NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|56786138|ref|NP_000610|]
View 

interferon gamma precursor [Homo sapiens]

Protein Classification

IFN-gamma domain-containing protein (domain architecture ID 10464985)

IFN-gamma domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IFN-gamma pfam00714
Interferon gamma;
15-152 1.04e-78

Interferon gamma;


:

Pssm-ID: 279103  Cd Length: 138  Bit Score: 232.60  E-value: 1.04e-78
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56786138    15 VLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVE 94
Cdd:pfam00714   1 ILGSSGCYCQATFFKEIENLKNYFNASSSDVADGGSLFLDILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQKSMD 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 56786138    95 TIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKR 152
Cdd:pfam00714  81 TIKEDLIVKFFNSSSSKLDDFQKLIQISVNDLQVQRKAISELIKVMNDLSPKSNLRKR 138
 
Name Accession Description Interval E-value
IFN-gamma pfam00714
Interferon gamma;
15-152 1.04e-78

Interferon gamma;


Pssm-ID: 279103  Cd Length: 138  Bit Score: 232.60  E-value: 1.04e-78
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56786138    15 VLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVE 94
Cdd:pfam00714   1 ILGSSGCYCQATFFKEIENLKNYFNASSSDVADGGSLFLDILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQKSMD 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 56786138    95 TIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKR 152
Cdd:pfam00714  81 TIKEDLIVKFFNSSSSKLDDFQKLIQISVNDLQVQRKAISELIKVMNDLSPKSNLRKR 138
 
Name Accession Description Interval E-value
IFN-gamma pfam00714
Interferon gamma;
15-152 1.04e-78

Interferon gamma;


Pssm-ID: 279103  Cd Length: 138  Bit Score: 232.60  E-value: 1.04e-78
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56786138    15 VLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVE 94
Cdd:pfam00714   1 ILGSSGCYCQATFFKEIENLKNYFNASSSDVADGGSLFLDILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQKSMD 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 56786138    95 TIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKR 152
Cdd:pfam00714  81 TIKEDLIVKFFNSSSSKLDDFQKLIQISVNDLQVQRKAISELIKVMNDLSPKSNLRKR 138
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH