVFGSELTEAMCEVHSSMGKTVKLFVSGEWDPKRVPVGTEHLDPLLETTSTIQPKQPD 234
Cdd:COG0318  92 PLNPRLTPRELAYILNDAGAK-VLITSAEFAALLEAVAEALPVVLVVLLVGDADDRLPITLEALAAEGPGPDADARPVDP 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 235 RsftDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALV--YYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVI-- 310
Cdd:COG0318 171 D---DLAFLLYTSGTTGLPKGVVLTHRNLLANAAGIaaALGGGLTPDDVVLSWLPLFHIFGLIVGLLAPLLGGGTLVLls 247
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 311 RKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQP-RKDTERKHKVRMALGNG--LRQSIWEEFTNRFNVPQIAEFYGAT 387
Cdd:COG0318 248 PEPFDPEEVLWLIEKYKVTVLSGVPTFLRELLDNPeKDDDDLSSSLRLVLSGGapLPPELLERFEERFGPIAILEGYGLT 327
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 388 E-----CNCSLGNFDNKTGACGfnsRILPYVYpIRLvkVDEETMELIrgpdgvcipcgPGEPGQLVGRIIQNdplrrFDG 462
Cdd:COG0318 328 EtspvvTINPPDDLLAKPGSVG---RPLPGVE-VRI--VDPDGGEVL-----------PGEVGEIWVRGPNV-----MKG 385
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 463 YVNQT-ATNKKIAQDVFkkgdsaYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV-- 539
Cdd:COG0318 386 YWNRPeATAEAFDEDGW------LRTGDLGYVDEDGYLYIVGRLKDLIISGGENIYPEEIEAVLAEHPAVAEAAVVGVpd 459
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 540 ----EVPGA--EGKAGMAAIADPEnntDLAKFsrdLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRR 603
Cdd:COG0318 460 erwgERVVAvvVLKPGGDAELTAE---ELRAF---LRKRLALYKVPRIVVFVDELPRTASGKIDRRALRE 523
AMP-binding pfam00501
AMP-binding enzyme;
83-503 2.43e-60

AMP-binding enzyme;


Pssm-ID: 306899  Cd Length: 405  Bit Score: 209.47  E-value: 2.43e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443    83 SVKKYGNKTALIFeGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRL 162
Cdd:pfam00501   1 QAARTPDKTALGV-GEGRRLTYRELDERANRLAAGLRALGVGPGDRVAILLPNSPEWVVAFLACLKAGAVYVPLNPRLPA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   163 EALVHCVNISSAKAVVFGSELTEAMCEVHSSMGK-----TVKLFVSGEWDPKRVPVGTEHLDPLLETTSTIQPKQPDrsf 237
Cdd:pfam00501  80 EELAYILEDSGAKVLITDDDGALKLEELLEALGKlevvvLVLVLDADPVLKEEPLPEEAEPAAVPPLVPPPVPPDPD--- 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   238 tDRLFYIYTSGTTGMPKAAIVVHSRYYRMAAL--VYYGFRMKPEDVLYDCLPLYHSAGnIVGIGQGLIHGMTVVIRKKFS 315
Cdd:pfam00501 157 -DLAYIIYTSGTTGKPKGVMLTHRNLVANVLAlkVPRYFRLGPDDVYLSTLPLFHDFG-LLGLLGPLLAGATVVLPPKFP 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   316 ASK--FWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMAL--GNGLRQSIWEEFTNRFNvPQIAEFYGATECNC 391
Cdd:pfam00501 235 ARDprLLELIERYKVTVLYGVPTLLNMLLEAGEPKAKDLSSLRLVLsgGAPLPPELARRLRELFG-PPLVNGYGLTETTG 313
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   392 ------SLGNFDNKTGACGfnsRILPYVypiRLVKVDEETMElirgpdgvciPCGPGEPGQLV--GRIIqndplrrFDGY 463
Cdd:pfam00501 314 vvttplPLDDDLRSLGSVG---RPLPGT---EVKIVDDEGGE----------PVPPGEPGELCirGPGV-------MKGY 370
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|.
gi 62955443   464 VNQ-TATNKkiaqdVFKKGDsAYLSGDVLVMDDFGYMYFRD 503
Cdd:pfam00501 371 LNDpELTAE-----AFDEDG-WYRTGDLGRRDEDGYLEIVG 405
benz_CoA_lig TIGR02262
benzoate-CoA ligase family; Characterized members of this protein family include benzoate-CoA ...
63-602 1.06e-28

benzoate-CoA ligase family; Characterized members of this protein family include benzoate-CoA ligase, 4-hydroxybenzoate-CoA ligase, 2-aminobenzoate-CoA ligase, etc. Members are related to fatty acid and acetate CoA ligases.


Pssm-ID: 274059  Cd Length: 505  Bit Score: 120.33  E-value: 1.06e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443    63 KLNVKKHLRERNTVpklfaksvKKYGNKTAliFEGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGL 142
Cdd:TIGR02262   2 KYNAAEDLLDRNVV--------EGRGGKTA--FIDDISSLSYGELEAQVRRLAAALRRLGVKREERVLLLMLDGVDFPIA 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   143 WLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVVFGSELTEAMCEVHSSMGKTVKLFVSGewdpkRVPVGTEHLDPLL 222
Cdd:TIGR02262  72 FLGAIRAGIVPVALNTLLTADDYAYMLEDSRARVVFVSGALLPVIKAALGKSPHLEHRVVVG-----RPEAGEVQLAELL 146
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   223 ETTS---TIQPKQPDrsftDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALvyYGFR---MKPEDVLYDCLPLYHSagniV 296
Cdd:TIGR02262 147 ATESeqfKPAATQAD----DPAFWLYSSGSTGMPKGVVHTHSNPYWTAEL--YARNtlgIREDDVCFSAAKLFFA----Y 216
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   297 GIGQGLIHGMTV-----VIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMAL--GNGLRQSIWE 369
Cdd:TIGR02262 217 GLGNALTFPMSVgattvLMGERPTPDAVFDRLRRHQPTIFYGVPTLYAAMLADPNLPSEDQVRLRLCTsaGEALPAEVGQ 296
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   370 EFTNRFNVpQIAEFYGATEcncsLGN--FDNKTGACGFNSRILPYV-YPIRLVKVDEEtmelirgpdgvciPCGPGEPGQ 446
Cdd:TIGR02262 297 RWQARFGV-DIVDGIGSTE----MLHifLSNLPGDVRYGTSGKPVPgYRLRLVGDGGQ-------------DVADGEPGE 358
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   447 LvgriiQNDPLRRFDGYVNQTATNKKIAQDVFKKgdsaylSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLS 526
Cdd:TIGR02262 359 L-----LISGPSSATMYWNNRAKSRDTFQGEWTR------SGDKYVRNDDGSYTYAGRTDDMLKVSGIYVSPFEIESALI 427
                         490       500       510       520       530       540       550
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 62955443   527 RLLDMKDVVVYGVEVPGAEGKAGMAAIADPENN---TDLAKFSRDlekALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:TIGR02262 428 QHPAVLEAAVVGVADEDGLIKPKAFVVLRPGQTaleTELKEHVKD---RLAPYKYPRWIVFVDDLPKTATGKIQRFKLR 503
 
Name Accession Description Interval E-value
hsFATP4_like cd05939
Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins; Fatty ...
99-608 0e+00

Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins; Fatty acid transport protein (FATP) transports long-chain or very-long-chain fatty acids across the plasma membrane. At least five copies of FATPs are identified in mammalian cells. This family includes FATP4, FATP1, and homologous proteins. Each FATP has unique patterns of tissue distribution. FATP4 is mainly expressed in the brain, testis, colon and kidney. FATPs also have fatty acid CoA synthetase activity, thus playing dual roles as fatty acid transporters and its activation enzymes. FATPs are the key players in the trafficking of exogenous fatty acids into the cell and in intracellular fatty acid homeostasis.


Pssm-ID: 213305  Cd Length: 474  Bit Score: 968.82  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  99 DEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVV 178
Cdd:cd05939   1 DRHWTFRELNEYSNKVANFFQAQGYRSGDVVALFMENRLEFVALWLGLAKIGVETALINSNLRLESLLHCITVSKAKALI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 179 FgselteamcevhssmgktvklfvsgewdpkrvpvgtEHLDPLLETTSTIQPKQPDRSFTDRLFYIYTSGTTGMPKAAIV 258
Cdd:cd05939  81 F------------------------------------NLLDPLLTQSSTEPPSQDDVNFRDKLFYIYTSGTTGLPKAAVI 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 259 VHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEIC 338
Cdd:cd05939 125 VHSRYYRIAAGAYYAFGMRPEDVVYDCLPLYHSAGGIMGVGQALLHGSTVVIRKKFSASNFWDDCVKYNCTIVQYIGEIC 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 339 RYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPQIAEFYGATECNCSLGNFDNKTGACGFNSRILPYVYPIRL 418
Cdd:cd05939 205 RYLLAQPPSEEEQKHNVRLAVGNGLRPQIWEQFVRRFGIPQIGEFYGATEGNSSLVNIDNHVGACGFNSRILPSVYPIRL 284
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 419 VKVDEETMELIRGPDGVCIPCGPGEPGQLVGRIIQNDPLRRFDGYVNQTATNKKIAQDVFKKGDSAYLSGDVLVMDDFGY 498
Cdd:cd05939 285 IKVDEDTGELIRDSDGLCIPCQPGEPGLLVGKIIQNDPLRRFDGYVNEGATNKKIARDVFKKGDSAFLSGDVLVMDELGY 364
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 499 MYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAEGKAGMAAIADPENNTDLAKFSRDLEKALPPYAR 578
Cdd:cd05939 365 LYFKDRTGDTFRWKGENVSTTEVEGILSNVLGLEDVVVYGVEVPGVEGRAGMAAIVDPERKVDLDRFSAVLAKSLPPYAR 444
                       490       500       510
                ....*....|....*....|....*....|
gi 62955443 579 PVFLRFLPEVDKTGTFKFQKTDMRRDGFDP 608
Cdd:cd05939 445 PQFIRLLPEVDKTGTFKLQKTDLQKEGYDP 474
PRK08279 PRK08279
long-chain-acyl-CoA synthetase; Validated
73-643 0e+00

long-chain-acyl-CoA synthetase; Validated


Pssm-ID: 236217  Cd Length: 600  Bit Score: 720.12  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   73 RNTVPKLFAKSVKKYGNKTALIFEgtDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVE 152
Cdd:PRK08279  36 KRSLGDVFEEAAARHPDRPALLFE--DQSISYAELNARANRYAHWAAARGVGKGDVVALLMENRPEYLAAWLGLAKLGAV 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  153 AALINFNLRLEALVHCVNISSAKAVVFGSELTEAMCEVHSSMGKTVKLFVSGEwDPKRVPVGTEHLDPLLETTSTIQPKQ 232
Cdd:PRK08279 114 VALLNTQQRGAVLAHSLNLVDAKHLIVGEELVEAFEEARADLARPPRLWVAGG-DTLDDPEGYEDLAAAAAGAPTTNPAS 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  233 PDRSFT-DRLFYIYTSGTTGMPKAAIVVHSRYYRMAAlvyyGF----RMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMT 307
Cdd:PRK08279 193 RSGVTAkDTAFYIYTSGTTGLPKAAVMSHMRWLKAMG----GFggllRLTPDDVLYCCLPLYHNTGGTVAWSSVLAAGAT 268
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  308 VVIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPQIAEFYGAT 387
Cdd:PRK08279 269 LALRRKFSASRFWDDVRRYRATAFQYIGELCRYLLNQPPKPTDRDHRLRLMIGNGLRPDIWDEFQQRFGIPRILEFYAAS 348
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  388 ECNCSLGNFDNKTGACGFNSRILPyvYPIRLVKVDEETMELIRGPDGVCIPCGPGEPGQLVGRIiqnDPLRRFDGYVNQT 467
Cdd:PRK08279 349 EGNVGFINVFNFDGTVGRVPLWLA--HPYAIVKYDVDTGEPVRDADGRCIKVKPGEVGLLIGRI---TDRGPFDGYTDPE 423
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  468 ATNKKIAQDVFKKGDSAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAEGK 547
Cdd:PRK08279 424 ASEKKILRDVFKKGDAWFNTGDLMRDDGFGHAQFVDRLGDTFRWKGENVATTEVENALSGFPGVEEAVVYGVEVPGTDGR 503
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  548 AGMAAI-ADPENNTDLAKFSRDLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRDGFDPNIVSDKLYFLDRTKGQYV 626
Cdd:PRK08279 504 AGMAAIvLADGAEFDLAALAAHLYERLPAYAVPLFVRLVPELETTGTFKYRKVDLRKEGFDPSKVDDPLYVLDPGSGGYV 583
                        570
                 ....*....|....*..
gi 62955443  627 ELNAELHRNIVSGKQKL 643
Cdd:PRK08279 584 PLTAELYAEIAAGKFRL 600
FATP_FACS cd05940
Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its ...
99-608 0e+00

Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes; Fatty acid transport protein (FATP) transports long-chain or very-long-chain fatty acids across the plasma membrane. FATPs also have fatty acid CoA synthetase activity, thus playing dual roles as fatty acid transporters and its activation enzymes. At least five copies of FATPs are identified in mammalian cells. This family also includes prokaryotic FATPs. FATPs are the key players in the trafficking of exogenous fatty acids into the cell and in intracellular fatty acid homeostasis.


Pssm-ID: 213306  Cd Length: 444  Bit Score: 685.12  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  99 DEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVV 178
Cdd:cd05940   1 DRRLSYAEFNAWANRYAHALRALGVKKGDVVALLMENRPEYLLAWLALAKLGAVAALINTTQRGEVLAHCINVSDARAVI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 179 fgselteamcevhssmgktvklfvsgewdpkrvpvgtehldpllettstiqpkqpdrsfTDRLFYIYTSGTTGMPKAAIV 258
Cdd:cd05940  81 -----------------------------------------------------------VDPAFYIYTSGTTGLPKAAIM 101
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 259 VHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEIC 338
Cdd:cd05940 102 SHRRWLRAGAVFGGLGLLKPDDVLYLCLPLYHSNALTVGWSSALAAGASLALRRKFSASQFWPDVRRYGATAFQYVGELC 181
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 339 RYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPQIAEFYGATECNCSLGNFDNKTGACGFNSRilpyvYPIRL 418
Cdd:cd05940 182 RYLLNQPEKPDDRDHPLRKIIGNGLRPDIWDEFKERFGVPRIVEFYGSTEGNVGFINLFNKPGAVGRLPP-----AAIAV 256
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 419 VKVDEETMELIRGPDGVCIPCGPGEPGQLVGRIiqnDPLRRFDGYVNQTATNKKIAQDVFKKGDSAYLSGDVLVMDDFGY 498
Cdd:cd05940 257 VKYDVETEEPIRDANGFCIKVPPGEVGLLLGEI---TDRNPFDGYTDDEATEKKILRDVFKKGDAYFNTGDLVRRDGFGY 333
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 499 MYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAEGKAGMAAIA-DPENNTDLAKFSRDLEKALPPYA 577
Cdd:cd05940 334 FYFVDRLGDTFRWKGENVSTTEVEEVLAKHPGVEEANVYGVEVPGTEGRAGMAALTlAPGAAFDPQAFAAHLDEQLPAYA 413
                       490       500       510
                ....*....|....*....|....*....|.
gi 62955443 578 RPVFLRFLPEVDKTGTFKFQKTDMRRDGFDP 608
Cdd:cd05940 414 RPLFLRVQAAMETTGTFKYQKTDLRKEGFDP 444
hsFATP2a_ACSVL_like cd05938
Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar ...
99-633 0e+00

Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins; Fatty acid transport proteins (FATP) of this family transport long-chain or very-long-chain fatty acids across the plasma membrane. At least five copies of FATPs are identified in mammalian cells. This family includes hsFATP2, hsFATP5, and hsFATP6, and similar proteins. Each FATP has unique patterns of tissue distribution. These FATPs also have fatty acid CoA synthetase activity, thus playing dual roles as fatty acid transporters and its activation enzymes. The hsFATP proteins exist in two splice variants; the b variant, lacking exon 3, has no acyl-CoA synthetase activity. FATPs are key players in the trafficking of exogenous fatty acids into the cell and in intracellular fatty acid homeostasis.


Pssm-ID: 213304  Cd Length: 535  Bit Score: 564.33  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  99 DEKWSFKELDEYSNRVANFLLQQ-GFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAV 177
Cdd:cd05938   1 GETVTYAEVDKRSNQVARALLAHaGLKPGDTVALLLGNEPAFLWIWLGLAKLGCPTAFLNTNIRSGSLLHCFRCCGARVL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 178 VFGSELTEAMCEVHSSMGKT-VKLFVSGewdPKRVPVGTEHLDPLLETTSTIQPKQPDRS---FTDRLFYIYTSGTTGMP 253
Cdd:cd05938  81 VADPELLEAVEEILPALRAMgVRVFYLS---HTSPPEGVISLLAKVDAASDEPVPASLRSgvsIRSTALYIYTSGTTGLP 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 254 KAAIVVHSRYYRMAAlVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQY 333
Cdd:cd05938 158 KAARISHLRVLQCSG-MLSLCGVTADDVVYTTLPLYHSSGALLGIVGCIGLGATLVLKPKFSASQFWDDCRKYNVTVFQY 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 334 IGEICRYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPQIAEFYGATECNCSLGNFDNKTGACGFNSRILPYV 413
Cdd:cd05938 237 IGELLRYLCNQPQSDNDRDHKVRLAIGNGLRPDVWREFLRRFGPIHVWETYASTEGNIGFINYTGRVGAVGRASCLYKLL 316
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 414 YPIRLVKVDEETMELIRGPDGVCIPCGPGEPGQLVGRIIQNDPlrrFDGYV-NQTATNKKIAQDVFKKGDSAYLSGDVLV 492
Cdd:cd05938 317 SPFELIKYDVEKDEPVRDAQGFCIPVGKGEPGLLISKITSQSP---FLGYAgPRELTEKKLLRDVFKKGDVYFNTGDLLV 393
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 493 MDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAEGKAGMAAIA-DPENNTDLAKFSRDLEK 571
Cdd:cd05938 394 QDRQNFLYFHDRTGDTFRWKGENVATTEVADILTMVDFIQEVNVYGVTVPGHEGRAGMAAVIlKPGTEFDLEKLYQHVRE 473
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 62955443 572 ALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRDGFDPNIVSDKLYFLDRTKGQYVELNAELH 633
Cdd:cd05938 474 FLPAYARPRFLRIQDSMEVTGTFKQQKVRLVEEGFNPSIISDPLYFLDNREKSYVPLTQEIY 535
FATP_chFAT1_like cd05937
Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA ...
95-608 3.24e-146

Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi; Fatty acid transport protein (FATP) transports long-chain or very-long-chain fatty acids across the plasma membrane. FATPs also have fatty acid CoA synthetase activity, thus playing dual roles as fatty acid transporters and its activation enzymes. FATPs are the key players in the trafficking of exogenous fatty acids into the cell and in intracellular fatty acid homeostasis. Members of this family are fungal FATPs, including FAT1 from Cochliobolus heterostrophus.


Pssm-ID: 213303  Cd Length: 468  Bit Score: 436.50  E-value: 3.24e-146
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  95 FEGtdEKWSFKELDEYSNRVANFLL-QQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISS 173
Cdd:cd05937   1 FEG--KTWTYSETYDLVLRYAHWLHgDRNVQSGDFVAIDTTNSAEFVFLWLALWSIGAVPAFINYNLSGDPLIHCLKISG 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 174 AKAVVFgselteamcevhssmgktvklfvsgewDPKrvpvgtehlDPLLettstiqpkqpdrsftdrlfYIYTSGTTGMP 253
Cdd:cd05937  79 AKFVIV---------------------------DPD---------DPAA--------------------LIYTSGTTGLP 102
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 254 KAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQY 333
Cdd:cd05937 103 KGCAISWRRTLVTSNPLSHDLNLQFPDRTYTCMPLYHGTAAFLGLCYCLGSGGTLCLSRKFSASQFWKDVRDSEATIIQY 182
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 334 IGEICRYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPQIAEFYGATECNCSLGNF---DNKTGACGFNSRIL 410
Cdd:cd05937 183 VGELCRYLLATPPSPYDRDHKVRVAYGNGLRPDIWERFRERFNVPEIGEFYAATEGVFAFTNHnvgPFTAGAIGFSGLIR 262
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 411 PYVYP--IRLVKVDEETMELIRGP-DGVCIPCGPGEPGQLVGRiIQNDPLRRFDGYV-NQTATNKKIAQDVFKKGDSAYL 486
Cdd:cd05937 263 RWFLEnqVFLVKMDPETDMPIRDPkTGFCVRAPVGEPGEMLGR-VRFKNRELFQGYLkNEDATESKLLRDVFRKGDIWYR 341
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 487 SGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAEGKAGMAAIADPENNTD----- 561
Cdd:cd05937 342 TGDLLRQDADGRWYFLDRLGDTFRWKSENVSTGEVADVLGAIPSVAEANVYGVKVPGYDGRAGCAAITLEESSAVeteft 421
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|
gi 62955443 562 ---LAKFSRdleKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRDGFDP 608
Cdd:cd05937 422 knlLAKLAR---KRLPSYAVPLFLRLTEEVATTGNHKQQKGVLRKEGVDP 468
CaiC COG0318
Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Lipid transport and metabolism, ...
75-603 1.30e-98

Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Lipid transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism];


Pssm-ID: 223395  Cd Length: 534  Bit Score: 315.55  E-value: 1.30e-98
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  75 TVPKLFAKSVKKYGNKTALIFEGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAA 154
Cdd:COG0318  12 TLASLLERAARRNPDRPALIFLGRGGRLTYRELDRRANRLAAALQALGVKPGDRVAILLPNSPEFLIAFLAALRAGAVAV 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 155 LINFNLRLEALVHCVNISSAKaVVFGSELTEAMCEVHSSMGKTVKLFVSGEWDPKRVPVGTEHLDPLLETTSTIQPKQPD 234
Cdd:COG0318  92 PLNPRLTPRELAYILNDAGAK-VLITSAEFAALLEAVAEALPVVLVVLLVGDADDRLPITLEALAAEGPGPDADARPVDP 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 235 RsftDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALV--YYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVI-- 310
Cdd:COG0318 171 D---DLAFLLYTSGTTGLPKGVVLTHRNLLANAAGIaaALGGGLTPDDVVLSWLPLFHIFGLIVGLLAPLLGGGTLVLls 247
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 311 RKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQP-RKDTERKHKVRMALGNG--LRQSIWEEFTNRFNVPQIAEFYGAT 387
Cdd:COG0318 248 PEPFDPEEVLWLIEKYKVTVLSGVPTFLRELLDNPeKDDDDLSSSLRLVLSGGapLPPELLERFEERFGPIAILEGYGLT 327
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 388 E-----CNCSLGNFDNKTGACGfnsRILPYVYpIRLvkVDEETMELIrgpdgvcipcgPGEPGQLVGRIIQNdplrrFDG 462
Cdd:COG0318 328 EtspvvTINPPDDLLAKPGSVG---RPLPGVE-VRI--VDPDGGEVL-----------PGEVGEIWVRGPNV-----MKG 385
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 463 YVNQT-ATNKKIAQDVFkkgdsaYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV-- 539
Cdd:COG0318 386 YWNRPeATAEAFDEDGW------LRTGDLGYVDEDGYLYIVGRLKDLIISGGENIYPEEIEAVLAEHPAVAEAAVVGVpd 459
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 540 ----EVPGA--EGKAGMAAIADPEnntDLAKFsrdLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRR 603
Cdd:COG0318 460 erwgERVVAvvVLKPGGDAELTAE---ELRAF---LRKRLALYKVPRIVVFVDELPRTASGKIDRRALRE 523
FACL_DitJ_like cd05934
Uncharacterized subfamily of fatty acid CoA ligase (FACL); Fatty acyl-CoA ligases catalyze the ...
99-602 1.54e-88

Uncharacterized subfamily of fatty acid CoA ligase (FACL); Fatty acyl-CoA ligases catalyze the ATP-dependent activation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions. Members of this family include DitJ from Pseudomonas and similar proteins.


Pssm-ID: 213300  Cd Length: 421  Bit Score: 285.23  E-value: 1.54e-88
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  99 DEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVV 178
Cdd:cd05934   1 GRRYTYAELAERVNRLAAGLLALGVRPGDRVALMLDNCPEFLRAWFALNKLGAVAVPINTALRGEELAHILDHSGARLIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 179 FgselteAMCEVhssmgktvklfvsgewdpkrvpvgtehldpllettstiqpkqpdrsftdrlfyIYTSGTTGMPKAAIV 258
Cdd:cd05934  81 V------DTAAI-----------------------------------------------------LYTSGTTGPPKGVLL 101
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 259 VHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEIC 338
Cdd:cd05934 102 THAQLLFAARLAARLLGLRPDDVLLTPLPLFHINAQAYSVYAALLVGATLVLLPRFSASRFWDQVRKHGATVFNLLGAMA 181
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 339 RYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPqIAEFYGATECNCSLGNFDNKT--GACGfnsRILPYvYPI 416
Cdd:cd05934 182 AILMKQPPSPDDRDHPLRFVFGAPLPAAIWPAFEERFGVK-LVEGYGMTETGVPIIAPGDPAppGSCG---RPRPG-VEV 256
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 417 RLvkVDEETMELirgpdgvcipcGPGEPGQLVGRIIQNDPLrrFDGYV-NQTATNKKIAQDVFKKGDSAYLsgdvlvmDD 495
Cdd:cd05934 257 RI--VDEDGREV-----------PPGEVGELVVRPRRPWAM--FKGYYgMPEATAKAWRNGWFHTGDRGRR-------DE 314
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 496 FGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGveVPGAEG-KAGMAAIADPENNT----DLAKFSRDle 570
Cdd:cd05934 315 DGFLYFVDRKKDAIRRRGENISSYEVEAAILAHPAVAEAAVVA--VPSELGeDEVKAVVVLRPGETldpeALLEFCRD-- 390
                       490       500       510
                ....*....|....*....|....*....|..
gi 62955443 571 kALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:cd05934 391 -RLPYFMVPRYIEFVDELPKTPTEKIQKAELR 421
PRK06155 PRK06155
crotonobetaine/carnitine-CoA ligase; Provisional
75-609 3.54e-74

crotonobetaine/carnitine-CoA ligase; Provisional


Pssm-ID: 235719  Cd Length: 542  Bit Score: 250.83  E-value: 3.54e-74
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   75 TVPKLFAKSVKKYGNKTALIFEGTdeKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAA 154
Cdd:PRK06155  22 TLPAMLARQAERYPDRPLLVFGGT--RWTYAEAARAAAAAAHALAAAGVKRGDRVALMCGNRIEFLDVFLGCAWLGAIAV 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  155 LINFNLRLEALVHCVNISSAKAVVFGSELTEAMCEVHSSMGKTVKLFVSGEWDPKRVPVG--TEHLDPLLE--TTSTIQP 230
Cdd:PRK06155 100 PINTALRGPQLEHILRNSGARLLVVEAALLAALEAADPGDLPLPAVWLLDAPASVSVPAGwsTAPLPPLDApaPAAAVQP 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  231 kqpdrsfTDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHS-AGNivGIGQGLIHGMTVV 309
Cdd:PRK06155 180 -------GDTAAILYTSGTTGPSKGVCCPHAQFYWWGRNSAEDLEIGADDVLYTTLPLFHTnALN--AFFQALLAGATYV 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  310 IRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPqIAEFYGATEC 389
Cdd:PRK06155 251 LEPRFSASGFWPAVRRHGATVTYLLGAMVSILLSQPARESDRAHRVRVALGPGVPAALHAAFRERFGVD-LLDGYGSTET 329
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  390 N--CSLGNFDNKTG-----ACGFNSRIlpyvypirlvkVDEETMELirgPdgvcipcgPGEPGQLVGRiiQNDPLRRFDG 462
Cdd:PRK06155 330 NfvIAVTHGSQRPGsmgrlAPGFEARV-----------VDEHDQEL---P--------DGEPGELLLR--ADEPFAFATG 385
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  463 YVNQTATNKKIAQDVFkkgdsaYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVP 542
Cdd:PRK06155 386 YFGMPEKTVEAWRNLW------FHTGDRVVRDADGWFRFVDRIKDAIRRRGENISSFEVEQVLLSHPAVAAAAVFPVPSE 459
                        490       500       510       520       530       540       550
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 62955443  543 GAEGKAgMAAI-------ADPEnntDLAKFSrdlEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRDGFDPN 609
Cdd:PRK06155 460 LGEDEV-MAAVvlrdgtaLEPV---ALVRHC---EPRLAYFAVPRYVEFVAALPKTENGKVQKFVLREQGVTAD 526
AFD_class_I cd04433
Adenylate forming domain, Class I; This family includes acyl- and aryl-CoA ligases, as well as ...
239-597 1.10e-69

Adenylate forming domain, Class I; This family includes acyl- and aryl-CoA ligases, as well as the adenylation domain of nonribosomal peptide synthetases and firefly luciferases. The adenylate-forming enzymes catalyze an ATP-dependent two-step reaction to first activate a carboxylate substrate as an adenylate and then transfer the carboxylate to the pantetheine group of either coenzyme A or an acyl-carrier protein. The active site of the domain is located at the interface of a large N-terminal subdomain and a smaller C-terminal subdomain.


Pssm-ID: 213270  Cd Length: 338  Bit Score: 232.57  E-value: 1.10e-69
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 239 DRLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFS-AS 317
Cdd:cd04433   1 DPAFILYTSGTTGKPKGVVLSHRNLLANAQALAQAIGLTEGDVLLSVLPLFHVVGGGSGLLGALLAGGTVVLYEGFPfPL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 318 KFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNGLRqsIWEEFTNRFNV---PQIAEFYGATECNCSLG 394
Cdd:cd04433  81 SFLELIEQYRVTVLFGVPTLYDALAKAAEDRGYDLSSLRLLISGGEP--LSPELLERFEErpgAPILEGYGLTETSVVTS 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 395 NF----DNKTGACGfnsRILPYVYpIRLVKVDEEtmelirgpdgvciPCGPGEPGQLVGRIIQndplrRFDGYVNQTAtn 470
Cdd:cd04433 159 TNpdseLKKPGTVG---RPVPGVE-VRVVDEEGK-------------PLPPGEVGELVVRGPW-----VMKGYWNNPP-- 214
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 471 kkiAQDVFKKGDSAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAeGKAGM 550
Cdd:cd04433 215 ---ETTAAATEDGWYRTGDLGYLDEEGYLYITGRSKDLIKVGGENVYPAEVESVLLQHPAVAEAAVVGVPDEDR-GERIV 290
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|.
gi 62955443 551 AAI----ADPENNTDLAKFSRdleKALPPYARPVFLRFLPEVDKTGTFKFQ 597
Cdd:cd04433 291 AFVvlrpGADALAEELKAHLR---ERLAPYKVPRVIEFVDELPKTASGKID 338
PRK06187 PRK06187
long-chain-fatty-acid--CoA ligase; Validated
74-604 1.01e-60

long-chain-fatty-acid--CoA ligase; Validated


Pssm-ID: 235730  Cd Length: 521  Bit Score: 213.51  E-value: 1.01e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   74 NTVPKLFAKSVKKYGNKTALIFEGtdEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEA 153
Cdd:PRK06187   6 LTIGRILRHGARKHPDKEAVYFDG--RRTTYAELDERVNRLANALRALGVKKGDRVAVFDWNSHEYLEAYFAVPKIGAVL 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  154 ALINFNLRLEALVHCVNISSAKAVVFGSELTEAMCEVHSSMgKTVKLFV-SGEWDPKRVPVGTEHLDPLLETTSTIQPkQ 232
Cdd:PRK06187  84 HPINIRLKPEEIAYILNDAEDRVVLVDSEFVPLLAAILPQL-PTVRTVIvEGDGPAAPLAPEVGEYEELLAAASDTFD-F 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  233 PDRSFTDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGniVGIG-QGLIHGMTVVIR 311
Cdd:PRK06187 162 PDIDENDAAAMLYTSGTTGHPKGVVLSHRNLFLHSLAVCAWLKLSRDDVYLVIVPMFHVHA--WGLPyLALMAGAKQVIP 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  312 KKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMAL--GNGLRQSIWEEFTNRFNVpQIAEFYGATEC 389
Cdd:PRK06187 240 RRFDPENLLDLIETERVTFFFAVPTIWQMLLKAPRAYFVDFSSLRLVIygGAALPPALLREFKEKFGI-DLVQGYGMTET 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  390 nCSLGNF----DNKTGACGFNS---RILPYVYpIRLvkVDEETMELirgpdgvciPCGPGEPGQLVGR---IIQndplrr 459
Cdd:PRK06187 319 -SPVVSVlppeDQLPGQWTKRRsagRPLPGVE-ARI--VDDDGDEL---------PPDGGEVGEIIVRgpwLMQ------ 379
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  460 fdGYVNQ-TATNKKIAqdvfkkgDSAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYG 538
Cdd:PRK06187 380 --GYWNRpEATAETID-------GGWLHTGDVGYIDEDGYLYITDRIKDVIISGGENIYPRELEDALYGHPAVAEVAVIG 450
                        490       500       510       520       530       540       550
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 62955443  539 V------EVPGA--EGKAGMAAIADpenntDLAKFsrdLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRD 604
Cdd:PRK06187 451 VpdekwgERPVAvvVLKPGATLDAK-----ELRAF---LRGRLAKFKLPKRIAFVDELPRTSVGKILKRVLREQ 516
AMP-binding pfam00501
AMP-binding enzyme;
83-503 2.43e-60

AMP-binding enzyme;


Pssm-ID: 306899  Cd Length: 405  Bit Score: 209.47  E-value: 2.43e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443    83 SVKKYGNKTALIFeGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRL 162
Cdd:pfam00501   1 QAARTPDKTALGV-GEGRRLTYRELDERANRLAAGLRALGVGPGDRVAILLPNSPEWVVAFLACLKAGAVYVPLNPRLPA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   163 EALVHCVNISSAKAVVFGSELTEAMCEVHSSMGK-----TVKLFVSGEWDPKRVPVGTEHLDPLLETTSTIQPKQPDrsf 237
Cdd:pfam00501  80 EELAYILEDSGAKVLITDDDGALKLEELLEALGKlevvvLVLVLDADPVLKEEPLPEEAEPAAVPPLVPPPVPPDPD--- 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   238 tDRLFYIYTSGTTGMPKAAIVVHSRYYRMAAL--VYYGFRMKPEDVLYDCLPLYHSAGnIVGIGQGLIHGMTVVIRKKFS 315
Cdd:pfam00501 157 -DLAYIIYTSGTTGKPKGVMLTHRNLVANVLAlkVPRYFRLGPDDVYLSTLPLFHDFG-LLGLLGPLLAGATVVLPPKFP 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   316 ASK--FWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMAL--GNGLRQSIWEEFTNRFNvPQIAEFYGATECNC 391
Cdd:pfam00501 235 ARDprLLELIERYKVTVLYGVPTLLNMLLEAGEPKAKDLSSLRLVLsgGAPLPPELARRLRELFG-PPLVNGYGLTETTG 313
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   392 ------SLGNFDNKTGACGfnsRILPYVypiRLVKVDEETMElirgpdgvciPCGPGEPGQLV--GRIIqndplrrFDGY 463
Cdd:pfam00501 314 vvttplPLDDDLRSLGSVG---RPLPGT---EVKIVDDEGGE----------PVPPGEPGELCirGPGV-------MKGY 370
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|.
gi 62955443   464 VNQ-TATNKkiaqdVFKKGDsAYLSGDVLVMDDFGYMYFRD 503
Cdd:pfam00501 371 LNDpELTAE-----AFDEDG-WYRTGDLGRRDEDGYLEIVG 405
FC-FACS_FadD_like cd05936
Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD; This ...
79-595 7.56e-55

Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD; This subfamily of the AMP-forming adenylation family contains Escherichia coli FadD and similar prokaryotic fatty acid CoA synthetases. FadD was characterized as a long-chain fatty acid CoA synthetase. The gene fadD is regulated by the fatty acid regulatory protein FadR. Fatty acid CoA synthetase catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, followed by the formation of a fatty acyl-CoA. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions.


Pssm-ID: 213302  Cd Length: 468  Bit Score: 195.81  E-value: 7.56e-55
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  79 LFAKSVKKYGNKTALIFEGtdEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGveAALINF 158
Cdd:cd05936   4 LLERAARRFPDRPALTFFG--RKLTYAELDELSDRFAAYLQQLGVKKGDRVALMLPNCPQFPIAYFGILKAG--AVVVPV 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 159 N--LRLEALVHCVNISSAKAVVFGSELTEAmcevhssmgktvklfvsgewdpkrvpvgtehldplLETTSTIQPKqPDRS 236
Cdd:cd05936  80 NplYTPRELEHQLNDSGAKVLIVAISFEDA-----------------------------------LASGAPLPLP-VELS 123
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 237 FTDRLFYIYTSGTTGMPKAAIVVHSRYYR--MAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKF 314
Cdd:cd05936 124 PDDLAVLQYTGGTTGVPKGAMLTHRNLVAnvQQIAAWVKDLREGEDRFLTALPLFHIFGLTVNMLLGLRLGATNVLVPNF 203
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 315 SASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNG--LRQSIWEEFTNRFNVPqIAEFYGATECN-- 390
Cdd:cd05936 204 RPINVLKEIKRYRFTIFPGVPTLYNALLNHPEFKKYDFSSLRLCISGGapLPVEVAERFEEKTGAP-LVEGYGLTETSpv 282
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 391 --CSLGNFDNKTGACGFNsriLPYVYpIRLvkVDEETMELirgpdgvcipcGPGEPGQLVGRIIQndplrRFDGYVNQTA 468
Cdd:cd05936 283 ttVNPLDGERKPGSIGLP---LPGTE-VKI--VDDEGNEL-----------PPGEVGELVVRGPQ-----VMKGYWNRPE 340
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 469 TNKKiaqdVFKKGdsaYL-SGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVP--GAE 545
Cdd:cd05936 341 ETAE----VLTDG---WLrTGDIGYMDEDGYFYIVDRKKDMIIVGGFNVYPREIEEVLYSHPAVLEAAVVGVPDPyrGEA 413
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|..
gi 62955443 546 GKAgMAAIADPENNT--DLAKFSRdleKALPPYARPVFLRFLPEVDKTGTFK 595
Cdd:cd05936 414 VKA-FVVLKEGASLTeeELIAFCR---ERLAAYKVPRQVEFRDELPKSAVGK 461
PRK07867 PRK07867
acyl-CoA synthetase; Validated
92-607 5.93e-51

acyl-CoA synthetase; Validated


Pssm-ID: 236120  Cd Length: 529  Bit Score: 186.04  E-value: 5.93e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   92 ALIFEgtDEKWSFKELDEYSNRVANFLLQQGFREGDV-VALFMENRHQYvGLWLGMAKI-GVEAALINFNLRLEALVHCV 169
Cdd:PRK07867  21 GLYFE--DSFTSWREHIRGSAARAAALRARLDPTRPPhVGVLLDNTPEF-SLLLGAAALsGIVPVGLNPTRRGAALARDI 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  170 NISSAKAVvfgseLTE-AMCEVHSSMGKTVKLFV--SGEWdpkrvpvgTEHLDPLLETTSTIQPKQPDrsftDRLFYIYT 246
Cdd:PRK07867  98 AHADCQLV-----LTEsAHAELLDGLDPGVRVINvdSPAW--------ADELAAHRDAEPPFRVADPD----DLFMLIFT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  247 SGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKY 326
Cdd:PRK07867 161 SGTSGDPKAVRCTHRKVASAGVMLAQRFGLGPDDVCYVSMPLFHSNAVMAGWAVALAAGASIALRRKFSASGFLPDVRRY 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  327 NCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVpQIAEFYGATECNCSLGNF-DNKTGACGf 405
Cdd:PRK07867 241 GATYANYVGKPLSYVLATPERPDDADNPLRIVYGNEGAPGDIARFARRFGC-VVVDGFGSTEGGVAITRTpDTPPGALG- 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  406 nsrilpyvypirlvkvdeetmeliRGPDGVCI-------PCGPGEPG--------QLVGRIIQNDPLRRFDGYVNQT-AT 469
Cdd:PRK07867 319 ------------------------PLPPGVAIvdpdtgtECPPAEDAdgrllnadEAIGELVNTAGPGGFEGYYNDPeAD 374
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  470 NKKIAQDVFKKGDSAYlsgdvlvMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPgAEGKAG 549
Cdd:PRK07867 375 AERMRGGVYWSGDLAY-------RDADGYAYFAGRLGDWMRVDGENLGTAPIERILLRYPDATEVAVYAVPDP-VVGDQV 446
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 62955443  550 MAAIADPENNT-DLAKFSRDL--EKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRDGFD 607
Cdd:PRK07867 447 MAALVLAPGAKfDPDAFAEFLaaQPDLGPKQWPSYVRVCAELPRTATFKVLKRQLSAEGVD 507
Acs COG0365
Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase [Lipid transport and metabolism];
88-603 5.79e-49

Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase [Lipid transport and metabolism];


Pssm-ID: 223442  Cd Length: 528  Bit Score: 180.56  E-value: 5.79e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  88 GNKTALIFEGTD---EKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEA 164
Cdd:COG0365  24 PDDTAIIFDGEDglfRELTYGDLRREVARLANALKDLGGVKGDRVAIYMPNSPEAVIALLATARIGAIPAVVSPGLSAEA 103
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 165 LVHCVNISSAKAVVFGSELTEAmcevhssmGKTVKLFVSGEWDPKRVPVGTEHLDPLLETTSTIQPKQP--DRSFTDRLF 242
Cdd:COG0365 104 VADRIADLGPKVLIADDGTFRN--------GKEIALLEDADAVLSSVVVVPRLGLWYDEAVEKASEKFEfePLPADDPLF 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 243 YIYTSGTTGMPKAAIVVHSRY-YRMAALVYYGFRMKPEDVLY---DClplyhsaGNIVGIGQG----LIHGMTVVI---R 311
Cdd:COG0365 176 LLYTSGTTGKPKGIVHSHGGYlVEHRLTAKFHGDLLPGDRFWnssDP-------GWIYGLWYSvfspLASGATTVLydgR 248
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 312 KKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNG--LRQSIWEEFTNRFNVPqIAEFYGATEC 389
Cdd:COG0365 249 PFYSPERLWEALEKYKVTIFGTSPTFLRRLMKLGLGEPYDLSSLRVLGSAGepLNPEAFEWFYSALGVW-ILDIYGQTET 327
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 390 N--CSLGNFDNKTGACGFnsrilPyVYPIRLVKVDEETMELIRGPDGVCIPcgPGEPGQLVGriIQNDPLRRFDGYVNQT 467
Cdd:COG0365 328 GmgFIAGRPPVKNGSSGL-----P-LPGYAVRRVDDEGNPVPPGVGELVVR--LPWPGMALT--YWNDPERYKEAYFGRW 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 468 atnkkiaqdvfkkgdsaYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPG-AEG 546
Cdd:COG0365 398 -----------------YRTGDWAERDEDGYFWLHGRSDDVIKVSGKRIGPLEIESVLLAHPAVAEAAVVGVPDPGkGQI 460
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 62955443 547 KAGMAAIADPENNTDLAKFSRD-LEKALPPYARPVFLRFLPEVDKTGTFKFqktdMRR 603
Cdd:COG0365 461 VLAFVVLAAGVEPNELAEEIRRhVARNIGPHAIPRKIRFVDELPKTASGKI----QRR 514
PRK08316 PRK08316
acyl-CoA synthetase; Validated
73-604 3.44e-47

acyl-CoA synthetase; Validated


Pssm-ID: 181381  Cd Length: 523  Bit Score: 175.12  E-value: 3.44e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   73 RNTVPKLFAKSVKKYGNKTALIFEgtDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVE 152
Cdd:PRK08316  10 RQTIGDILRRSARRYPDKTALVFG--DRSWTYAELDAAVNRVAAALLDLGLKKGDRVAALGHNSDAYALLWLACARAGAV 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  153 AALINFNLRLEALVHCVNISSAKAVVFGSELTEAMCEVHSSMGkTVKLFVSGEWDPKRVPVGTEHLDPLLETTSTIQPkQ 232
Cdd:PRK08316  88 HVPVNFMLTGEELAYILDHSGARAFLVDPALAPTAEAALALLP-VDTLILSLVLGGREAPGGWLDFADWAEAGSVAEP-D 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  233 PDRSFTDRLFYIYTSGTTGMPKAAIVVHSryyrmaALV--YYG----FRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGM 306
Cdd:PRK08316 166 VELADDDLAQILYTSGTESLPKGAMLTHR------ALIaeYVScivaGDMSADDIPLHALPLYHCAQLDVFLGPYLYVGA 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  307 TVVIRKKFSASKFWDDCIKYNCTI------VqYIGeicryLLNQPRKDTERkhkvrmaLGnGLRQ-----SIW-----EE 370
Cdd:PRK08316 240 TNVILDAPDPELILRTIEAERITSffapptV-WIS-----LLRHPDFDTRD-------LS-SLRKgyygaSIMpvevlKE 305
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  371 FTNRFnvPQIA--EFYGATEC---NCSLG--NFDNKTGACG---FN--SRIlpyvypirlvkVDEetmelirgpDGVCIP 438
Cdd:PRK08316 306 LRERL--PGLRfyNCYGQTEIaplATVLGpeEHLRRPGSAGrpvLNveTRV-----------VDD---------DGNDVA 363
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  439 cgPGEPGQLVGRIIQndplrRFDGYVNQTAtnkKIAQdVFKKGdsAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVST 518
Cdd:PRK08316 364 --PGEVGEIVHRSPQ-----LMLGYWDDPE---KTAE-AFRGG--WFHSGDLGVMDEEGYITVVDRKKDMIKTGGENVAS 430
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  519 TEVEGTLSRLLDMKDVVVYGVE------------VPgaegKAGMAAIADpenntDLAKFSRdleKALPPYARPVFLRFLP 586
Cdd:PRK08316 431 REVEEALYTHPAVAEVAVIGLPdpkwieavtavvVP----KAGATVTED-----ELIAHCR---ARLAGFKVPKRVIFVD 498
                        570
                 ....*....|....*...
gi 62955443  587 EVDKTGTFKFQKTDMRRD 604
Cdd:PRK08316 499 ELPRNPSGKILKRELRER 516
PRK13388 PRK13388
acyl-CoA synthetase; Provisional
238-607 1.12e-45

acyl-CoA synthetase; Provisional


Pssm-ID: 237374  Cd Length: 540  Bit Score: 170.98  E-value: 1.12e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  238 TDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSAS 317
Cdd:PRK13388 150 MDPFMLIFTSGTTGAPKAVRCSHGRLAFAGRALTERFGLTRDDVCYVSMPLFHSNAVMAGWAPAVASGAAVALPAKFSAS 229
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  318 KFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVpQIAEFYGATECNCSLGNFD 397
Cdd:PRK13388 230 GFLDDVRRYGATYFNYVGKPLAYILATPERPDDADNPLRVAFGNEASPRDIAEFSRRFGC-QVEDGYGSSEGAVIVVREP 308
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  398 NK-TGACGfnsRILPYVypirlVKVDEETMElirgpdgVCIPCGPGEPGQL------VGRIIQNDPLRRFDGYVN-QTAT 469
Cdd:PRK13388 309 GTpPGSIG---RGAPGV-----AIYNPETLT-------ECAVARFDAHGALlnadeaIGELVNTAGAGFFEGYYNnPEAT 373
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  470 NKKIAQDVFKKGDSAYLSGDvlvmddfGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAeGKAG 549
Cdd:PRK13388 374 AERMRHGMYWSGDLAYRDAD-------GWIYFAGRTADWMRVDGENLSAAPIERILLRHPAINRVAVYAVPDERV-GDQV 445
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 62955443  550 MAAIADPENNT-DLAKFSRDL--EKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRDGFD 607
Cdd:PRK13388 446 MAALVLRDGATfDPDAFAAFLaaQPDLGTKAWPRYVRIAADLPSTATNKVLKRELIAQGWA 506
caiC PRK08008
putative crotonobetaine/carnitine-CoA ligase; Validated
68-539 1.92e-44

putative crotonobetaine/carnitine-CoA ligase; Validated


Pssm-ID: 181195  Cd Length: 517  Bit Score: 166.78  E-value: 1.92e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   68 KHLRErntvpkLFAKSVKKYGNKTALIFE---GTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWL 144
Cdd:PRK08008   7 QHLRQ------MWDDLADVYGHKTALIFEssgGVVRRYSYLELNEEINRTANLFYSLGIRKGDKVALHLDNCPEFIFCWF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  145 GMAKIGVEAALINFNLRLEALVHCVNISSAKAVVFGSELTEAMCEVHSSMGKTVK-LFVSGEWDPKRvpVGTEHLDPLLE 223
Cdd:PRK08008  81 GLAKIGAIMVPINARLLREESAWILQNSQASLLVTSAQFYPMYRQIQQEDATPLRhICLTRVALPAD--DGVSSFTQLKA 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  224 TTSTIQPKQPDRSFTDRLFYIYTSGTTGMPKAAIVVHsryYRMAALVYYG---FRMKPEDVLYDCLPLYHSAGNIVGIGQ 300
Cdd:PRK08008 159 QQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITH---YNLRFAGYYSawqCALRDDDVYLTVMPAFHIDCQCTAAMA 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  301 GLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVR-----MALGNGLRqsiwEEFTNRF 375
Cdd:PRK08008 236 AFSAGATFVLLEKYSARAFWGQVCKYRATITECIPMMIRTLMVQPPSANDRQHCLRevmfyLNLSDQEK----DAFEERF 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  376 NVpQIAEFYGATEcncSLGnfdnktGACG---FNSRILPYV------YPIRLvkVDEETMELIRGPDG-VCIpcgPGEPG 445
Cdd:PRK08008 312 GV-RLLTSYGMTE---TIV------GIIGdrpGDKRRWPSIgrpgfcYEAEI--RDDHNRPLPAGEIGeICI---KGVPG 376
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  446 QLVgriiqndplrrFDGYVNQT-ATNKKIAQDVF-KKGDSAYlsgdvlvMDDFGYMYFRDRTGDTFRWKGENVSTTEVEG 523
Cdd:PRK08008 377 KTI-----------FKEYYLDPkATAKVLEADGWlHTGDTGY-------VDEEGFFYFVDRRCNMIKRGGENVSCVELEN 438
                        490
                 ....*....|....*.
gi 62955443  524 TLSRLLDMKDVVVYGV 539
Cdd:PRK08008 439 IIATHPKIQDIVVVGI 454
Firefly_Luc_like cd05911
Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL); This family ...
98-595 3.83e-44

Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL); This family contains two functionally unique groups of proteins; one group is insect firefly luciferases and the other is plant 4-coumarate:coenzyme A ligases. However, they share significant sequence similarity in spite of their functional diversity. Luciferase catalyzes the production of light in the presence of MgATP, molecular oxygen, and luciferin. In the first step, luciferin is activated by acylation of its carboxylate group with ATP, resulting in an enzyme-bound luciferyl adenylate. In the second step, luciferyl adenylate reacts with molecular oxygen, producing an enzyme-bound excited state product (Luc=O*) and releasing AMP. This excited-state product then decays to the ground state (Luc=O), emitting a quantum of visible light. 4-coumarate:coenzyme A ligase is a key enzyme in the phenylpropanoid metabolic pathway for monolignol and flavonoid biosynthesis. It catalyzes the synthesis of hydroxycinnamate-CoA thioesters in a two-step reaction, involving the formation of hydroxycinnamate-AMP anhydride and then the nucleophilic substitution of AMP by CoA. The phenylpropanoid pathway is one of the most important secondary metabolism pathways in plants and hydroxycinnamate-CoA thioesters are the precursors of lignin and other important phenylpropanoids.


Pssm-ID: 213279  Cd Length: 487  Bit Score: 165.49  E-value: 3.83e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  98 TDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAV 177
Cdd:cd05911   7 TGTELTFADLLKKALRLAKGLRKLGLKQGDVVALISPNSIEFPPVFLGCLAAGGIVSAANPSYTPDELAHQLKISKPKLI 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 178 VFGSELTEAMCEVHSSMGKTVKLFVSGEWDPKRVPVGTEhLDPLLETTSTIQPKQPDRSFTDRLFYIYTSGTTGMPKAAI 257
Cdd:cd05911  87 FCDPDELDKVKEAAKELGPVVRIIVLDSAPDGVLRIEDL-LEPRLGAEDEFRPTPLIDGKDDTAALLYSSGTTGLPKGVM 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 258 VVHSRY---YRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLiHGMTVVIRKKFSASKFWDDCIKYNCTIVQYI 334
Cdd:cd05911 166 LSHKNIianLSQVQDTLKGNPDSSNDVVLTFLPFYHAYGLTTTLASLL-CGATVIIMPKFDSETFLKLIEKYKVTSLFLV 244
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 335 GEICRYLLNQPRKDTERKHKVRMAL--GNGLRQSIWEEFTNRFNVPQIAEFYGATECNCSL---GNFDNKTGACGfnsRI 409
Cdd:cd05911 245 PPIAVALAKSPLVDKYDLSSLRVIFsgAAPLSKELQEELRKRFPNTTIKQGYGMTETGPATtltPPGDEKPGSVG---RL 321
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 410 LPYVYpirlVK-VDEETMELIrgpdgvcipcGPGEPGQLVGRIIQndplrRFDGYV-NQTATNKKIAQDVFKKgdsaylS 487
Cdd:cd05911 322 VPNVE----AKiVDEDGGKSL----------GPNERGELCVKGPQ-----IMKGYLnNPEATKETIDEDGWLH------T 376
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 488 GDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVP-GAEGKAGMAAIADPENNT--DLAK 564
Cdd:cd05911 377 GDIGYFDEDGNFYIVDRKKELIKYKGYQVPPAELEAVLLEHPKVADAAVIGIPDEvAGELPRAYVVLKPGSKLTeqEVKD 456
                       490       500       510
                ....*....|....*....|....*....|....*
gi 62955443 565 FsrdLEKALPPYARpvfLR----FLPEVDKTGTFK 595
Cdd:cd05911 457 Y---VAKKVAKYKQ---LRggvvFVDEIPKSPSGK 485
FACL_like_2 cd05917
Uncharacterized subfamily of fatty acid CoA ligase (FACL); Fatty acyl-CoA ligases catalyze the ...
245-602 8.65e-39

Uncharacterized subfamily of fatty acid CoA ligase (FACL); Fatty acyl-CoA ligases catalyze the ATP-dependent activation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions.


Pssm-ID: 213284  Cd Length: 347  Bit Score: 146.90  E-value: 8.65e-39
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 245 YTSGTTGMPKAaiVVHSRYYRMAALVYYGFRMK--PEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDD 322
Cdd:cd05917   9 YTSGTTGRPKG--AMLTHRNVLNNGYSIARRLGltEGDRTLVPVPLFHVFGLVLGVLASLTAGATLVLMEKFDPGAALRL 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 323 CIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVR-MALGNGLRQSIW-EEFTNRFNVPQIAEFYGATECN----CSLGN- 395
Cdd:cd05917  87 IERERITALHGVPTMFIALLEHPDFDKFDLSSLRtGISGGAPVPPELvRRIREEFPMAEITTGYGMTETSgvgtQTSGDd 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 396 -FDNKTGACGfnsRILPyvypirlvkvdeeTMEL-IRGPDGVciPCGPGEPGQLVGRIIQNdplrrFDGYVNQ-TATNKK 472
Cdd:cd05917 167 pYEDRPGTVG---RPLP-------------GVEVkIVDPDGG--EVPPGEVGEICVRGYSV-----MKGYYNDpEATAEA 223
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 473 IAQDVFkkgdsaYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV------EVPGA-- 544
Cdd:cd05917 224 IDADGW------LHTGDLGYMDEDGYLRIVGRIKDMIIRGGENIYPAEIEEALLTHPAVAEAAVVGVpderlgEVVAAfv 297
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 62955443 545 EGKAGMAAIADpenntDLAKFSRDLekaLPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:cd05917 298 VLKPGATLTEE-----ELIAFCRGR---LARFKVPRYVRFVDELPRTASGKIQKFKLR 347
BACL_like cd05929
Bacterial Bile acid CoA ligases and similar proteins; Bile acid-Coenzyme A ligase catalyzes ...
244-602 1.67e-38

Bacterial Bile acid CoA ligases and similar proteins; Bile acid-Coenzyme A ligase catalyzes the formation of bile acid-CoA conjugates in a two-step reaction: the formation of a bile acid-AMP molecule as an intermediate, followed by the formation of a bile acid-CoA. This ligase requires a bile acid with a free carboxyl group, ATP, Mg2+, and CoA for synthesis of the final bile acid-CoA conjugate. The bile acid-CoA ligation is believed to be the initial step in the bile acid 7alpha-dehydroxylation pathway in the intestinal bacterium Eubacterium sp.


Pssm-ID: 213295  Cd Length: 342  Bit Score: 146.08  E-value: 1.67e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 244 IYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNiVGIGQGLIHGMTVVIRKKFSASKFWDDC 323
Cdd:cd05929   7 LYTSGTTGRPKGVMLTHRNLLANAVNALAGVDLSPGDVYLLAAPLYHAAGG-LFLLPALAAGGTVVLMPKFDPEAVLDLI 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 324 IKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNG------LRQSIWEEFTnrfnvPQIAEFYGATEC--NCSLG- 394
Cdd:cd05929  86 ERHRVTHTFLVPTMFQRLLRLPDFARYDLSSLRLIIYGAapmpaeLKRAMIEWFG-----PVFVQGYGMTETgpTTTLLs 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 395 --NFDNKTGACGFnsrilpyvyPIRLVKVdeetmeLIRGPDGVciPCGPGEPGQLVGRIIQNdplrrFDGYVNQTATNKK 472
Cdd:cd05929 161 peDWLRKLGSVGR---------PVPGVEV------RIVDEDGR--ELPPGEVGEIVVRGPAV-----MAGYWNRPEATAE 218
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 473 IAQDVFkkgdsaYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV------EVPGA-- 544
Cdd:cd05929 219 ALRDGW------LHTGDLGYLDEDGYLYIVDRKKDMIISGGENIYPAEVENVLLAHPAVADVAVIGVpdeewgEAVVAvv 292
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 62955443 545 EGKAGMAAIADpenntDLAKFSRDlekALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:cd05929 293 VLRPGATLDAE-----ELIAFCRE---RLAGYKVPKSVEFVDELPRNASGKILKRELR 342
BCL_like cd05919
Benzoate CoA ligase (BCL) and similar adenylate forming enzymes; This family contains benzoate ...
90-602 3.57e-38

Benzoate CoA ligase (BCL) and similar adenylate forming enzymes; This family contains benzoate CoA ligase (BCL) and related ligases that catalyze the acylation of benzoate derivatives, 2-aminobenzoate and 4-hydroxybenzoate. Aromatic compounds represent the second most abundant class of organic carbon compounds after carbohydrates. Xenobiotic aromatic compounds are also a major class of man-made pollutants. Some bacteria use benzoate as the sole source of carbon and energy through benzoate degradation. Benzoate degradation starts with its activation to benzoyl-CoA by benzoate CoA ligase. The reaction catalyzed by benzoate CoA ligase proceeds via a two-step process; the first ATP-dependent step forms an acyl-AMP intermediate, and the second step forms the acyl-CoA ester with release of the AMP.


Pssm-ID: 213286  Cd Length: 436  Bit Score: 147.10  E-value: 3.57e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  90 KTAliFEGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCV 169
Cdd:cd05919   1 KTA--FYCGEQSLTYRELHDLANRFANVLRALGVSPGDRVLLLLPDSPELVAAFLACLKAGAVAVALNPLLTPQDLEHIL 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 170 NISSAKAVVFGselTEAMCevhssmgktvklfvsgewdpkrvpvgtehldpllettstiqpkqpdrsftdrlFYIYTSGT 249
Cdd:cd05919  79 DDSGAALLVTE---ADDIA-----------------------------------------------------YWLYTSGT 102
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 250 TGMPKAAIVVH-SRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVI-RKKFSASKFWDDCIKYN 327
Cdd:cd05919 103 TGKPKGVMHRHrDPLTFAEAFARELLGLQPGDRIFSSSKLFFAYGLGNSLLFPLFSGASAVLlPGWPTPEAVLDLLARHR 182
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 328 CTIVQYIGEICRYLLNQPRKDTERKHKVRMAL--GNGLRQSIWEEFTNRFNVPqIAEFYGATE------CNcslgNFDN- 398
Cdd:cd05919 183 PTVLFGVPALYRALLESGAGSAPLFRSVRLCVsaGEALPAGLAERWAEATGIE-ILDGIGSTEvlhifiSN----RPGAa 257
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 399 KTGACGfnsRILPYvYPIRLVkvDEETMELirgpdgvcipcGPGEPGQLvgrIIQNDPLrrFDGYVNQTATnkkiAQDVF 478
Cdd:cd05919 258 RPGTTG---RPVPG-YEARLV--DESGREV-----------PAGTVGDL---WVRGPSL--APGYWNLPEK----TQRTL 311
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 479 KKGdsAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVygVEVPGAEGKAGMAAI---AD 555
Cdd:cd05919 312 RDG--WLRTGDRFSRDADGWYRYQGRADDMIKVSGQWVSPLEVEAALGEHPAVAEAAV--VAVPDEDGLVRLKAFvvpRP 387
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|..
gi 62955443 556 PENN-----TDLAKFSRDlekALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:cd05919 388 GEAIqqlleRDLHRFLRE---RLAPYKCPRQIEFLDTLPRTATGKLQRFRLR 436
MACS_AAE_MA_like cd05970
Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like; MACS catalyzes the two-step activation ...
85-602 2.24e-37

Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like; MACS catalyzes the two-step activation of medium chain fatty acids (containing 4-12 carbons). The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. This family of MACS enzymes is found in archaea and bacteria. It is represented by the acyl-adenylating enzyme from Methanosarcina acetivorans (AAE_MA). AAE_MA is most active with propionate, butyrate, and the branched analogs: 2-methyl-propionate, butyrate, and pentanoate. The specific activity is weaker for smaller or larger acids.


Pssm-ID: 213317  Cd Length: 537  Bit Score: 146.03  E-value: 2.24e-37
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  85 KKYGNKTALIF--EGTDEK-WSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLR 161
Cdd:cd05970  28 DEEPDKLALIWcdDDGEEKiFTFGDLKDYSNKAANFFKALGIGKGDTVMLTLKRRYEFWFSMLALHKIGAIAIPATHMLT 107
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 162 LEALVHCVNISSAKAVVFGSE--LTEAMCEVHSSMGKTVKLFVSGEWDPKrvpvGTEHLDPLLETTSTIQPKQPDRSFT- 238
Cdd:cd05970 108 AKDIVYRIEAAGIKMIVCIGEdgVPEHIDEAAPECGSPTLLVLVGDPVPE----GWIDFDKEIENASPDFERPTGNDATc 183
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 239 --DRLFYIYTSGTTGMPKaaIVVHSRYYRMAALVY--YGFRMKPEDVLY--------DCL--PLYhsagnivgiGQgLIH 304
Cdd:cd05970 184 ndDILLVYFTSGTTGMPK--MVEHDHTYPLGHIVTakYWQNVKEGGLHLtvadtgwgKAVwgKLY---------GQ-WIA 251
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 305 GMTVVI--RKKFSASKFWDDCIKYNCTIVQYIGEICRYLLnqpRKDTERKH--KVRMAL--GNGLRQSIWEEFTNRFNVp 378
Cdd:cd05970 252 GAAVFVydYDKFDPKNLLEKIEKYGVTTFCAPPTIYRFLI---KEDLSKYDlsSLRYCTtaGEPLNPEVFNTFKEKTGI- 327
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 379 QIAEFYGATECNCSLGNFDN---KTGACGFNSRIlpyvYPIRLVKvdeetmelirgPDGVciPCGPGEPGQLVGRIIQND 455
Cdd:cd05970 328 KLMEGFGQTETTLTIATFPWmepKPGSMGKPSPG----YDIDIID-----------PDGK--SCEVGEEGEIVIRTSDGK 390
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 456 PLRRFDGYVNQTATNKKIAQDVFkkgdsaYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVV 535
Cdd:cd05970 391 PLGLFMGYYRDPERTAEVWHDGY------YHTGDTAWMDEDGYLWFVGRADDLIKSSGYRIGPFEVESALIQHPAVLECA 464
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 536 VYGVEVP--GAEGKAGMAAIADPENNTDLAK-FSRDLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:cd05970 465 VTGVPDPirGQVVKATIVLTKGYEPSEELKKeLQDHVKKVTAPYKYPRIIEFVDELPKTISGKIRRVEIR 534
FACL_fum10p_like cd05926
Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis; FACL ...
242-599 3.79e-34

Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis; FACL catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, followed by the formation of a fatty acyl-CoA. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions. Fum10p is a fatty acid CoA ligase involved in the synthesis of fumonisin, a polyketide mycotoxin, in Gibberella moniliformis.


Pssm-ID: 213292  Cd Length: 345  Bit Score: 133.52  E-value: 3.79e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 242 FYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWD 321
Cdd:cd05926   6 LILHTSGTTGRPKGVPLTHKNLLASARNIAKSHKLTPSDRCLNVMPLFHIHGLIVSLLATLLAGGSVVCPPKFSASKFWD 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 322 DCIKYNCTIVQYIGEICRYLLNQPRKDTERK-HKVRMA--LGNGLRQSIWEEFTNRFNVPqIAEFYGATEC--NCSLGNF 396
Cdd:cd05926  86 DIAKYRVTWYSAVPTIHQILLKTAKPNPGKPpPRLRFIrsASAPLPPAVLDRLEKRFGVP-VLEAYGMTEAahQIASNPL 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 397 D---NKTGACGfnsriLPYVYPIRlvkvdeetmelIRGPDGVCIPcgPGEPGQLVGR---IIQndplrrfdGYV-NQTAT 469
Cdd:cd05926 165 PplvRKPGSVG-----RPAGVEVA-----------ILDDDGRPLP--PGQEGEIVIRgpnVTA--------GYLnNPEAN 218
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 470 NKKIAQDVFKKGDSAYLSGDvlvmddfGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV------EVPG 543
Cdd:cd05926 219 REAFRDGWFRTGDLGYLDED-------GYLFLTGRIKELINRGGEKISPREVEEVLLRHPAVAEAVVFGVpdelygEEVA 291
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 62955443 544 AegkagmAAIADPENNTDLAKFSRDLEKALPPYARPVFLRFLPEVDKTGTFKFQKT 599
Cdd:cd05926 292 A------AVVLRADSKVTIEELRDFARKRLAAFKVPKKILFVDALPKGATGKIQRR 341
MCS cd05941
Malonyl-CoA synthetase (MCS); MCS catalyzes the formation of malonyl-CoA in a two-step ...
89-598 4.84e-34

Malonyl-CoA synthetase (MCS); MCS catalyzes the formation of malonyl-CoA in a two-step reaction consisting of the adenylation of malonate with ATP, followed by malonyl transfer from malonyl-AMP to CoA. Malonic acid and its derivatives are the building blocks of polyketides and malonyl-CoA serves as the substrate of polyketide synthases. Malonyl-CoA synthetase has broad substrate tolerance and can activate a variety of malonyl acid derivatives. MCS may play an important role in biosynthesis of polyketides, the important secondary metabolites with therapeutic and agrochemical utility.


Pssm-ID: 213307  Cd Length: 430  Bit Score: 135.06  E-value: 4.84e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  89 NKTALIFEgtDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHC 168
Cdd:cd05941   1 DRIALVDG--GRSLTYGELDARSGRLAKALLALGLLPGDRVAVLAPKSAEYVVLYLAIWRAGGVAVPLNPSYPAAELAYI 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 169 VNISSAKAVVfgselteamcevhssmgktvklfvsgewdpkrvpvgtehldpllettstiqpkqpdrsftDRLFYIYTSG 248
Cdd:cd05941  79 LSDSQPSLLV------------------------------------------------------------DPALIIYTSG 98
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 249 TTGMPKAAIVVHSRYYRMA-ALVYYgFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYN 327
Cdd:cd05941  99 TTGRPKGVVLTHGNLAANArALVEA-WRWTASDVLLHALPLHHVHGLFNALHCPLWAGASVEFLPRFDPQERDALRLLPR 177
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 328 CTIVQYIGEICRYLLNQPRKDTERK-HKVRMAL---GNG-LRQSIWEEFTNRFNVPqIAEFYGATECNCSLGN---FDNK 399
Cdd:cd05941 178 ITVFMGVPTIYTRLLEHYEFDDAAAaAARNLRLfvsGSAaLPVPVLERWEERTGHT-LLERYGMTETGMALSNpldGERR 256
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 400 TGACGFnsrILPYVyPIRLvkVDEETMElirgpdgvciPCGPGEPGQLvgrIIQNDPLrrFDGYVN-QTATNKKIAQDVF 478
Cdd:cd05941 257 PGTVGL---PLPGV-EVRI--VDEDGGE----------PLAAGEVGEI---QVRGPNV--FSEYWNkPEATAEAFTEDGW 315
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 479 KKgdsaylSGDVLVMDDFGYMYFRDRTG-DTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGveVPGAEGKAGMAAIADPE 557
Cdd:cd05941 316 FK------TGDVGVVDEDGYYRILGRKSdDIIKSGGYKVSALEIEEALLEHPGVAEVAVIG--VPDPDWGEAVVAVVVPE 387
                       490       500       510       520
                ....*....|....*....|....*....|....*....|...
gi 62955443 558 NNT--DLAKFSRDLEKALPPYARPVFLRFLPEVDKTGTFKFQK 598
Cdd:cd05941 388 AGAalTLAELRAWAREKLAPYKIPKRVIVVDELPRNAMGKVQK 430
BCL_4HBCL cd05959
Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase); Benzoate ...
87-602 2.86e-33

Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase); Benzoate CoA ligase and 4-hydroxybenzoate-coenzyme A ligase catalyze the first activating step for benzoate and 4-hydroxybenzoate catabolic pathways, respectively. Although these two enzymes share very high sequence homology, they have their own substrate preference. The reaction proceeds via a two-step process; the first ATP-dependent step forms the substrate-AMP intermediate, while the second step forms the acyl-CoA ester, releasing the AMP. Aromatic compounds represent the second most abundant class of organic carbon compounds after carbohydrates. Some bacteria can use benzoic acid or benzenoid compounds as the sole source of carbon and energy through degradation. Benzoate CoA ligase and 4-hydroxybenzoate-Coenzyme A ligase are key enzymes of this process.


Pssm-ID: 213312  Cd Length: 506  Bit Score: 133.60  E-value: 2.86e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  87 YGNKTALIFEgtDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALV 166
Cdd:cd05959  18 RGDKIALYYD--DGSLTYGELQEEVNRWGNALRELGIERENRVLLILLDTPEFPTAFWGAIKIGAVPVPINTLLTPDDYR 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 167 HCVNISSAKAVVFGSELTEAMCEVHSSMGKTVKLFVSGEWDPkrvpvGTEHLDPLLETTS---TIQPKQPDrsftDRLFY 243
Cdd:cd05959  96 YYLNDSRARVLVISEELWEVLKPALQKDPHLRHVIVVGGAGP-----GALSYAQLIATAAeelEAAATSAD----DMAFW 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 244 IYTSGTTGMPKAAIVVHSRYYrmAALVYYG---FRMKPEDVLYDCLPLYHSagniVGIGQGLIHGM-----TVVIRKKFS 315
Cdd:cd05959 167 LYSSGSTGRPKGVVHLHHDML--VTAEAYAknvLGITEDDVVFSAAKLFFA----YGLGNGLYFPLsvgatTVLMPERPT 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 316 ASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMAL--GNGLRQSIWEEFTNRFNVpQIAEFYGATEcncSL 393
Cdd:cd05959 241 PDAVFATIERYKPTVFFGVPTLYAAMLAAPEKPERDLSSLRLCVsaGEALPAEIGYRWKELFGL-EILDGIGSTE---ML 316
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 394 GNF-DNKTGAC--GFNSRILPYvYPIRLVkvdeetmelirGPDGVciPCGPGEPGQLvgrIIQNDPLRRfdGYVNQTATN 470
Cdd:cd05959 317 HIFlSNRPGAVkyGTSGKPVPG-YEVKLV-----------DEDGE--EVADGEIGEL---WVRGDSSAA--GYWNRREKT 377
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 471 KkiaqDVFKKGdsAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPgaEG---- 546
Cdd:cd05959 378 R----ETFVGE--WTRTGDKYYRDEDGYYWYCGRSDDMLKVSGIWVSPFEVEDALLQHPAVLEAAVVGAEDE--DGltkp 449
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 62955443 547 ------KAGMAaiADPENNTDLAKFSRDlekALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:cd05959 450 kafvvlKDGYQ--PSPELETELKDFVKD---KLAPYKYPRWIEFVDELPKTATGKIQRFKLR 506
PRK07656 PRK07656
long-chain-fatty-acid--CoA ligase; Validated
75-602 3.88e-31

long-chain-fatty-acid--CoA ligase; Validated


Pssm-ID: 236072  Cd Length: 513  Bit Score: 127.33  E-value: 3.88e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   75 TVPKLFAKSVKKYGNKTALIFEgtDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGveAA 154
Cdd:PRK07656   6 TLPELLARAARRFGDKEAYVFG--DQRLTYAELNARVRRAAAALAALGIGKGDRVAIWAPNSPHWVIAALGALKAG--AV 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  155 LINFNLRLEA--LVHCVNISSAKAVVFGSELTEAMCEVHSSMGKTVKLFVSGEWDPKRVPVGTEHLDPLLETTSTIQPkQ 232
Cdd:PRK07656  82 VVPLNTRYTAdeAAYILARGDAKALFVLGLFLGVDYSATTRLPALEHVVICETEEDDPHTEKMKTFTDFLAAGDPAER-A 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  233 PDRSFTDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALV--YYGFRmkpEDVLYDC-LPLYHSAGNIVGIGQGLIHGMTVV 309
Cdd:PRK07656 161 PEVDPDDVADILFTSGTTGRPKGAMLTHRQLLSNAADWaeYLGLT---EGDRYLAaNPFFHVFGYKAGVNAPLMRGATIL 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  310 IRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNG--LRQSIWEEFTNRFNVPQIAEFYGAT 387
Cdd:PRK07656 238 PLPVFDPDEVFRLIETERITVLPGPPTMYNSLLQHPDRSAEDLSSLRLAVTGAasMPVALLERFESELGVDIVLTGYGLS 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  388 ECN-----CSLGN-FDNKTGACGfnsrilpyvYPIRLVK---VDEETMELirgpdgvcipcGPGEPGQLVGR---IIQnd 455
Cdd:PRK07656 318 EASgvttfNRLDDdRKTVAGTIG---------TAIAGVEnkiVNELGEEV-----------PVGEVGELLVRgpnVMK-- 375
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  456 plrrfdGYVNQ-TATNKKIaqdvfkKGDSAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDV 534
Cdd:PRK07656 376 ------GYYDDpEATAAAI------DADGWLHTGDLGRLDEEGYLYIVDRKKDMFIVGGFNVYPAEVEEVLYEHPAVAEA 443
                        490       500       510       520       530       540       550
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 62955443  535 VVYGV--EVPGAEGKA----GMAAIADPEnntDLAKFSRDlekALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:PRK07656 444 AVIGVpdERLGEVGKAyvvlKPGAELTEE---ELIAYCRE---HLAKYKVPRSIEFLDELPKNATGKVLKRALR 511
MACS_like cd05972
Medium-chain acyl-CoA synthetase (MACS or ACSM); MACS catalyzes the two-step activation of ...
102-602 4.96e-31

Medium-chain acyl-CoA synthetase (MACS or ACSM); MACS catalyzes the two-step activation of medium chain fatty acids (containing 4-12 carbons). The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. The acyl-CoA is a key intermediate in many important biosynthetic and catabolic processes.


Pssm-ID: 213319  Cd Length: 430  Bit Score: 126.31  E-value: 4.96e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 102 WSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVVFGS 181
Cdd:cd05972   1 WTFAELKEESDRAANFLKDLGVGRGDRVAVLLPRVPELWAVILGCIKLGAVFIPGTTQLGPKDIRYRLERAGARAIVTSA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 182 ElteamcevhssmgktvklfvsgewdpkrvpvgtehldpllettstiqpkqpdrsftDRLFYIYTSGTTGMPKAAIVVHS 261
Cdd:cd05972  81 D--------------------------------------------------------DPALLYFTSGTTGLPKMVLHTHS 104
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 262 RYYRMAALVYYGFRMKPEDVLY---DCLPLYHSAGNIVGIgqgLIHGMTVVIR--KKFSASKFWDDCIKYNCTIVQYIGE 336
Cdd:cd05972 105 YPLGHLVTGAYWLDLRPDDLHWtiaDPGWAKGAWSSLFAP---WLLGAAVFVYhgRRFDAERTLELLERYGVTTFCAPPT 181
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 337 ICRYLLNQPRKDTERKHkVRMALGNG---LRQSI--WEEFTNRfnvpQIAEFYGATECNCSLGNF---DNKTGACGfnsR 408
Cdd:cd05972 182 AYRMLLQQDLSSYDFSH-LRHVVSAGeplNPEVIdwWRAATGL----PIRDGYGQTETGLLVANFpgmEVKPGSMG---R 253
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 409 ILPyvyPIRLVKVDEETMElirgpdgvcipCGPGEPGQLVGRIIQNDP--LRRFDGYVNQTATNkkiaqdvfkKGDSAYL 486
Cdd:cd05972 254 PAP---GYRVAIIDDEGNE-----------LPPGEEGDIAVRVKPRPPglFRGYLKDPEKTEAT---------IRGDWYL 310
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 487 SGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV--EVPGAEGKAGMAAIADPENNTDLAK 564
Cdd:cd05972 311 TGDRAIKDEDGYFWFVGRADDVIKSSGYRIGPFEVESALIEHPAVAEAAVVGSpdPVRGEVVKAFVVLAPGYQPSEELAK 390
                       490       500       510
                ....*....|....*....|....*....|....*....
gi 62955443 565 -FSRDLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:cd05972 391 eLQEHVKKRTAPYKYPREIEFVEELPKTVSGKIRRVELR 429
LC_FACS_like cd05935
Putative long-chain fatty acid CoA ligase; The members of this family are putative long-chain ...
103-601 4.47e-30

Putative long-chain fatty acid CoA ligase; The members of this family are putative long-chain fatty acyl-CoA synthetases, which catalyze the ATP-dependent activation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. Fatty acyl-CoA synthetases are responsible for fatty acid degradation as well as physiological regulation of cellular functions via the production of fatty acyl-CoA esters.


Pssm-ID: 213301  Cd Length: 430  Bit Score: 123.20  E-value: 4.47e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 103 SFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVVFGSE 182
Cdd:cd05935   3 TYAELLELVDRLAGLLQEKGVRKGDRVALYMQNSPQFVIAYYAILRAGAVVVPVNPMNREAELEHILNDSGARVLIVGSE 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 183 LTeamcevhssmgktvklfvsgewDPKRVPvgtehldpllettstiqpkqpdrsftdrlfyiYTSGTTGMPKAAIVVHSR 262
Cdd:cd05935  83 LD----------------------DVAVIP--------------------------------YTSGTTGLPKGCMHTHRT 108
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 263 YYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLL 342
Cdd:cd05935 109 VLATAAASAAWSGLTPDSVLLAFLPLFHVAGMQGSMNAPIYTGATLVLLTRWDREAAARAIERYRVTHWTNIVTMVVDLL 188
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 343 NQPRKDTERKHKVRMALGNG------LRQSiWEEFTN-RFNvpqiaEFYGATE---CNCSLGNFDNKTGACGfnsriLPy 412
Cdd:cd05935 189 AHPRFADYDLSSLKVVGGGGaalppaVAER-LKALTGlLYE-----EGYGLTEthtCTHFNPPDRPKPQCLG-----IP- 256
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 413 VYPIRLVKVDEETMELIrgpdgvcipcGPGEPGQLVGRIIQndplrRFDGYVNQTATNKKIAqdVFKKGDSAYLSGDVLV 492
Cdd:cd05935 257 VFGTDARVIDPETGEEL----------PPGEEGEIVVRGPQ-----VFKGYWNRPEATAESF--IELDGKRFFRTGDLGY 319
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 493 MDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV------EVPGA--EGKAGMAAIADPEnntDLAK 564
Cdd:cd05935 320 IDEEGYFFFLDRVKRMINVSGYKVWPAEVEALLYQHPAVLEVCVIGRpdprrgEVVKAfvVLKPDYRGKVTEE---DIIE 396
                       490       500       510
                ....*....|....*....|....*....|....*..
gi 62955443 565 FSRDLEKAlppYARPVFLRFLPEVDKTGTFKFQKTDM 601
Cdd:cd05935 397 WCRERMAA---YKYPRIIEFVDELPKTASGKVLWRLL 430
PRK07786 PRK07786
long-chain-fatty-acid--CoA ligase; Validated
89-604 2.25e-29

long-chain-fatty-acid--CoA ligase; Validated


Pssm-ID: 169098  Cd Length: 542  Bit Score: 122.58  E-value: 2.25e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   89 NKTALIFEGTDEKWsfKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHC 168
Cdd:PRK07786  32 DAPALRFLGNTTTW--RELDDRVAALAGALSRRGVGFGDRVLILMLNRTEFVESVLAANMLGAIAVPVNFRLTPPEIAFL 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  169 VNISSAKAVVFGSELTEAMCEVHSSMGKTVKLFVSGEwDPKRVPVGTEhlDPLLETTSTIQPKQ-PDRSFTdrlFYIYTS 247
Cdd:PRK07786 110 VSDCGAHVVVTEAALAPVATAVRDIVPLLSTVVVAGG-SSDDSVLGYE--DLLAEAGPAHAPVDiPNDSPA---LIMYTS 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  248 GTTGMPKAAIVVHSRYYRMAALVYYGFRM-KPEDVLYDCLPLYHSAGnIVGIGQGLIHGMTVVIR--KKFSASKFWDDCI 324
Cdd:PRK07786 184 GTTGRPKGAVLTHANLTGQAMTCLRTNGAdINSDVGFVGVPLFHIAG-IGSMLPGLLLGAPTVIYplGAFDPGQLLDVLE 262
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  325 KYNCTIVQYIGEICRYLLNQPRKDtERKHKVRMaLGNGL---RQSIWEEFTNRFNVPQIAEFYGATECN---CSLGNFD- 397
Cdd:PRK07786 263 AEKVTGIFLVPAQWQAVCAEQQAR-PRDLALRV-LSWGAapaSDTLLRQMAATFPEAQILAAFGQTEMSpvtCMLLGEDa 340
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  398 -NKTGACGfnsRILPYVYpirlVKVDEETMELIrgpdgvcipcGPGEpgqlVGRIIQNDPlRRFDGYVNqtatNKKIAQD 476
Cdd:PRK07786 341 iRKLGSVG---KVIPTVA----ARVVDENMNDV----------PVGE----VGEIVYRAP-TLMSGYWN----NPEATAE 394
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  477 VFKKGdsAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYG------VEVPGAegkagM 550
Cdd:PRK07786 395 AFAGG--WFHSGDLVRQDEEGYVWVVDRKKDMIISGGENIYCAEVENVLASHPDIVEVAVIGradekwGEVPVA-----V 467
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|....
gi 62955443  551 AAIADPENNTDLAKFSRDLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRD 604
Cdd:PRK07786 468 AAVRNDDAALTLEDLAEFLTDRLARYKHPKALEIVDALPRNPAGKVLKTELRER 521
MACS_like_3 cd05971
Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS); MACS catalyzes the ...
96-603 4.56e-29

Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS); MACS catalyzes the two-step activation of medium chain fatty acids (containing 4-12 carbons). The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. MACS enzymes are localized to mitochondria.


Pssm-ID: 213318  Cd Length: 439  Bit Score: 120.54  E-value: 4.56e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  96 EGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAK 175
Cdd:cd05971   1 DGTREEYTFGQLKDASNRLANALRELGVERGDRVGVYLPQSPETAIAHLAVYKLGAVSVPLSVLFGPDAVEHRLRDSGAR 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 176 AVVfgselteamcevhssmgktvklfVSGEWDPKRVpvgtehldpllettstiqpkqpdrsftdrlfyIYTSGTTGMPKA 255
Cdd:cd05971  81 VLV-----------------------TDGSDDPAIL--------------------------------IYTSGTTGPPKG 105
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 256 AIVVHSRYYRMAALVYYGFRM--KPEDVLYDclplyhSA--GNIVGIGQ----GLIHGMTVVI--RKKFSASKFWDDCIK 325
Cdd:cd05971 106 ALHGHRVLLGHLPGVELYFELapRPGDVFWT------PAdwAWIGGLLDvllpALYFGVPVVAyrMQRFDPERAFALMRR 179
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 326 YNCTIVQYIGEICRYLLNQ--PRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPqIAEFYGATECNCSLGN----FDNK 399
Cdd:cd05971 180 YGVTNAFLPPTALKMMRRVgsERARYDLRLRAVASGGESLGEELLEWARDELGLT-VNEFYGQTEANLVVGNcaalGPAR 258
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 400 TGACGfnsrilpYVYPIRLVKVDEETMElirgpdgvciPCGPGEPGQLVgrIIQNDPLrRFDGYVNQ-TATNKKIAQDVF 478
Cdd:cd05971 259 PGSMG-------KPVPGHEVAVVDDAGR----------PVPPGEVGEIA--VKRPDPV-MFLGYWNNpEATAAKFAGDWL 318
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 479 KKGDSAylsgdvlVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV--EVPGAEGKAGMAAIADP 556
Cdd:cd05971 319 LTGDLG-------RRDADGYLWFKGRADDVIKSSGYRIGPAEIEECLLKHPAVLEAAVVGVpdPERGEIVKAFVVLAEGV 391
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*...
gi 62955443 557 ENNTDLAKFSRDLEKA-LPPYARPVFLRFLPEVDKTGTFKFQKTDMRR 603
Cdd:cd05971 392 EPSDELATELQELVKSrLAAHEYPREIEFVDELPMTTTGKIRRRELRR 439
ttLC_FACS_AEE21_like cd12118
Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis; This ...
80-603 4.68e-29

Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis; This family includes fatty acyl-CoA synthetases that can activate medium to long-chain fatty acids. These enzymes catalyze the ATP-dependent acylation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. Fatty acyl-CoA synthetases are responsible for fatty acid degradation as well as physiological regulation of cellular functions via the production of fatty acyl-CoA esters. The fatty acyl-CoA synthetase from Thermus thermophiles in this family has been shown to catalyze the long-chain fatty acid, myristoyl acid. Also included in this family are acyl activating enzymes from Arabidopsis, which contains a large number of proteins from this family with up to 63 different genes, many of which are uncharacterized.


Pssm-ID: 213326  Cd Length: 520  Bit Score: 121.22  E-value: 4.68e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  80 FAKSVKKYGNKTALIFegTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGveAALINFN 159
Cdd:cd12118  10 LERAAKVYPDRTAVVY--GDRRYTYRETYDRCRRLASALSKLGIGKGDVVAVLAPNTPAMLEAHFGVPMAG--AVLVPLN 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 160 LRLEA--LVHCVNISSAKAVVFGSELTEAMCEVHSSMG-KTVKLFVSGEWDPKRVPVGTEHLDPLLETTSTIQPKQPDRS 236
Cdd:cd12118  86 TRLDAddIAFILNHSEAKVLFVDQEFLSLAEEALALLStKEIIDTEIIVISPAAEDSEEGDYEDLLAGGDPDPLPIPPDD 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 237 FTDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAG-----NIVGIGqglihGMTVVIR 311
Cdd:cd12118 166 EWDPISLNYTSGTTGNPKGVVYTHRGAYLNALGNVIEWGMPDRPVYLWTLPMFHCNGwcfpwAITAVG-----GTHVCLR 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 312 kKFSASKFWDDCIKYNCT------IVQYIgeicryLLNQPRKDTER-KHKVRMALGN--------GLRQSIweeftnRFN 376
Cdd:cd12118 241 -KVDAPAIYDLIEKHKVThlcgapTVLNM------LANAPEADKLPlPRPVRVMTAGappppaviKKMEEL------GFE 307
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 377 VPQIaefYGATECN-----CSLGN-FDNktGACGFNSRI-----LPYVYPIRLVKVDEETMELIrGPDGVCIpcgpgepG 445
Cdd:cd12118 308 VTHV---YGLTETYgpitvCEWKPeWDA--LPAEERARLkarqgVRYVGLEEVDVVDPETMKDV-PRDGKTI-------G 374
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 446 QLV--GRIIqndplrrFDGYV-NQTATNKKIAQDVFKkgdsaylSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVE 522
Cdd:cd12118 375 EIVmrGNTV-------MKGYYkNPEATEEAFAGGWFH-------SGDLAVVHPDGYIEIKDRSKDIIISGGENISSIEVE 440
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 523 GTLSRLLDMKDVVVYGV------EVPGA--EGKAGMAAIADpenntDLAKFSRDlekALPPYARPVFLRFLpEVDKTGTF 594
Cdd:cd12118 441 GVLYKHPAVLEAAVVARpdekwgETPCAfvVLKPGASVTEE-----ELIEYCRE---KLAHFKVPKTVEFV-ELPKTATG 511

                ....*....
gi 62955443 595 KFQKTDMRR 603
Cdd:cd12118 512 KIQKFVLRE 520
benz_CoA_lig TIGR02262
benzoate-CoA ligase family; Characterized members of this protein family include benzoate-CoA ...
63-602 1.06e-28

benzoate-CoA ligase family; Characterized members of this protein family include benzoate-CoA ligase, 4-hydroxybenzoate-CoA ligase, 2-aminobenzoate-CoA ligase, etc. Members are related to fatty acid and acetate CoA ligases.


Pssm-ID: 274059  Cd Length: 505  Bit Score: 120.33  E-value: 1.06e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443    63 KLNVKKHLRERNTVpklfaksvKKYGNKTAliFEGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGL 142
Cdd:TIGR02262   2 KYNAAEDLLDRNVV--------EGRGGKTA--FIDDISSLSYGELEAQVRRLAAALRRLGVKREERVLLLMLDGVDFPIA 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   143 WLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVVFGSELTEAMCEVHSSMGKTVKLFVSGewdpkRVPVGTEHLDPLL 222
Cdd:TIGR02262  72 FLGAIRAGIVPVALNTLLTADDYAYMLEDSRARVVFVSGALLPVIKAALGKSPHLEHRVVVG-----RPEAGEVQLAELL 146
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   223 ETTS---TIQPKQPDrsftDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALvyYGFR---MKPEDVLYDCLPLYHSagniV 296
Cdd:TIGR02262 147 ATESeqfKPAATQAD----DPAFWLYSSGSTGMPKGVVHTHSNPYWTAEL--YARNtlgIREDDVCFSAAKLFFA----Y 216
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   297 GIGQGLIHGMTV-----VIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMAL--GNGLRQSIWE 369
Cdd:TIGR02262 217 GLGNALTFPMSVgattvLMGERPTPDAVFDRLRRHQPTIFYGVPTLYAAMLADPNLPSEDQVRLRLCTsaGEALPAEVGQ 296
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   370 EFTNRFNVpQIAEFYGATEcncsLGN--FDNKTGACGFNSRILPYV-YPIRLVKVDEEtmelirgpdgvciPCGPGEPGQ 446
Cdd:TIGR02262 297 RWQARFGV-DIVDGIGSTE----MLHifLSNLPGDVRYGTSGKPVPgYRLRLVGDGGQ-------------DVADGEPGE 358
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   447 LvgriiQNDPLRRFDGYVNQTATNKKIAQDVFKKgdsaylSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLS 526
Cdd:TIGR02262 359 L-----LISGPSSATMYWNNRAKSRDTFQGEWTR------SGDKYVRNDDGSYTYAGRTDDMLKVSGIYVSPFEIESALI 427
                         490       500       510       520       530       540       550
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 62955443   527 RLLDMKDVVVYGVEVPGAEGKAGMAAIADPENN---TDLAKFSRDlekALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:TIGR02262 428 QHPAVLEAAVVGVADEDGLIKPKAFVVLRPGQTaleTELKEHVKD---RLAPYKYPRWIVFVDDLPKTATGKIQRFKLR 503
OSB_CoA_lg cd05912
O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA ...
102-603 1.42e-27

O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE); O-succinylbenzoic acid-CoA synthase catalyzes the coenzyme A (CoA)- and ATP-dependent conversion of o-succinylbenzoic acid to o-succinylbenzoyl-CoA. The reaction is the fourth step of the biosynthesis pathway of menaquinone (vitamin K2). In certain bacteria, menaquinone is used during fumarate reduction in anaerobic respiration. In cyanobacteria, the product of the menaquinone pathway is phylloquinone (2-methyl-3-phytyl-1,4-naphthoquinone), a molecule used exclusively as an electron transfer cofactor in Photosystem 1. In green sulfur bacteria and heliobacteria, menaquinones are used as loosely bound secondary electron acceptors in the photosynthetic reaction center.


Pssm-ID: 213280  Cd Length: 407  Bit Score: 115.35  E-value: 1.42e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 102 WSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALvhcvnissakavvfgs 181
Cdd:cd05912   2 LTFQELDQRVSQLAEQLAALGVRRGDRVALLAKNSIEFLLLFLALLRLGAVVLPLNPRLPQEEL---------------- 65
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 182 eltEAMCevhssmgktvklfvsgewdpkrvpvgtEHLDPLLETTSTIqpkqpdrsftdrlfyIYTSGTTGMPKAaiVVHS 261
Cdd:cd05912  66 ---QQQL---------------------------ADLQPDLDRPATI---------------IFTSGSTGKPKA--VVHT 98
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 262 R--YYRMAALVYYGFRMKPEDVLYDCLPLYHsagnIVGIGQ---GLIHGMTVVIRKKFSASKFWDDCIKYNCTIV----- 331
Cdd:cd05912  99 WgnHLASARGSAENLGLTPDDNWLLSLPLFH----VSGLAIvmrSLLAGGALVLPDKFDAEAIAEALENHGVTHIslvpt 174
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 332 QYIgeicRYLLNQPRKDTER-KHkvrMALGNGLrqsIWEEFTNR---FNVPqIAEFYGATEcNCS------LGNFDNKTG 401
Cdd:cd05912 175 QLQ----RLLESLGARWLSSlRA---VLLGGAP---IPPSLLEQarqRGIP-LYPTYGMTE-TASqvatlkPDDFLAKLG 242
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 402 ACGfnsRILPYVyPIRLvkVDEETME-LIRGPDgvcipcgpgepgqlvgriiqndplrRFDGYVNQ-TATNKKIAQDVFK 479
Cdd:cd05912 243 SVG---KPLPGR-ELRI--VNPQDGEiLVRGPS-------------------------LFLGYLPQgGLTPPLDEDGWFH 291
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 480 KGDSAYLSGDvlvmddfGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV------EVPgaegkagmAAI 553
Cdd:cd05912 292 TGDLGYLDAE-------GYLYVLGRRDDLIISGGENIYPEEIEAVLLQHPAVEEAAVVGVpddewgQRP--------VAF 356
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|.
gi 62955443 554 ADPEN-NTDLAKFSRDLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRR 603
Cdd:cd05912 357 VVPNDdPVSVEELQAFLADKLAKYKRPKRWYPLPELPRNASGKIDRAALRQ 407
23DHB-AMP_lg cd05920
2,3-dihydroxybenzoate-AMP ligase; 2,3-dihydroxybenzoate-AMP ligase activates 2, ...
68-598 1.64e-27

2,3-dihydroxybenzoate-AMP ligase; 2,3-dihydroxybenzoate-AMP ligase activates 2,3-dihydroxybenzoate (DHB) by ligation of AMP from ATP with the release of pyrophosphate. However, it can also catalyze the ATP-PPi exchange for 2,3-DHB analogs, such as salicyclic acid (o-hydrobenzoate), as well as 2,4-DHB and 2,5-DHB, but with less efficiency. Proteins in this family are the stand-alone adenylation components of non-ribosomal peptide synthases (NRPSs) involved in the biosynthesis of siderophores, which are low molecular weight iron-chelating compounds synthesized by many bacteria to aid in the acquisition of this vital trace elements. In Escherichia coli, the 2,3-dihydroxybenzoate-AMP ligase is called EntE, the adenylation component of the enterobactin NRPS system.


Pssm-ID: 213287  Cd Length: 483  Bit Score: 116.15  E-value: 1.64e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  68 KHLRERN-----TVPKLFAKSVKKYGNKTALIfeGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGL 142
Cdd:cd05920   4 ERYRAAGywgdqTLGDLLAANAARHPDRTAVV--DGPRRLTYRELDAAVDRLAAGLLALGIGPGDRVLVQLPNVAEFVIL 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 143 WLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVVfgselteamcevhssmgktvklfVSGEWdpkrvpvgteHLDPLL 222
Cdd:cd05920  82 YFALFKLGAIPVLALPAHRAHEIGHFARQSEAKAYI-----------------------IADRF----------SGFDYA 128
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 223 ETTSTIQPKQPDRsftdrLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQG- 301
Cdd:cd05920 129 ALARELLEELPDV-----ALFQLSGGTTGLPKLIPRTHNDYLYSARASAEACGLDPGTVYLAVLPAAHNFTLSSPGLLGa 203
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 302 LIHGMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRmALGNG---LRQSIWEEFTNRFNVP 378
Cdd:cd05920 204 LLAGGTVVLHHPPSPDVAFPLIEREKVTHTALVPALLNLWLEAAEWDQADLSSLR-VIQVGgapLSPELARRVEERLGCP 282
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 379 qIAEFYGATE--CNCSLGNfDNKTGACGFNSR-ILPYVYpIRLVkvDEETmelirgpdgvcIPCGPGEPGQLVGRiiqnD 455
Cdd:cd05920 283 -LQQVFGMAEglVNYTRLD-DPPDVIMRTQGRpISPADE-IRIV--DDQG-----------EPVPPGEVGELLTR----G 342
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 456 PLRrFDGYVNQTATNKKiaqdVFKKgDSAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVV 535
Cdd:cd05920 343 PYT-IRGYYRAPEHNAR----AFTD-DGFYRTGDLVRIDADGYYRVVGRIKDQINRGGEKISPEEIENLLLSHPAVADAA 416
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 62955443 536 VYGVEVPGAEGKAGMAAIADPENNTDLAKFSRDL-EKALPPYARPVFLRFLPEVDKTGTFKFQK 598
Cdd:cd05920 417 VVGMPDEVLGERICAFVVPRGGAAPTLAELRAFLrEQGLAKFKLPDRLEVVDSLPLTPVGKVDK 480
PRK08276 PRK08276
long-chain-fatty-acid--CoA ligase; Validated
92-602 1.07e-26

long-chain-fatty-acid--CoA ligase; Validated


Pssm-ID: 236215  Cd Length: 502  Bit Score: 114.23  E-value: 1.07e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   92 ALIFEGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNI 171
Cdd:PRK08276   2 AVIMAPSGEVVTYGELEARSNRLAHGLRALGLREGDVVAILLENNPEFFEVYWAARRSGLYYTPINWHLTAAEIAYIVDD 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  172 SSAKAVVFGSELTEAMCEVHSSMGKTVKLF--VSGEWDpkrvpvGTEHLDPLLETTSTIQPkqPDRSFTDRLfyIYTSGT 249
Cdd:PRK08276  82 SGAKVLIVSAALADTAAELAAELPAGVPLLlvVAGPVP------GFRSYEEALAAQPDTPI--ADETAGADM--LYSSGT 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  250 TGMPKA------AIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAgNIVGIGQGLIHGMTVVIRKKFSASKFWDDC 323
Cdd:PRK08276 152 TGRPKGikrplpGLDPDEAPGMMLALLGFGMYGGPDSVYLSPAPLYHTA-PLRFGMSALALGGTVVVMEKFDAEEALALI 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  324 IKYNCTIVQYIGEICRYLLNQPRKDTER----KHKVRMALGNGL-----RQSI--WEeftnrfnvPQIAEFYGATECN-- 390
Cdd:PRK08276 231 ERYRVTHSQLVPTMFVRMLKLPEEVRARydvsSLRVAIHAAAPCpvevkRAMIdwWG--------PIIHEYYASSEGGgv 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  391 --CSLGNFDNKTGACGfnsriLPYVYPIRlvkvdeetmelIRGPDGVciPCGPGEPGQLVGRiiQNDPlrRFDGYVNQTA 468
Cdd:PRK08276 303 tvITSEDWLAHPGSVG-----KAVLGEVR-----------ILDEDGN--ELPPGEIGTVYFE--MDGY--PFEYHNDPEK 360
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  469 TNK-KIAQDVFKKGDSAYLsgdvlvmDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGveVPGAE-G 546
Cdd:PRK08276 361 TAAaRNPHGWVTVGDVGYL-------DEDGYLYLTDRKSDMIISGGVNIYPQEIENLLVTHPKVADVAVFG--VPDEEmG 431
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 62955443  547 KAGMAAI-------ADPENNTDLAKFSRDlekALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:PRK08276 432 ERVKAVVqpadgadAGDALAAELIAWLRG---RLAHYKCPRSIDFEDELPRTPTGKLYKRRLR 491
PRK03640 PRK03640
O-succinylbenzoic acid--CoA ligase; Provisional
89-544 1.32e-26

O-succinylbenzoic acid--CoA ligase; Provisional


Pssm-ID: 235146  Cd Length: 483  Bit Score: 113.52  E-value: 1.32e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   89 NKTALIFEgtDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHC 168
Cdd:PRK03640  17 DRTAIEFE--EKKVTFMELHEAVVSVAGKLAALGVKKGDRVALLMKNGMEMILVIHALQQLGAVAVLLNTRLSREELLWQ 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  169 VNISSAKAVVfgselteamcevhssmgktvklfVSGEWDPKRVPVGTEHLDPLLETTSTIQPKQPDRSFTDRLFYIYTSG 248
Cdd:PRK03640  95 LDDAEVKCLI-----------------------TDDDFEAKLIPGISVKFAELMNGPKEEAEIQEEFDLDEVATIMYTSG 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  249 TTGMPKAAIVVHSRYYRMA---ALvyyGFRMKPEDVLYDCLPLYHSAG-NIvgIGQGLIHGMTVVIRKKFSASKFWDDCI 324
Cdd:PRK03640 152 TTGKPKGVIQTYGNHWWSAvgsAL---NLGLTEDDCWLAAVPIFHISGlSI--LMRSVIYGMRVVLVEKFDAEKINKLLQ 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  325 KYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNG-LRQSIWEEFTNRfNVPQIaEFYGATE-CN--CSLGNFD--N 398
Cdd:PRK03640 227 TGGVTIISVVSTMLQRLLERLGEGTYPSSFRCMLLGGGpAPKPLLEQCKEK-GIPVY-QSYGMTEtASqiVTLSPEDalT 304
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  399 KTGACG---FNSRilpyvypIRLVKvdeetmelirgpDGVciPCGPGEPGQLVgriIQNDPLRRfdGYVNQTATNKKIAQ 475
Cdd:PRK03640 305 KLGSAGkplFPCE-------LKIEK------------DGV--VVPPFEEGEIV---VKGPNVTK--GYLNREDATRETFQ 358
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 62955443  476 D-VFKKGDSAYLsgdvlvmDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVE------VPGA 544
Cdd:PRK03640 359 DgWFKTGDIGYL-------DEEGFLYVLDRRSDLIISGGENIYPAEIEEVLLSHPGVAEAGVVGVPddkwgqVPVA 427
4CL cd05904
4-Coumarate-CoA Ligase (4CL); 4-Coumarate:coenzyme A ligase is a key enzyme in the ...
84-544 1.83e-26

4-Coumarate-CoA Ligase (4CL); 4-Coumarate:coenzyme A ligase is a key enzyme in the phenylpropanoid metabolic pathway for monolignol and flavonoid biosynthesis. It catalyzes the synthesis of hydroxycinnamate-CoA thioesters in a two-step reaction, involving the formation of hydroxycinnamate-AMP anhydride and the nucleophilic substitution of AMP by CoA. The phenylpropanoid pathway is one of the most important secondary metabolism pathways in plants and hydroxycinnamate-CoA thioesters are the precursors of lignin and other important phenylpropanoids.


Pssm-ID: 213272  Cd Length: 504  Bit Score: 113.50  E-value: 1.83e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  84 VKKYGNKTALIFEGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLE 163
Cdd:cd05904  15 ASEFGDRPALIDAATGRALTYAELERLVRRLAAGLAARGGRKGDVVLLLSPNSLEFPVVFLAVLSAGAVVTTANPLYTPA 94
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 164 ALVHCVNISSAKAVVFGSELTEamcevhssmgktvKLFVSGEwdPKRVPVGTEHLDPLLE----TTSTIQPKQPDRSFTD 239
Cdd:cd05904  95 EIAKQVKDSGAKLAITTSELAE-------------KLASLAL--EPVVLLDSADDGSAAIddllFADEPEPPVVVIKQDD 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 240 RLFYIYTSGTTGMPKAAIVVHSRYYRMAALV--YYGFRMKPEDVLYDCLPLYHSAGnIVGIGQGLIH-GMTVVIRKKFSA 316
Cdd:cd05904 160 VAALPYSSGTTGRSKGVMLTHRNLIANVAQLvaGEGPNFDREDVTLCVLPMFHIYG-LTVILLALLRlGATVVVMPRFDL 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 317 SKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNG--LRQSIWEEFTNRFNVPQIAEFYGATECN---- 390
Cdd:cd05904 239 EKFLAAIEKYKVTHLPVVPPIVLALVKHPIVDKYDLSSLKQIGSGAapLGKELAEAFRARFPGVELGQGYGMTESSpvtt 318
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 391 -CSLGNFDNKTGACGfnsRILPYVYpirlVK-VDEETmelirgpdGVCIPcgPGEPGQLVGR---IIQndplrrfdGYV- 464
Cdd:cd05904 319 mCPVPEKDPKPGSVG---RLVPNVE----AKiVDPET--------GESLP--PNQPGELWVRgpqVMK--------GYLn 373
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 465 NQTATNKKIAQDVF-KKGDSAYLsgdvlvmDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV---- 539
Cdd:cd05904 374 NPEATAETIDKDGWlHTGDLGYF-------DEDGYLFIVDRLKELIKYKGFQVAPAELEALLLSHPEIADAAVIPYpdee 446

                ....*..
gi 62955443 540 --EVPGA 544
Cdd:cd05904 447 agEIPMA 453
PRK13391 PRK13391
acyl-CoA synthetase; Provisional
90-602 2.72e-26

acyl-CoA synthetase; Provisional


Pssm-ID: 184022  Cd Length: 511  Bit Score: 112.86  E-value: 2.72e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   90 KTALIFEGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCV 169
Cdd:PRK13391  13 KPAVIMASTGEVVTYRELDERSNRLAHLFRSLGLKRGDHVAIFMENNLRYLEVCWAAERSGLYYTCVNSHLTPAEAAYIV 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  170 NISSAKAVVfgselteamcevhssmGKTVKLFVSGEwDPKRVPVGTEHLDPL----------LETTSTIQPKQP--DRSF 237
Cdd:PRK13391  93 DDSGARALI----------------TSAAKLDVARA-LLKQCPGVRHRLVLDgdgelegfvgYAEAVAGLPATPiaDESL 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  238 TDRLFyiYTSGTTGMPKAAI-------VVHSRYYRMAALVYYGFRmkpEDVLYDC-LPLYHSAGN-IVGIGQGLihGMTV 308
Cdd:PRK13391 156 GTDML--YSSGTTGRPKGIKrplpeqpPDTPLPLTAFLQRLWGFR---SDMVYLSpAPLYHSAPQrAVMLVIRL--GGTV 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  309 VIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPrKDTERKHKVrmalgNGLRQSI-----------------WEef 371
Cdd:PRK13391 229 IVMEHFDAEQYLALIEEYGVTHTQLVPTMFSRMLKLP-EEVRDKYDL-----SSLEVAIhaaapcppqvkeqmidwWG-- 300
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  372 tnrfnvPQIAEFYGATECNcslgnfdnktGACGFNSrilpyvypirlvkvdEETME-------------LIRGPDGVciP 438
Cdd:PRK13391 301 ------PIIHEYYAATEGL----------GFTACDS---------------EEWLAhpgtvgramfgdlHILDDDGA--E 347
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  439 CGPGEPGQL---VGRIIQ--NDPlrrfdgyvNQTATNKKIAQDVFKKGDSAYLsgdvlvmDDFGYMYFRDRTGDTFRWKG 513
Cdd:PRK13391 348 LPPGEPGTIwfeGGRPFEylNDP--------AKTAEARHPDGTWSTVGDIGYV-------DEDGYLYLTDRAAFMIISGG 412
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  514 ENVSTTEVEGTLSRLLDMKDVVVYGV--EVPGAEGKAGM----AAIADPENNTDLAKFSRDlekALPPYARPVFLRFLPE 587
Cdd:PRK13391 413 VNIYPQEAENLLITHPKVADAAVFGVpnEDLGEEVKAVVqpvdGVDPGPALAAELIAFCRQ---RLSRQKCPRSIDFEDE 489
                        570
                 ....*....|....*
gi 62955443  588 VDKTGTFKFQKTDMR 602
Cdd:PRK13391 490 LPRLPTGKLYKRLLR 504
FAA1 COG1022
Long-chain acyl-CoA synthetase (AMP-forming) [Lipid transport and metabolism];
66-570 3.55e-26

Long-chain acyl-CoA synthetase (AMP-forming) [Lipid transport and metabolism];


Pssm-ID: 223953  Cd Length: 613  Bit Score: 113.57  E-value: 3.55e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  66 VKKHLRERNTVPKLFAKSVKKYGNKTALIFE--GTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLW 143
Cdd:COG1022   8 AWEDVAEIHTLPKRLAERVKDRPDGVALMYKelGGWEAITYRELYERVRALASGLLSLGIPAGDRVAIFAANRPEWAIAD 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 144 LGMAKIGVEAALINFNLRLEALVHCVNISSAKAVVFG-SELTEAMCEVHSSMGKTVKLFVSGEWDPKRVPVGTEHLDPL- 221
Cdd:COG1022  88 LAILALGAVSVPIYSTSTPEQLAYILNESESKVIFVEnQELLDLVLPVLEDCPKVVDLIVIIDLVREAVEAKALVLEVFp 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 222 -----------LETTSTIQPKQPDRSFTdrlfYIYTSGTTGMPKAaiVVHSrYYRMAALVYYGFRM----KPEDVLYDCL 286
Cdd:COG1022 168 degislflidsAGLEGRIAPPKPDDLAT----IIYTSGTTGTPKG--VMLT-HRNLLAQVAGIDEVlppiGPGDRVLSFL 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 287 PLYHSAGNIVGIGQGLIHGMTVV---------------------------------IRKKFSASKFWDDCI-------KY 326
Cdd:COG1022 241 PLAHIFERAFEGGLALYGGVTVLfkedprtlledlkevrptvmigvprvwekvykgIMEKVAKAPAVRRKLfrwalkvAY 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 327 NCTIVQYIGEicRYLLNQPRKDTERKHKVRMALGNGLRQSI---------WEEFTNRFNVPqIAEFYGATECN---CSLG 394
Cdd:COG1022 321 KKISRALLGG--GPLSWLLVADRLVFRKIRDALGGRIRYALsggaplspeLLHFFRSLGIP-ILEGYGLTETSavvSVNP 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 395 NFDNKTGACGfnsRILPYVYpirlVKVDEETMELIRGPdgvcipcgpgepgQLvgriiqndplrrFDGYV-NQTATNKKI 473
Cdd:COG1022 398 PDRFVLGTVG---KPLPGIE----VKIADDGEILVRGP-------------NV------------MKGYYkNPEATAEAF 445
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 474 AQDVFKKgdsaylSGDVLVMDDFGYMYFRDRTGDTFRW-KGENVSTTEVEGTLSRLLDMKDVVVYGvevpgaEGKAGMAA 552
Cdd:COG1022 446 TEDGWFR------TGDLGELDEDGYLVITGRKKELIKLsNGKNIAPEPIESKLAKSPLIEQICVVG------DDKKFLVA 513
                       570
                ....*....|....*...
gi 62955443 553 IADPenntDLAKFSRDLE 570
Cdd:COG1022 514 LIVP----DFDALEKWAE 527
PRK07868 PRK07868
acyl-CoA synthetase; Validated
78-630 4.06e-26

acyl-CoA synthetase; Validated


Pssm-ID: 236121  Cd Length: 994  Bit Score: 114.04  E-value: 4.06e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   78 KLFAKSVKKYGNKTALIFEGTDEkwSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALIN 157
Cdd:PRK07868 451 RIIAEQARDAPKGEFLLFDGRVH--TYEAVNRRINNVVRGLIAVGVRQGDRVGVLMETRPSALVAIAALSRLGAVAVLMP 528
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  158 FNLRLEAlvhCVNISSAKAVVFGSELTEAMcevhSSMGKTVKLFVSGEWDPKRVPVGTEHLDplLETtstIQPKQ----- 232
Cdd:PRK07868 529 PDTDLAA---AVRLGGVTEIITDPTNLEAA----RQLPGRVLVLGGGESRDLDLPDDADVID--MEK---IDPDAvelpg 596
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  233 ---PDRSFTDRLFYIYTSGTTGMPKAAIVVHSRYyrmaALVYYGF----RMKPEDVLYdCL-PLYHSAGNIVGIGQGLIH 304
Cdd:PRK07868 597 wyrPNPGLARDLAFIAFSTAGGELVAKQITNYRW----ALSAFGTasaaALDRRDTVY-CLtPLHHESGLLVSLGGAVVG 671
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  305 GMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPQIAEFY 384
Cdd:PRK07868 672 GSRIALSRGLDPDRFVQEVRQYGVTVVSYTWAMLREVVDDPAFVLHGNHPVRLFIGSGMPTGLWERVVEAFAPAHVVEFF 751
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  385 GATECNCSLGNFDN-KTGACGfnsRILPYVYPIRLVKVDEETMELIRGPDGVCIPCGPGEPGQLVGRIiqndplrrfDGY 463
Cdd:PRK07868 752 ATTDGQAVLANVSGaKIGSKG---RPLPGAGRVELAAYDPEHDLILEDDRGFVRRAEVNEVGVLLARA---------RGP 819
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  464 VNQTATNKKiaqDVFKKGDSAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPG 543
Cdd:PRK07868 820 IDPTASVKR---GVFAPADTWISTEYLFRRDDDGDYWLVDRRGSVIRTARGPVYTEPVTDALGRIGGVDLAVTYGVEVGG 896
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  544 AEgkAGMAAIA-DPENNTDLAKFSRDLEkALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRDGFdPNiVSDKLYFLDRTK 622
Cdd:PRK07868 897 RQ--LAVAAVTlRPGAAITAADLTEALA-SLPVGLGPDIVHVVPEIPLSATYRPTVSALRAAGI-PK-PGRQAWYFDPET 971

                 ....*...
gi 62955443  623 GQYVELNA 630
Cdd:PRK07868 972 NRYRRLTP 979
FACL_like_6 cd05922
Uncharacterized subfamily of fatty acid CoA ligase (FACL); Fatty acyl-CoA ligases catalyze the ...
244-602 9.66e-26

Uncharacterized subfamily of fatty acid CoA ligase (FACL); Fatty acyl-CoA ligases catalyze the ATP-dependent activation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions.


Pssm-ID: 213289  Cd Length: 350  Bit Score: 109.25  E-value: 9.66e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 244 IYTSGTTGMPKAAIVVHSRYYRMAALV--YYGfrMKPEDVLYDCLPLYHSAGNIVgIGQGLIHGMTVVIRKKFSASK-FW 320
Cdd:cd05922   8 IYTSGSTGEPKGVMLSHRNLTAGARSIaqYLE--LTEDDRILAVLPFSFDYGLSQ-LLTAFRVGGTLVLESRFAFPRdVL 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 321 DDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRM--ALGNGLRQSIWEEFTNRFNVPQIAEFYGATECNCSL----G 394
Cdd:cd05922  85 KHLAKERITGFAGVPTTWAQLLRLDPLAREDFPSLRYltNAGGALPAKTILQLRRAFPDAKLFSMYGLTEAFRSTylppE 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 395 NFDNKTGACGfnsRILPyvypirlvkvDEETMelIRGPDGVciPCGPGEPGQLVGR---IIQndplrrfdGYVNQTATNK 471
Cdd:cd05922 165 ELDRRPDSIG---KAIP----------NVELW--VVDEDGN--RCAPGEVGELVHRganVMK--------GYWNDPEATA 219
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 472 KIAQDVFKKGDSAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAEGKAGMA 551
Cdd:cd05922 220 ERLRPGPLPGEIVLYTGDLVRMDEEGYLYFVGRKDDMIKTRGYRVSPTEIEEVICAHPLVAEAAVIGVPDPLLGQAIVAV 299
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|.
gi 62955443 552 AIADPENNTDLAKFSRDLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMR 602
Cdd:cd05922 300 VVSADGESLDEKELLKHCRKHLPNYMVPAEIVFVDSLPKNANGKVDRSALR 350
PRK07529 PRK07529
AMP-binding domain protein; Validated
100-604 1.90e-25

AMP-binding domain protein; Validated


Pssm-ID: 236043  Cd Length: 632  Bit Score: 111.20  E-value: 1.90e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  100 EKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQ-YVGLWLGMAKiGVeAALINFNLRLEALVHCVNISSAKAVV 178
Cdd:PRK07529  57 ETWTYAELLADVTRTANLLHSLGVGPGDVVAFLLPNLPEtHFALWGGEAA-GI-ANPINPLLEPEQIAELLRAAGAKVLV 134
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  179 -----FGSELTEAMCEV--HSSMGKTVkLFVSG---EWDPKRVPVGTEHLDP---LLETTSTIQPKQPDRSFTDRLF--- 242
Cdd:PRK07529 135 tlgpfPGTDIWQKVAEVlaALPELRTV-VEVDLaryLPGPKRLAVPLIRRKAharILDFDAELARQPGDRLFSGRPIgpd 213
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  243 ----YIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVI------RK 312
Cdd:PRK07529 214 dvaaYFHTGGTTGMPKLAQHTHGNEVANAWLGALLLGLGPGDTVFCGLPLFHVNALLVTGLAPLARGAHVVLatpqgyRG 293
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  313 KFSASKFWDDCIKYNCTIVQYIGEICRYLLNQP--RKDTErkhKVRMALGNG--LRQSIWEEFTNRFNVPqIAEFYGATE 388
Cdd:PRK07529 294 PGVIANFWKIVERYRINFLSGVPTVYAALLQVPvdGHDIS---SLRYALCGAapLPVEVFRRFEAATGVR-IVEGYGLTE 369
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  389 CNC-SLGNF---DNKTGACGFNsriLPYVYpIRLVKVDEEtmelirGPDGVciPCGPGEPGQLVgriIQNDPLrrFDGYV 464
Cdd:PRK07529 370 ATCvSSVNPpdgERRIGSVGLR---LPYQR-VRVVILDDA------GRYLR--DCAVDEVGVLC---IAGPNV--FSGYL 432
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  465 NQtATNKKI--AQDVFKKGDSAYLSGDvlvmddfGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV--- 539
Cdd:PRK07529 433 EA-AHNKGLwlEDGWLNTGDLGRIDAD-------GYFWLTGRAKDLIIRGGHNIDPAAIEEALLRHPAVALAAAVGRpda 504
                        490       500       510       520       530       540       550
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 62955443  540 ---EVPGA--EGKAGMAaiADPEnntDLAKFSRD--LEKAlppyARPVFLRFLPEVDKTGTFKFQKTDMRRD 604
Cdd:PRK07529 505 hagELPVAyvQLKPGAS--ATEA---ELLAFARDhiAERA----AVPKHVRILDALPKTAVGKIFKPALRRD 567
PRK12406 PRK12406
long-chain-fatty-acid--CoA ligase; Provisional
103-595 2.42e-25

long-chain-fatty-acid--CoA ligase; Provisional


Pssm-ID: 183506  Cd Length: 509  Bit Score: 110.17  E-value: 2.42e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  103 SFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVVFGSE 182
Cdd:PRK12406  13 SFDELAQRAARAAGGLAALGVRPGDCVALLMRNDFAFFEAAYAAMRLGAYAVPVNWHFKPEEIAYILEDSGARVLIAHAD 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  183 LTEAmceVHSSMGKTVKLFVSG-----------EWDPKRVPVGTEHLDPLLETTSTI-QPKQPDRSFTdrlfyIYTSGTT 250
Cdd:PRK12406  93 LLHG---LASALPAGVTVLSVPtppeiaaayriSPALLTPPAGAIDWEGWLAQQEPYdGPPVPQPQSM-----IYTSGTT 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  251 GMPK-----AAIVVHSRYY-RMAALVyYGFrmKPEDVLYDCLPLYHSAGNIVGIGQGLIhGMTVVIRKKFSASKFWDDCI 324
Cdd:PRK12406 165 GHPKgvrraAPTPEQAAAAeQMRALI-YGL--KPGIRALLTGPLYHSAPNAYGLRAGRL-GGVLVLQPRFDPEELLQLIE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  325 KYNCTIVQYIGEICRYLLNQPRKDTER------KHKVRMAL---GNGLRQSI--WEeftnrfnvPQIAEFYGATECN--- 390
Cdd:PRK12406 241 RHRITHMHMVPTMFIRLLKLPEEVRAKydvsslRHVIHAAApcpADVKRAMIewWG--------PVIYEYYGSTESGavt 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  391 -CSLGNFDNKTGACGfnsRILPYVypiRLVKVDEETMELirgpdgvcipcGPGEPGQLVGRIIQNDPLRrfdgYVNQTAT 469
Cdd:PRK12406 313 fATSEDALSHPGTVG---KAAPGA---ELRFVDEDGRPL-----------PQGEIGEIYSRIAGNPDFT----YHNKPEK 371
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  470 NKKIAQDVFkkgdsaYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGveVPGAE-GKA 548
Cdd:PRK12406 372 RAEIDRGGF------ITSGDVGYLDADGYLFLCDRKRDMVISGGVNIYPAEIEAVLHAVPGVHDCAVFG--IPDAEfGEA 443
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|.
gi 62955443  549 GMAAI-ADPENNTDLAKFSRDLEKALPPYARPVFLRF---LPEVDKTGTFK 595
Cdd:PRK12406 444 LMAVVePQPGATLDEADIRAQLKARLAGYKVPKHIEImaeLPREDSGKIFK 494
PRK07788 PRK07788
acyl-CoA synthetase; Validated
79-540 2.88e-25

acyl-CoA synthetase; Validated


Pssm-ID: 236097  Cd Length: 549  Bit Score: 110.40  E-value: 2.88e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   79 LFAKSVKKYGNKTALIFEgtDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINF 158
Cdd:PRK07788  54 LVAHAARRAPDRAALIDE--RGTLTYAELDEQSNALARGLLALGVRAGDGVAVLARNHRGFVLALYAAGKVGARIILLNT 131
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  159 NLRLEALVHCVNISSAKAVVFGSELTEAMCEVHSSMGKTVKLFVSGEWDPKRVPvGTEHLDPLLETTSTIQPKQPDR--S 236
Cdd:PRK07788 132 GFSGPQLAEVAAREGVKALVYDDEFTDLLSALPPDLGRLRAWGGNPDDDEPSGS-TDETLDDLIAGSSTAPLPKPPKpgG 210
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  237 FTdrlfyIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGnIVGIGQGLIHGMTVVIRKKFSA 316
Cdd:PRK07788 211 IV-----ILTSGTTGTPKGAPRPEPSPLAPLAGLLSRVPFRAGETTLLPAPMFHATG-WAHLTLAMALGSTVVLRRRFDP 284
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  317 SKFWDDCIKYNCTIVQYIGEICRYLLNQPrKDTERKH-----KVRMALGNGLRQSIWEEFTNRFNvPQIAEFYGATECN- 390
Cdd:PRK07788 285 EATLEDIAKHKATALVVVPVMLSRILDLG-PEVLAKYdtsslKIIFVSGSALSPELATRALEAFG-PVLYNLYGSTEVAf 362
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  391 CSLGNFDNKTGACGFNSRIlpyVYPIRLVKVDEETMELIRGpdgvcipcgpgepgqLVGRI-IQNDPLrrFDGYVNqtAT 469
Cdd:PRK07788 363 ATIATPEDLAEAPGTVGRP---PKGVTVKILDENGNEVPRG---------------VVGRIfVGNGFP--FEGYTD--GR 420
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 62955443  470 NKKIAQDVFKKGDSAYLsgdvlvmDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVE 540
Cdd:PRK07788 421 DKQIIDGLLSSGDVGYF-------DEDGLLFVDGRDDDMIVSGGENVFPAEVEDLLAGHPDVVEAAVIGVD 484
CHC_CoA_lg cd05903
Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase); ...
103-603 3.88e-25

Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase); Cyclohexanecarboxylate-CoA ligase activates the aliphatic ring compound, cyclohexanecarboxylate, for degradation. It catalyzes the synthesis of cyclohexanecarboxylate-CoA thioesters in a two-step reaction involving the formation of cyclohexanecarboxylate-AMP anhydride, followed by the nucleophilic substitution of AMP by CoA.


Pssm-ID: 213271  Cd Length: 437  Bit Score: 108.46  E-value: 3.88e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 103 SFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGveaALINfnlrleALVHcvnISSAKAVVFGse 182
Cdd:cd05903   3 TYGELDDAADRLAAALAELGVRPGDVVAFQLPNWWEFVVVYLACARIG---AVIN------PIVP---IYRERELGFI-- 68
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 183 LTEAMCEVhssmgktvkLFVSGEWDpkrvpvGTEHLDpllettstiqpkQPDrsftDRLFYIYTSGTTGMPKAAIVVHSR 262
Cdd:cd05903  69 LRQARARV---------LFVPDEFR------GFDYAA------------MPD----DVALLLYTSGTTGEPKGVMHTHNT 117
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 263 YYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLL 342
Cdd:cd05903 118 LLAEVRSYVERLGLTPDDVVLMPSPLAHITGFLYGLELPLLLGATVVLQDRWDPARALELIREHGVTFTMGATPFLADLL 197
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 343 NQPRKDTERKHKVRMALGNG------LRQSIWEEFTNRfnvpqIAEFYGATECNCSLGNFDN-----KTGACGfnsrilp 411
Cdd:cd05903 198 AAADAAGPDLPSLRVFLCGGapvpreLARRAAEALGAK-----VVRAYGMTEVPLVTVGTPDdpddkRAATDG------- 265
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 412 YVYP-IRLVKVDEETMELirgpdgvcipcGPGEPGQLVGRIIQNdplrrFDGYVNQTATNKKIAQDVFkkgdsaYLSGDV 490
Cdd:cd05903 266 RPVPgVEVRIVDDDGNDV-----------PPGEEGELQVRGPQL-----FLGYLDPPDNTEAFTDDGW------FRTGDL 323
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443 491 LVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVygVEVPGAE-G-KAGMAAIADPENNTDLAKFSRD 568
Cdd:cd05903 324 GRLDADGYLRITGRKKDIIIRGGENISAREIEDLLLRHPAVAEVAV--VAMPDERlGeRVCAVVVPAPGASLTLAELTEH 401
                       490       500       510
                ....*....|....*....|....*....|....*.
gi 62955443 569 L-EKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRR 603
Cdd:cd05903 402 LaAQGLAKQKWPERLEVVDALPRTPSGKVQKFELRE 437
PRK12583 PRK12583
acyl-CoA synthetase; Provisional
75-602 2.48e-24

acyl-CoA synthetase; Provisional


Pssm-ID: 237145  Cd Length: 558  Bit Score: 107.55  E-value: 2.48e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443   75 TVPKLFAKSVKKYGNKTALIFEGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGveAA 154
Cdd:PRK12583  19 TIGDAFDATVARFPDREALVVRHQALRYTWRQLADAVDRLARGLLALGVQPGDRVGIWAPNCAEWLLTQFATARIG--AI 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  155 LINFN--LRLEALVHCVNISSAKAVVF-----GSE----LTEAMCEVHSSMgktvklfvSGEWDPKRVP----------V 213
Cdd:PRK12583  97 LVNINpaYRASELEYALGQSGVRWVICadafkTSDyhamLQELLPGLAEGQ--------PGALACERLPelrgvvslapA 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  214 GTEHL---DPLLETTSTIQP-----KQPDRSFTDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDC 285
Cdd:PRK12583 169 PPPGFlawHELQARGETVSRealaeRQASLDRDDPINIQYTSGTTGFPKGATLSHHNILNNGYFVAESLGLTEHDRLCVP 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  286 LPLYHSAGNIVGIGQGLIHGMTVVI-RKKFSASKFWDDCIKYNCTIVQ-----YIGEicrylLNQPRKDTERKHKVR--- 356
Cdd:PRK12583 249 VPLYHCFGMVLANLGCMTVGACLVYpNEAFDPLATLQAVEEERCTALYgvptmFIAE-----LDHPQRGNFDLSSLRtgi 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  357 MALGNGLRQsIWEEFTNRFNVPQIAEFYGATECN------CSLGNFDNKTGACGfnsRILPYVYpirlVKVDEetmelir 430
Cdd:PRK12583 324 MAGAPCPIE-VMRRVMDEMHMAEVQIAYGMTETSpvslqtTAADDLERRVETVG---RTQPHLE----VKVVD------- 388
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  431 gPDGVCIPcgPGEPGQLVGR---IIQndplrrfdGYVNQ-TATNKKIAQDvfkkgdsAYL-SGDVLVMDDFGYMYFRDRT 505
Cdd:PRK12583 389 -PDGATVP--RGEIGELCTRgysVMK--------GYWNNpEATAESIDED-------GWMhTGDLATMDEQGYVRIVGRS 450
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62955443  506 GDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGV--EVPGAEGKA------GMAAIADpenntDLAKFSRDlekALPPYA 577
Cdd:PRK12583 451 KDMIIRGGENIYPREIEEFLFTHPAVADVQVFGVpdEKYGEEIVAwvrlhpGHAASEE-----ELREFCKA---RIAHFK 522
                        570       580
                 ....*....|....*....|....*
gi 62955443  578 RPVFLRFLPEVDKTGTF