NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|55600522|ref|XP_525866|]
View 

PREDICTED: interleukin-1 alpha [Pan troglodytes]

Protein Classification

IL1_propep and IL1 domain-containing protein (domain architecture ID 10493286)

IL1_propep and IL1 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IL1 smart00125
Interleukin-1 homologues; Cytokines with various biological functions. Interluekin 1 alpha and ...
129-267 6.87e-62

Interleukin-1 homologues; Cytokines with various biological functions. Interluekin 1 alpha and beta are also known as hematopoietin and catabolin.


:

Pssm-ID: 128430  Cd Length: 147  Bit Score: 195.29  E-value: 6.87e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55600522    129 IIKYEFILNDAlNQSIIR-ANDQYLTAAALH--NLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDE-DQPVLL 204
Cdd:smart00125   1 VISQECRLNDA-NQKSLVlSNPQYLKALHLNgqNLNQEVKFDMSFVQGEEDDSKIPVTLGISGTNLYLSCVKKgDEPTLQ 79
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 55600522    205 KEMPEIPKTITgSETNLLFFWETH--GTKNYFTSVAHPNLFIATKQDYW--VCLAGGPPS--ITDFQIL 267
Cdd:smart00125  80 LEMVDPPKYPK-KEMEKRFVFEKHeiGNKVEFESAAHPNWFISTSQEEDkpVFLGNGPPSqdITDFQME 147
IL1_propep pfam02394
Interleukin-1 propeptide; The Interleukin-1 cytokines are translated as precursor proteins. ...
1-107 1.92e-42

Interleukin-1 propeptide; The Interleukin-1 cytokines are translated as precursor proteins. The N terminal approx. 115 amino acids form a propeptide that is cleaved off to release the active interleukin-1.


:

Pssm-ID: 308158  Cd Length: 102  Bit Score: 143.58  E-value: 1.92e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55600522     1 MAKVPDMFEDLKNCY-SENEEDSSSIDHLSLNqKSFYHVSYGPlhegCMDQSVSLSISETSKTSklTFKESMVVVATNgK 79
Cdd:pfam02394   1 MAKVPELFEDLMACYsSENDLFFEADGPLSLK-KSFQDLDLCS----CMDKGIQLQISEQSKNK--SFKESVVVVVAV-E 72
                          90       100
                  ....*....|....*....|....*...
gi 55600522    80 VLKKRRLSLSQSITDDDLEAIANDSEEE 107
Cdd:pfam02394  73 KLKKRRLSCSQPFQDDDLEAIFSDIFEE 100
 
Name Accession Description Interval E-value
IL1 smart00125
Interleukin-1 homologues; Cytokines with various biological functions. Interluekin 1 alpha and ...
129-267 6.87e-62

Interleukin-1 homologues; Cytokines with various biological functions. Interluekin 1 alpha and beta are also known as hematopoietin and catabolin.


Pssm-ID: 128430  Cd Length: 147  Bit Score: 195.29  E-value: 6.87e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55600522    129 IIKYEFILNDAlNQSIIR-ANDQYLTAAALH--NLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDE-DQPVLL 204
Cdd:smart00125   1 VISQECRLNDA-NQKSLVlSNPQYLKALHLNgqNLNQEVKFDMSFVQGEEDDSKIPVTLGISGTNLYLSCVKKgDEPTLQ 79
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 55600522    205 KEMPEIPKTITgSETNLLFFWETH--GTKNYFTSVAHPNLFIATKQDYW--VCLAGGPPS--ITDFQIL 267
Cdd:smart00125  80 LEMVDPPKYPK-KEMEKRFVFEKHeiGNKVEFESAAHPNWFISTSQEEDkpVFLGNGPPSqdITDFQME 147
IL1 cd00100
Interleukin-1 homologes; Cytokines with various biological functions. Interleukin 1 alpha and ...
133-267 2.25e-58

Interleukin-1 homologes; Cytokines with various biological functions. Interleukin 1 alpha and beta are also known as hematopoietin and catabolin. This family also contains interleukin-1 receptor antagonists (inhibitors).


Pssm-ID: 238048  Cd Length: 144  Bit Score: 186.10  E-value: 2.25e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55600522 133 EFILNDALNQSIIRANDQYLTAAALH--NLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDE--DQPVLLKEMP 208
Cdd:cd00100   1 EFRLNDANQKSLVLSNPQYLKAAHLQgqNLNLEVKFDMSFYQGEESDSKIPVTLGISKTNLYLSCVKEgdDPPLQLEEVP 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 55600522 209 E---IPKTITgsETNLLFFWETHGTKNYFTSVAHPNLFIATKQ--DYWVCLAGGP--PSITDFQIL 267
Cdd:cd00100  81 PkdyPKKKIT--EKRFVFFWEEIGNKNYFESAAFPNWFIATKQeeDKPVFLANGPggPSITDFQIQ 144
IL1_propep pfam02394
Interleukin-1 propeptide; The Interleukin-1 cytokines are translated as precursor proteins. ...
1-107 1.92e-42

Interleukin-1 propeptide; The Interleukin-1 cytokines are translated as precursor proteins. The N terminal approx. 115 amino acids form a propeptide that is cleaved off to release the active interleukin-1.


Pssm-ID: 308158  Cd Length: 102  Bit Score: 143.58  E-value: 1.92e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55600522     1 MAKVPDMFEDLKNCY-SENEEDSSSIDHLSLNqKSFYHVSYGPlhegCMDQSVSLSISETSKTSklTFKESMVVVATNgK 79
Cdd:pfam02394   1 MAKVPELFEDLMACYsSENDLFFEADGPLSLK-KSFQDLDLCS----CMDKGIQLQISEQSKNK--SFKESVVVVVAV-E 72
                          90       100
                  ....*....|....*....|....*...
gi 55600522    80 VLKKRRLSLSQSITDDDLEAIANDSEEE 107
Cdd:pfam02394  73 KLKKRRLSCSQPFQDDDLEAIFSDIFEE 100
IL1 pfam00340
Interleukin-1 / 18; This family includes interleukin-1 and interleukin-18.
161-265 3.55e-41

Interleukin-1 / 18; This family includes interleukin-1 and interleukin-18.


Pssm-ID: 278755  Cd Length: 113  Bit Score: 140.66  E-value: 3.55e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55600522   161 DEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDE-DQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNY--FTSV 237
Cdd:pfam00340   1 NLEVKFDMSFYKGESDDSKIPVTLGIKGKKLYLSCVKEgDKPVLQLEEVEIPKLIPNKESDKRFFFIKSESKNYvkFESA 80
                          90       100       110
                  ....*....|....*....|....*....|...
gi 55600522   238 AHPNLFIATKQD-----YWVCLAGGPPSITDFQ 265
Cdd:pfam00340  81 AYPGWFLATKQEedlpvLLLNTAGGQDSITDFQ 113
 
Name Accession Description Interval E-value
IL1 smart00125
Interleukin-1 homologues; Cytokines with various biological functions. Interluekin 1 alpha and ...
129-267 6.87e-62

Interleukin-1 homologues; Cytokines with various biological functions. Interluekin 1 alpha and beta are also known as hematopoietin and catabolin.


Pssm-ID: 128430  Cd Length: 147  Bit Score: 195.29  E-value: 6.87e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55600522    129 IIKYEFILNDAlNQSIIR-ANDQYLTAAALH--NLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDE-DQPVLL 204
Cdd:smart00125   1 VISQECRLNDA-NQKSLVlSNPQYLKALHLNgqNLNQEVKFDMSFVQGEEDDSKIPVTLGISGTNLYLSCVKKgDEPTLQ 79
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 55600522    205 KEMPEIPKTITgSETNLLFFWETH--GTKNYFTSVAHPNLFIATKQDYW--VCLAGGPPS--ITDFQIL 267
Cdd:smart00125  80 LEMVDPPKYPK-KEMEKRFVFEKHeiGNKVEFESAAHPNWFISTSQEEDkpVFLGNGPPSqdITDFQME 147
IL1 cd00100
Interleukin-1 homologes; Cytokines with various biological functions. Interleukin 1 alpha and ...
133-267 2.25e-58

Interleukin-1 homologes; Cytokines with various biological functions. Interleukin 1 alpha and beta are also known as hematopoietin and catabolin. This family also contains interleukin-1 receptor antagonists (inhibitors).


Pssm-ID: 238048  Cd Length: 144  Bit Score: 186.10  E-value: 2.25e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55600522 133 EFILNDALNQSIIRANDQYLTAAALH--NLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDE--DQPVLLKEMP 208
Cdd:cd00100   1 EFRLNDANQKSLVLSNPQYLKAAHLQgqNLNLEVKFDMSFYQGEESDSKIPVTLGISKTNLYLSCVKEgdDPPLQLEEVP 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 55600522 209 E---IPKTITgsETNLLFFWETHGTKNYFTSVAHPNLFIATKQ--DYWVCLAGGP--PSITDFQIL 267
Cdd:cd00100  81 PkdyPKKKIT--EKRFVFFWEEIGNKNYFESAAFPNWFIATKQeeDKPVFLANGPggPSITDFQIQ 144
IL1_propep pfam02394
Interleukin-1 propeptide; The Interleukin-1 cytokines are translated as precursor proteins. ...
1-107 1.92e-42

Interleukin-1 propeptide; The Interleukin-1 cytokines are translated as precursor proteins. The N terminal approx. 115 amino acids form a propeptide that is cleaved off to release the active interleukin-1.


Pssm-ID: 308158  Cd Length: 102  Bit Score: 143.58  E-value: 1.92e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55600522     1 MAKVPDMFEDLKNCY-SENEEDSSSIDHLSLNqKSFYHVSYGPlhegCMDQSVSLSISETSKTSklTFKESMVVVATNgK 79
Cdd:pfam02394   1 MAKVPELFEDLMACYsSENDLFFEADGPLSLK-KSFQDLDLCS----CMDKGIQLQISEQSKNK--SFKESVVVVVAV-E 72
                          90       100
                  ....*....|....*....|....*...
gi 55600522    80 VLKKRRLSLSQSITDDDLEAIANDSEEE 107
Cdd:pfam02394  73 KLKKRRLSCSQPFQDDDLEAIFSDIFEE 100
IL1 pfam00340
Interleukin-1 / 18; This family includes interleukin-1 and interleukin-18.
161-265 3.55e-41

Interleukin-1 / 18; This family includes interleukin-1 and interleukin-18.


Pssm-ID: 278755  Cd Length: 113  Bit Score: 140.66  E-value: 3.55e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55600522   161 DEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDE-DQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNY--FTSV 237
Cdd:pfam00340   1 NLEVKFDMSFYKGESDDSKIPVTLGIKGKKLYLSCVKEgDKPVLQLEEVEIPKLIPNKESDKRFFFIKSESKNYvkFESA 80
                          90       100       110
                  ....*....|....*....|....*....|...
gi 55600522   238 AHPNLFIATKQD-----YWVCLAGGPPSITDFQ 265
Cdd:pfam00340  81 AYPGWFLATKQEedlpvLLLNTAGGQDSITDFQ 113
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH