NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|53724505|ref|YP_104662|]
View 

methyl-accepting chemotaxis protein [Burkholderia mallei ATCC 23344]

Protein Classification

sCache_2 and MCP_signal domain-containing protein (domain architecture ID 12182667)

sCache_2 and MCP_signal domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCPsignal super family cl28165
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
159-478 1.81e-113

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


The actual alignment was detected with superfamily member PRK15041:

Pssm-ID: 332985  Cd Length: 554  Bit Score: 350.41  E-value: 1.81e-113
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  159 VFVIGLVITAAMLVIIR---NVRASLGGEPDEAASLAARIAAGDLTRPVAVragDGTSMM----AAMRDMQGRLRSTIGG 231
Cdd:PRK15041 193 MWILVGVMIVVLAVIFAvwfGIKASLVAPMNRLIDSIRHIAGGDLVKPIEV---DGSNEMgqlaESLRHMQGELMRTVGD 269
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  232 IRRAAESIAAASHEIASGNHDLSQRTEQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVVSRVIG 311
Cdd:PRK15041 270 VRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQ 349
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  312 TMGEINDSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLIDASVERVN 391
Cdd:PRK15041 350 TMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVD 429
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  392 NGSALVGQAGETMTEILQAVRRVTDIMGEIAAASEEQSSGISQVGRAVTQMDEMTQQNAALVEEAAAAASSLQEQAARLR 471
Cdd:PRK15041 430 VGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLT 509

                 ....*..
gi 53724505  472 ESVSAFQ 478
Cdd:PRK15041 510 EAVAVFR 516
sCache_2 pfam17200
Single Cache domain 2; This entry represents the single Cache domain 2 (sCache_2), which ...
1-151 1.52e-42

Single Cache domain 2; This entry represents the single Cache domain 2 (sCache_2), which contains the long N-terminal helix domain.


:

Pssm-ID: 319218  Cd Length: 152  Bit Score: 150.55  E-value: 1.52e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505     1 MLAERKEGMANLVDSAAGVVKAYYALAQSGKMSDEDARRDALERLAAMRYGD-SGYLFVMDSKPVVLMHPTLPKLVGTQV 79
Cdd:pfam17200   1 LIDQKKDELKNLVETAISLIEAVYKQVESGKITEEEAQELAKELVRALRYGDgKGYFFVYDSDGTMLVHPFNPQLEGKNL 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 53724505    80 GDYLDPDGKRLFVTILNAAKAGGHGFAEYRGRLPHSETAVPKISYVTRFAPWDWNISSGVFLKDIDTVYYET 151
Cdd:pfam17200  81 SNLKDANGKYFIRELIDTAKKAGGGFVDYLWKNPGEGAVEPKLAYVKYFPPWDWVIGTGSYLDDINKRVESI 152
 
Name Accession Description Interval E-value
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
159-478 1.81e-113

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 350.41  E-value: 1.81e-113
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  159 VFVIGLVITAAMLVIIR---NVRASLGGEPDEAASLAARIAAGDLTRPVAVragDGTSMM----AAMRDMQGRLRSTIGG 231
Cdd:PRK15041 193 MWILVGVMIVVLAVIFAvwfGIKASLVAPMNRLIDSIRHIAGGDLVKPIEV---DGSNEMgqlaESLRHMQGELMRTVGD 269
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  232 IRRAAESIAAASHEIASGNHDLSQRTEQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVVSRVIG 311
Cdd:PRK15041 270 VRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQ 349
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  312 TMGEINDSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLIDASVERVN 391
Cdd:PRK15041 350 TMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVD 429
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  392 NGSALVGQAGETMTEILQAVRRVTDIMGEIAAASEEQSSGISQVGRAVTQMDEMTQQNAALVEEAAAAASSLQEQAARLR 471
Cdd:PRK15041 430 VGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLT 509

                 ....*..
gi 53724505  472 ESVSAFQ 478
Cdd:PRK15041 510 EAVAVFR 516
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
232-478 4.41e-72

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 232.95  E-value: 4.41e-72
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505    232 IRRAAESIAAASHEIASGNHDLSQRTEQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVVSRVIG 311
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505    312 TMGEINDSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLI-------- 383
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIkeiqeetn 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505    384 ------DASVERVNNGSALVGQAGETMTEILQAVRRVTDIMGEIAAASEEQSSGISQVGRAVTQMDEMTQQNAALVEEAA 457
Cdd:smart00283 162 eavaamEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|.
gi 53724505    458 AAASSLQEQAARLRESVSAFQ 478
Cdd:smart00283 242 AAAEELSGLAEELDELVERFK 262
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
156-478 2.23e-71

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 236.04  E-value: 2.23e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 156 LAVVFVIGLVITAAMLVIIRNVRASLGGEPDEAASLAARIAAGDLTRPVAVRAGDGTSMMA-AMRDMQGRLRSTIGGIRR 234
Cdd:COG0840  59 LKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAkSFNEMILNLRQIIDAVQD 138
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 235 AAESIAAASHEIASGNHDLSQRTEQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVVSRVIGTMG 314
Cdd:COG0840 139 NAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQ 218
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 315 EIN-----------DSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLI 383
Cdd:COG0840 219 EIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLI 298
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 384 --------------DASVERVNNGSALVGQAGETMTEILQAVRRVTDIMGEIAAASEEQSSGISQVGRAVTQMDEMTQQN 449
Cdd:COG0840 299 eeiqneaadavehmEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQEN 378
                       330       340
                ....*....|....*....|....*....
gi 53724505 450 AALVEEAAAAASSLQEQAARLRESVSAFQ 478
Cdd:COG0840 379 AAAVEELAAASEELKELAEKLLELVAKFK 407
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
258-449 2.47e-58

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 194.76  E-value: 2.47e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 258 EQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVVSRVIGTMGEINDSSRKIADIIGVIDGIAFQT 337
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 338 NILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLIDASVERVNNGSALVGQAGETMTEILQAVRRVTDI 417
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190
                ....*....|....*....|....*....|..
gi 53724505 418 MGEIAAASEEQSSGISQVGRAVTQMDEMTQQN 449
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEI 192
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
282-477 3.22e-58

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 194.59  E-value: 3.22e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505   282 AENARQASGlanNASEIALKGNDVVSRVIGTMGEINDSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVV 361
Cdd:pfam00015   1 SDLAQLASE---EALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVV 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505   362 AGEVRSLAQRSATAAKEIKQLIDASVERVN--------------NGSALVGQAGETMTEILQAVRRVTDIMGEIAAASEE 427
Cdd:pfam00015  78 ADEVRKLAERSAQAAKEIEALIEEIVKQTNdstasiqqtrteveVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDE 157
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|
gi 53724505   428 QSSGISQVGRAVTQMDEMTQQNAALVEEAAAAASSLQEQAARLRESVSAF 477
Cdd:pfam00015 158 QSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
sCache_2 pfam17200
Single Cache domain 2; This entry represents the single Cache domain 2 (sCache_2), which ...
1-151 1.52e-42

Single Cache domain 2; This entry represents the single Cache domain 2 (sCache_2), which contains the long N-terminal helix domain.


Pssm-ID: 319218  Cd Length: 152  Bit Score: 150.55  E-value: 1.52e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505     1 MLAERKEGMANLVDSAAGVVKAYYALAQSGKMSDEDARRDALERLAAMRYGD-SGYLFVMDSKPVVLMHPTLPKLVGTQV 79
Cdd:pfam17200   1 LIDQKKDELKNLVETAISLIEAVYKQVESGKITEEEAQELAKELVRALRYGDgKGYFFVYDSDGTMLVHPFNPQLEGKNL 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 53724505    80 GDYLDPDGKRLFVTILNAAKAGGHGFAEYRGRLPHSETAVPKISYVTRFAPWDWNISSGVFLKDIDTVYYET 151
Cdd:pfam17200  81 SNLKDANGKYFIRELIDTAKKAGGGFVDYLWKNPGEGAVEPKLAYVKYFPPWDWVIGTGSYLDDINKRVESI 152
Cache_2 smart01049
Cache is an extracellular domain that is predicted to have a role in small-molecule ...
1-91 1.54e-30

Cache is an extracellular domain that is predicted to have a role in small-molecule recognition in a wide range of proteins; Members include the animal dihydropyridine-sensitive voltage-gated Ca2+ channel; alpha-2delta subunit, and various bacterial chemotaxis receptors. The name Cache comes from CAlcium channels and CHEmotaxis receptors. This domain consists of an N-terminal part with three predicted strands and an alpha-helix, and a C-terminal part with a strand dyad followed by a relatively unstructured region. The N-terminal portion of the (unpermuted) Cache domain contains three predicted strands that could form a sheet analogous to that present in the core of the PAS domain structure. Cache domains are particularly widespread in bacteria, with Vibrio cholerae. The animal calcium channel alpha-2delta subunits might have acquired a part of their extracellular domains from a bacterial source. The Cache domain appears to have arisen from the GAF-PAS fold despite their divergent functions.


Pssm-ID: 214995  Cd Length: 91  Bit Score: 115.04  E-value: 1.54e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505      1 MLAERKEGMANLVDSAAGVVKAYYALAQSGKMSDEDARRDALERLAAMRYGDSGYLFVMDSKPVVLMHPTLPKLVGTQVG 80
Cdd:smart01049   1 LLEERKAELKNLVEIAVSIVEAYYAQAAAGKLTEEEAQAQAKAALRALRYGGDGYFFVYDSDGVMLMHPAKPELEGKNLS 80
                           90
                   ....*....|.
gi 53724505     81 DYLDPDGKRLF 91
Cdd:smart01049  81 DLKDPNGKYLF 91
COG4564 COG4564
Signal transduction histidine kinase [Signal transduction mechanisms];
1-144 3.40e-21

Signal transduction histidine kinase [Signal transduction mechanisms];


Pssm-ID: 226930  Cd Length: 459  Bit Score: 96.05  E-value: 3.40e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505   1 MLAERKEGMANLVDSAAGVVKAYYAlaqSGKMSDEDARRDALERLAAMRYGDSGYLFVMDSKPVVLMHPTLPKLVGTQVG 80
Cdd:COG4564  45 MLEAKETELLNLVNLALSAIRLVYN---NAGPSDEAAKQEVKAILTNLDYGSDGYFFVYDYQGTNLVHPRQPELVGQNLW 121
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 53724505  81 DYLDPDGKRLFVTILNAAKAGGhGFAEYRGRLPHSETAVPKISYVTRFAPWDWNISSGVFLKDI 144
Cdd:COG4564 122 QLTDPRGDRVIQALIAKAQEGG-GLHQYLWEKPSSHETVDKLSYAAGLDKWEWMIGTGLYLDDV 184
 
Name Accession Description Interval E-value
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
159-478 1.81e-113

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 350.41  E-value: 1.81e-113
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  159 VFVIGLVITAAMLVIIR---NVRASLGGEPDEAASLAARIAAGDLTRPVAVragDGTSMM----AAMRDMQGRLRSTIGG 231
Cdd:PRK15041 193 MWILVGVMIVVLAVIFAvwfGIKASLVAPMNRLIDSIRHIAGGDLVKPIEV---DGSNEMgqlaESLRHMQGELMRTVGD 269
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  232 IRRAAESIAAASHEIASGNHDLSQRTEQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVVSRVIG 311
Cdd:PRK15041 270 VRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQ 349
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  312 TMGEINDSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLIDASVERVN 391
Cdd:PRK15041 350 TMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVD 429
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  392 NGSALVGQAGETMTEILQAVRRVTDIMGEIAAASEEQSSGISQVGRAVTQMDEMTQQNAALVEEAAAAASSLQEQAARLR 471
Cdd:PRK15041 430 VGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLT 509

                 ....*..
gi 53724505  472 ESVSAFQ 478
Cdd:PRK15041 510 EAVAVFR 516
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
161-478 2.55e-112

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 347.38  E-value: 2.55e-112
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  161 VIGLVITAAMLVIIRNVRASLGGEPDEAASLAARIAAGDLTRPVAVRAGDGTSMMAAMRD-MQGRLRSTIGGIRRAAESI 239
Cdd:PRK15048 196 VIALVVVLILLVAWYGIRRMLLTPLAKIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVShMQRSLTDTVTHVREGSDAI 275
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  240 AAASHEIASGNHDLSQRTEQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVVSRVIGTMGEINDS 319
Cdd:PRK15048 276 YAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADS 355
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  320 SRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLIDASVERVNNGSALVGQ 399
Cdd:PRK15048 356 SKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVES 435
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 53724505  400 AGETMTEILQAVRRVTDIMGEIAAASEEQSSGISQVGRAVTQMDEMTQQNAALVEEAAAAASSLQEQAARLRESVSAFQ 478
Cdd:PRK15048 436 AGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFR 514
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
198-477 5.97e-104

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 325.10  E-value: 5.97e-104
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  198 GDLTRPVAVRA-GDGTSMMAAMRDMQGRLRSTIGGIRRAAESIAAASHEIASGNHDLSQRTEQQAASLEETAASMEELTA 276
Cdd:PRK09793 231 GNLARPIAVYGrNEITAIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTA 310
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  277 TVKQNAENARQASGLANNASEIALKGNDVVSRVIGTMGEINDSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGR 356
Cdd:PRK09793 311 TVGQNADNARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGR 390
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505  357 GFAVVAGEVRSLAQRSATAAKEIKQLIDASVERVNNGSALVGQAGETMTEILQAVRRVTDIMGEIAAASEEQSSGISQVG 436
Cdd:PRK09793 391 GFAVVAGEVRNLASRSAQAAKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVA 470
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 53724505  437 RAVTQMDEMTQQNAALVEEAAAAASSLQEQAARLRESVSAF 477
Cdd:PRK09793 471 QAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSRVAVF 511
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
232-478 4.41e-72

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 232.95  E-value: 4.41e-72
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505    232 IRRAAESIAAASHEIASGNHDLSQRTEQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVVSRVIG 311
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505    312 TMGEINDSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLI-------- 383
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIkeiqeetn 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505    384 ------DASVERVNNGSALVGQAGETMTEILQAVRRVTDIMGEIAAASEEQSSGISQVGRAVTQMDEMTQQNAALVEEAA 457
Cdd:smart00283 162 eavaamEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|.
gi 53724505    458 AAASSLQEQAARLRESVSAFQ 478
Cdd:smart00283 242 AAAEELSGLAEELDELVERFK 262
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
156-478 2.23e-71

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 236.04  E-value: 2.23e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 156 LAVVFVIGLVITAAMLVIIRNVRASLGGEPDEAASLAARIAAGDLTRPVAVRAGDGTSMMA-AMRDMQGRLRSTIGGIRR 234
Cdd:COG0840  59 LKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAkSFNEMILNLRQIIDAVQD 138
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 235 AAESIAAASHEIASGNHDLSQRTEQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVVSRVIGTMG 314
Cdd:COG0840 139 NAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQ 218
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 315 EIN-----------DSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLI 383
Cdd:COG0840 219 EIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLI 298
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 384 --------------DASVERVNNGSALVGQAGETMTEILQAVRRVTDIMGEIAAASEEQSSGISQVGRAVTQMDEMTQQN 449
Cdd:COG0840 299 eeiqneaadavehmEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQEN 378
                       330       340
                ....*....|....*....|....*....
gi 53724505 450 AALVEEAAAAASSLQEQAARLRESVSAFQ 478
Cdd:COG0840 379 AAAVEELAAASEELKELAEKLLELVAKFK 407
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
258-449 2.47e-58

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 194.76  E-value: 2.47e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 258 EQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVVSRVIGTMGEINDSSRKIADIIGVIDGIAFQT 337
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505 338 NILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLIDASVERVNNGSALVGQAGETMTEILQAVRRVTDI 417
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190
                ....*....|....*....|....*....|..
gi 53724505 418 MGEIAAASEEQSSGISQVGRAVTQMDEMTQQN 449
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEI 192
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
282-477 3.22e-58

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 194.59  E-value: 3.22e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505   282 AENARQASGlanNASEIALKGNDVVSRVIGTMGEINDSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVV 361
Cdd:pfam00015   1 SDLAQLASE---EALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVV 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505   362 AGEVRSLAQRSATAAKEIKQLIDASVERVN--------------NGSALVGQAGETMTEILQAVRRVTDIMGEIAAASEE 427
Cdd:pfam00015  78 ADEVRKLAERSAQAAKEIEALIEEIVKQTNdstasiqqtrteveVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDE 157
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|
gi 53724505   428 QSSGISQVGRAVTQMDEMTQQNAALVEEAAAAASSLQEQAARLRESVSAF 477
Cdd:pfam00015 158 QSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
sCache_2 pfam17200
Single Cache domain 2; This entry represents the single Cache domain 2 (sCache_2), which ...
1-151 1.52e-42

Single Cache domain 2; This entry represents the single Cache domain 2 (sCache_2), which contains the long N-terminal helix domain.


Pssm-ID: 319218  Cd Length: 152  Bit Score: 150.55  E-value: 1.52e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505     1 MLAERKEGMANLVDSAAGVVKAYYALAQSGKMSDEDARRDALERLAAMRYGD-SGYLFVMDSKPVVLMHPTLPKLVGTQV 79
Cdd:pfam17200   1 LIDQKKDELKNLVETAISLIEAVYKQVESGKITEEEAQELAKELVRALRYGDgKGYFFVYDSDGTMLVHPFNPQLEGKNL 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 53724505    80 GDYLDPDGKRLFVTILNAAKAGGHGFAEYRGRLPHSETAVPKISYVTRFAPWDWNISSGVFLKDIDTVYYET 151
Cdd:pfam17200  81 SNLKDANGKYFIRELIDTAKKAGGGFVDYLWKNPGEGAVEPKLAYVKYFPPWDWVIGTGSYLDDINKRVESI 152
Cache_2 smart01049
Cache is an extracellular domain that is predicted to have a role in small-molecule ...
1-91 1.54e-30

Cache is an extracellular domain that is predicted to have a role in small-molecule recognition in a wide range of proteins; Members include the animal dihydropyridine-sensitive voltage-gated Ca2+ channel; alpha-2delta subunit, and various bacterial chemotaxis receptors. The name Cache comes from CAlcium channels and CHEmotaxis receptors. This domain consists of an N-terminal part with three predicted strands and an alpha-helix, and a C-terminal part with a strand dyad followed by a relatively unstructured region. The N-terminal portion of the (unpermuted) Cache domain contains three predicted strands that could form a sheet analogous to that present in the core of the PAS domain structure. Cache domains are particularly widespread in bacteria, with Vibrio cholerae. The animal calcium channel alpha-2delta subunits might have acquired a part of their extracellular domains from a bacterial source. The Cache domain appears to have arisen from the GAF-PAS fold despite their divergent functions.


Pssm-ID: 214995  Cd Length: 91  Bit Score: 115.04  E-value: 1.54e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505      1 MLAERKEGMANLVDSAAGVVKAYYALAQSGKMSDEDARRDALERLAAMRYGDSGYLFVMDSKPVVLMHPTLPKLVGTQVG 80
Cdd:smart01049   1 LLEERKAELKNLVEIAVSIVEAYYAQAAAGKLTEEEAQAQAKAALRALRYGGDGYFFVYDSDGVMLMHPAKPELEGKNLS 80
                           90
                   ....*....|.
gi 53724505     81 DYLDPDGKRLF 91
Cdd:smart01049  81 DLKDPNGKYLF 91
dCache_2 pfam08269
Cache domain; Double Cache domain 2 (dCache_2) may be a result of single Cache domain 2 ...
3-146 1.59e-30

Cache domain; Double Cache domain 2 (dCache_2) may be a result of single Cache domain 2 (sCache_2) duplication.


Pssm-ID: 311945  Cd Length: 296  Bit Score: 120.53  E-value: 1.59e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505     3 AERKEGMANLVDSAAGVVKAYYALaQSGKMSDEDARRDALERLAAMRY-GDSGYLFVMDSKPVVLMHPTLPKLVGTQVGD 81
Cdd:pfam08269  44 ESLKESLKSRVEEAYSIAESIYEK-YKNKLSEEEIKKLIKEALRSIRYnGGTGYYFIIDSKGTLILHPDSPSLEGKNLLD 122
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 53724505    82 YLDPDGKRLFVTILNAAKAGGHGFAEYRGRLPhSETAVPKISYVTRFAPWDWNISSGVFLKDIDT 146
Cdd:pfam08269 123 LKDKNGRYIIREMIKLARKKGEGFVEYLWPKP-PKTPYKKISYVKYFEPYDWIIGTGAYLDDIEE 186
dCache_2 pfam08269
Cache domain; Double Cache domain 2 (dCache_2) may be a result of single Cache domain 2 ...
35-145 1.80e-28

Cache domain; Double Cache domain 2 (dCache_2) may be a result of single Cache domain 2 (sCache_2) duplication.


Pssm-ID: 311945  Cd Length: 296  Bit Score: 114.76  E-value: 1.80e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505    35 EDARRDALERLAAMRYGDSGYLFVMDSKPVVLMHPTLPKLVGTQVGDYLDPDGKRLFVTILNAAKAGGHGFAEYRGRLPH 114
Cdd:pfam08269 186 EELKQELLKQLASIRYGNNGYFFIYDTDGNMILHPLKPELDGKNLTDVKDKKGVEIFQELLDAAKKGGEGFVTYKWPKPG 265
                          90       100       110
                  ....*....|....*....|....*....|.
gi 53724505   115 SETAVPKISYVTRFAPWDWNISSGVFLKDID 145
Cdd:pfam08269 266 GDKPRPKISYVRYFPPWGWIIGTGVYLDEIE 296
COG4564 COG4564
Signal transduction histidine kinase [Signal transduction mechanisms];
1-144 3.40e-21

Signal transduction histidine kinase [Signal transduction mechanisms];


Pssm-ID: 226930  Cd Length: 459  Bit Score: 96.05  E-value: 3.40e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505   1 MLAERKEGMANLVDSAAGVVKAYYAlaqSGKMSDEDARRDALERLAAMRYGDSGYLFVMDSKPVVLMHPTLPKLVGTQVG 80
Cdd:COG4564  45 MLEAKETELLNLVNLALSAIRLVYN---NAGPSDEAAKQEVKAILTNLDYGSDGYFFVYDYQGTNLVHPRQPELVGQNLW 121
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 53724505  81 DYLDPDGKRLFVTILNAAKAGGhGFAEYRGRLPHSETAVPKISYVTRFAPWDWNISSGVFLKDI 144
Cdd:COG4564 122 QLTDPRGDRVIQALIAKAQEGG-GLHQYLWEKPSSHETVDKLSYAAGLDKWEWMIGTGLYLDDV 184
Cache_3-Cache_2 pfam17201
Cache 3/Cache 2 fusion domain; The Cache_3-Cache_2 domain likely originated as a fusion of ...
34-145 8.24e-10

Cache 3/Cache 2 fusion domain; The Cache_3-Cache_2 domain likely originated as a fusion of sCache_3 and sCache_2 domains.


Pssm-ID: 319219  Cd Length: 291  Bit Score: 59.64  E-value: 8.24e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505    34 DEDARRDALER-LAAMRYGDSGYLFVMDSKP----VVLMHPTLPklvGTQVGDylDPDGKRLFVTILNAAKAGghgFAEY 108
Cdd:pfam17201 176 DQSEILASLRKaIGKAKIGKTGYLYVLDGKGdekgKFIIHPTLK---GKNLLD--DADGQRDFVKKMLAKKDG---SLEY 247
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 53724505   109 RgrLPHSETAVPKISYVTRFAPWDWNISSGVFLKDID 145
Cdd:pfam17201 248 T--WKDDAKGREKIAVFTYFEPWDWVIVASVYEDEFL 282
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
227-308 7.30e-04

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 41.12  E-value: 7.30e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53724505    227 STIGGIRRAAESIAAASHEIASGNHDLSQRTEQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDVV 306
Cdd:smart00283 179 ELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEISAAAEELSGLAEELDELV 258

                   ..
gi 53724505    307 SR 308
Cdd:smart00283 259 ER 260
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH