NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|53793688|ref|NP_001005464|]
View 

histone H3.2 [Homo sapiens]

Protein Classification

PTZ00018 family protein (domain architecture ID 10794185)

PTZ00018 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PTZ00018 PTZ00018
histone H3; Provisional
1-136 1.33e-88

histone H3; Provisional


:

Pssm-ID: 185400  Cd Length: 136  Bit Score: 257.53  E-value: 1.33e-88
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
Cdd:PTZ00018   1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 53793688   81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
Cdd:PTZ00018  81 TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERS 136
 
Name Accession Description Interval E-value
PTZ00018 PTZ00018
histone H3; Provisional
1-136 1.33e-88

histone H3; Provisional


Pssm-ID: 185400  Cd Length: 136  Bit Score: 257.53  E-value: 1.33e-88
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
Cdd:PTZ00018   1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 53793688   81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
Cdd:PTZ00018  81 TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERS 136
H3 smart00428
Histone H3;
34-136 5.11e-60

Histone H3;


Pssm-ID: 128705  Cd Length: 105  Bit Score: 183.80  E-value: 5.11e-60
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688     34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT--DLRFQSSAVMALQEASEAYLVGLFEDTNLC 111
Cdd:smart00428   1 GGKTKHRRYRPGQVALREIRKYQKSTDLLIRKAPFQRLVREIAQKFTTgvDLRFQSSAIMALQEAAEAYLVGLFEDTNLL 80
                           90       100
                   ....*....|....*....|....*
gi 53793688    112 AIHAKRVTIMPKDIQLARRIRGERA 136
Cdd:smart00428  81 AIHAKRVTIMPKDIQLARRIRGERL 105
Histone pfam00125
Core histone H2A/H2B/H3/H4;
1-132 8.51e-50

Core histone H2A/H2B/H3/H4;


Pssm-ID: 306605  Cd Length: 127  Bit Score: 158.34  E-value: 8.51e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPatggvKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
Cdd:pfam00125   1 MARNKQKANPETGGTAPPKTVSQKPSSKSII-----KKTRRYRPGTVALKEIRKYQKSTDLLIYKLPFARVVREIVKSSK 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 53793688    81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR 132
Cdd:pfam00125  76 TDLRISADAVVALQEALEDYLVELFEDANLLAKHAKRVTITPKDIQLARRLR 127
HHT1 COG2036
Archaeal histone H3/H4 [Chromatin structure and dynamics];
44-135 6.17e-29

Archaeal histone H3/H4 [Chromatin structure and dynamics];


Pssm-ID: 224947  Cd Length: 91  Bit Score: 103.56  E-value: 6.17e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688  44 PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDfktdlRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPK 123
Cdd:COG2036   1 PGAVGLKEIRRYQRSTDLLLPKAPVRRILRKAGAE-----RVSSSAIEELQEALEEYLEEIAEDAVELAEHAKRKTVKAE 75
                        90
                ....*....|..
gi 53793688 124 DIQLARRIRGER 135
Cdd:COG2036  76 DIKLALKRLGRR 87
 
Name Accession Description Interval E-value
PTZ00018 PTZ00018
histone H3; Provisional
1-136 1.33e-88

histone H3; Provisional


Pssm-ID: 185400  Cd Length: 136  Bit Score: 257.53  E-value: 1.33e-88
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
Cdd:PTZ00018   1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 53793688   81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
Cdd:PTZ00018  81 TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERS 136
PLN00121 PLN00121
histone H3; Provisional
1-136 4.05e-81

histone H3; Provisional


Pssm-ID: 177733  Cd Length: 136  Bit Score: 238.42  E-value: 4.05e-81
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
Cdd:PLN00121   1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFK 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 53793688   81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
Cdd:PLN00121  81 TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
H3 smart00428
Histone H3;
34-136 5.11e-60

Histone H3;


Pssm-ID: 128705  Cd Length: 105  Bit Score: 183.80  E-value: 5.11e-60
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688     34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT--DLRFQSSAVMALQEASEAYLVGLFEDTNLC 111
Cdd:smart00428   1 GGKTKHRRYRPGQVALREIRKYQKSTDLLIRKAPFQRLVREIAQKFTTgvDLRFQSSAIMALQEAAEAYLVGLFEDTNLL 80
                           90       100
                   ....*....|....*....|....*
gi 53793688    112 AIHAKRVTIMPKDIQLARRIRGERA 136
Cdd:smart00428  81 AIHAKRVTIMPKDIQLARRIRGERL 105
Histone pfam00125
Core histone H2A/H2B/H3/H4;
1-132 8.51e-50

Core histone H2A/H2B/H3/H4;


Pssm-ID: 306605  Cd Length: 127  Bit Score: 158.34  E-value: 8.51e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPatggvKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
Cdd:pfam00125   1 MARNKQKANPETGGTAPPKTVSQKPSSKSII-----KKTRRYRPGTVALKEIRKYQKSTDLLIYKLPFARVVREIVKSSK 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 53793688    81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR 132
Cdd:pfam00125  76 TDLRISADAVVALQEALEDYLVELFEDANLLAKHAKRVTITPKDIQLARRLR 127
PLN00161 PLN00161
histone H3; Provisional
1-133 1.76e-46

histone H3; Provisional


Pssm-ID: 215082  Cd Length: 135  Bit Score: 150.15  E-value: 1.76e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688    1 MARTKQtARKSTGGKAPRKQLATKAARKSApatggvKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80
Cdd:PLN00161   1 MARRLQ-GKRFRKGKKPQKEASGVTRQELD------KKPHRYRPGTVALREIRKYQKSTELLIRKLPFARLVREISNEML 73
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 53793688   81 TD-LRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 133
Cdd:PLN00161  74 REpFRWTAEALLALQEATEDFLVHLFEDCNLCAIHAKRVTIMPKDMQLARRIRG 127
PLN00160 PLN00160
histone H3; Provisional
43-134 1.09e-37

histone H3; Provisional


Pssm-ID: 165727  Cd Length: 97  Bit Score: 126.32  E-value: 1.09e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688   43 RPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF-KTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM 121
Cdd:PLN00160   2 RPGEKALKEIKMYQKSTDLLIRRLPFARLVREIQMEMsREAYRWQGSAILALQEAAEAHLVGLFEDSNLCAIHGKRVTIM 81
                         90
                 ....*....|...
gi 53793688  122 PKDIQLARRIRGE 134
Cdd:PLN00160  82 PKDMQLARRIRGQ 94
HHT1 COG2036
Archaeal histone H3/H4 [Chromatin structure and dynamics];
44-135 6.17e-29

Archaeal histone H3/H4 [Chromatin structure and dynamics];


Pssm-ID: 224947  Cd Length: 91  Bit Score: 103.56  E-value: 6.17e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53793688  44 PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDfktdlRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPK 123
Cdd:COG2036   1 PGAVGLKEIRRYQRSTDLLLPKAPVRRILRKAGAE-----RVSSSAIEELQEALEEYLEEIAEDAVELAEHAKRKTVKAE 75
                        90
                ....*....|..
gi 53793688 124 DIQLARRIRGER 135
Cdd:COG2036  76 DIKLALKRLGRR 87
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH