NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|53719488|ref|YP_108474|]
View 

methyl-accepting chemotaxis protein [Burkholderia pseudomallei K96243]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCPsignal super family cl28165
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
270-560 1.95e-93

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


The actual alignment was detected with superfamily member PRK15041:

Pssm-ID: 332985  Cd Length: 554  Bit Score: 300.33  E-value: 1.95e-93
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  270 VAAGDLtshfdAHRVDPQAKDEISRVMRALQTMNDGLVRIVTDVRSGTDTIATASHEIMAGNNDLSARTEQQAASLQETA 349
Cdd:PRK15041 232 IAGGDL-----VKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETA 306
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  350 ASMSELTATVKLNLENARQANMIGSNAVSTVEKGSVSVEQLVTTVNAISTNSGKIADIISLIEGIAFQTNILALNAAVEA 429
Cdd:PRK15041 307 ASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEA 386
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  430 ARAGEQGRGFAVVASEVRSLAQRSSSAAKEIKDLIETSIDTVRDGVSKADEVGQHIVEVKQAIRRVADLVGEITAASEEQ 509
Cdd:PRK15041 387 ARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQ 466
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 53719488  510 TRGIEQVDAAVSQMDRVTQQNAALVEQAAAASKAMDDQAGNLRAAASIFKL 560
Cdd:PRK15041 467 SRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRI 517
HAMP pfam00672
HAMP domain;
232-302 5.02e-03

HAMP domain;


:

Pssm-ID: 307012  Cd Length: 69  Bit Score: 36.78  E-value: 5.02e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 53719488   232 IISAAVAIGILAFFALMLHmmfKRVLAGLEAAASTASRVAAGDLTSHFDahrvdpQAKDEISRVMRALQTM 302
Cdd:pfam00672   2 LLVLLIALLLALLLAWLLA---RRILRPLRRLAEAARRIASGDLDVPLE------SGRDEIGELARAFNQM 63
 
Name Accession Description Interval E-value
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
270-560 1.95e-93

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 300.33  E-value: 1.95e-93
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  270 VAAGDLtshfdAHRVDPQAKDEISRVMRALQTMNDGLVRIVTDVRSGTDTIATASHEIMAGNNDLSARTEQQAASLQETA 349
Cdd:PRK15041 232 IAGGDL-----VKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETA 306
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  350 ASMSELTATVKLNLENARQANMIGSNAVSTVEKGSVSVEQLVTTVNAISTNSGKIADIISLIEGIAFQTNILALNAAVEA 429
Cdd:PRK15041 307 ASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEA 386
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  430 ARAGEQGRGFAVVASEVRSLAQRSSSAAKEIKDLIETSIDTVRDGVSKADEVGQHIVEVKQAIRRVADLVGEITAASEEQ 509
Cdd:PRK15041 387 ARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQ 466
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 53719488  510 TRGIEQVDAAVSQMDRVTQQNAALVEQAAAASKAMDDQAGNLRAAASIFKL 560
Cdd:PRK15041 467 SRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRI 517
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
205-560 1.57e-66

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 224.87  E-value: 1.57e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 205 IDDFLKLLDARTEGAIARAQASAQTWKIISAAVAIGILAFFALMLHMMFKRVLAGLEAAASTASRVAAGDLTshfdaHRV 284
Cdd:COG0840  33 LGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLT-----KRI 107
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 285 DPQAKDEISRVMRALQTMNDGLVRIVTDVRSGTDTIATASHEIMAGNNDLSARTEQQAASLQETAASMSELTATVKLNLE 364
Cdd:COG0840 108 DESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAF 187
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 365 NARQANMIGSNAVSTVEKGSVSVEQLVTTVNAI-----------STNSGKIADIISLIEGIAFQTNILALNAAVEAARAG 433
Cdd:COG0840 188 NAKEAAALASEASQVAEEGGEEVRQAVEQMQEIaeelaevvkklSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAG 267
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 434 EQGRGFAVVASEVRSLAQRSSSAAKEIKDLIET--------------SIDTVRDGVSKADEVGQHIVEVKQAIRRVADLV 499
Cdd:COG0840 268 EAGRGFAVVADEVRKLAERSADSAKEIGLLIEEiqneaadavehmeeSASEVSEGVKLVEETGSSLGEIAAAIEEVSQLI 347
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 53719488 500 GEITAASEEQTRGIEQVDAAVSQMDRVTQQNAALVEQAAAASKAMDDQAGNLRAAASIFKL 560
Cdd:COG0840 348 SEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
312-559 4.67e-60

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 202.90  E-value: 4.67e-60
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488    312 DVRSGTDTIATASHEIMAGNNDLSARTEQQAASLQETAASMSELTATVKLNLENARQANMIGSNAVSTVEKGSVSVEQLV 391
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488    392 TTVNAISTNSGKIADIISLIEGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSSSAAKEIKDLIET----- 466
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488    467 ---------SIDTVRDGVSKADEVGQHIVEVKQAIRRVADLVGEITAASEEQTRGIEQVDAAVSQMDRVTQQNAALVEQA 537
Cdd:smart00283 161 neavaameeSSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 53719488    538 AAASKAMDDQAGNLRAAASIFK 559
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
339-530 1.86e-52

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 180.13  E-value: 1.86e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 339 EQQAASLQETAASMSELTATVKLNLENARQANMIGSNAVSTVEKGSVSVEQLVTTVNAISTNSGKIADIISLIEGIAFQT 418
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 419 NILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSSSAAKEIKDLIETSIDTVRDGVSKADEVGQHIVEVKQAIRRVADL 498
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190
                ....*....|....*....|....*....|..
gi 53719488 499 VGEITAASEEQTRGIEQVDAAVSQMDRVTQQN 530
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEI 192
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
364-558 1.16e-47

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 167.24  E-value: 1.16e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488   364 ENARQANmigSNAVSTVEKGSVSVEQLVTTVNAISTNSGKIADIISLIEGIAFQTNILALNAAVEAARAGEQGRGFAVVA 443
Cdd:pfam00015   2 DLAQLAS---EEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVA 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488   444 SEVRSLAQRSSSAAKEIKDLIETSI--------------DTVRDGVSKADEVGQHIVEVKQAIRRVADLVGEITAASEEQ 509
Cdd:pfam00015  79 DEVRKLAERSAQAAKEIEALIEEIVkqtndstasiqqtrTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQ 158
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 53719488   510 TRGIEQVDAAVSQMDRVTQQNAALVEQAAAASKAMDDQAGNLRAAASIF 558
Cdd:pfam00015 159 SAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
HAMP pfam00672
HAMP domain;
232-302 5.02e-03

HAMP domain;


Pssm-ID: 307012  Cd Length: 69  Bit Score: 36.78  E-value: 5.02e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 53719488   232 IISAAVAIGILAFFALMLHmmfKRVLAGLEAAASTASRVAAGDLTSHFDahrvdpQAKDEISRVMRALQTM 302
Cdd:pfam00672   2 LLVLLIALLLALLLAWLLA---RRILRPLRRLAEAARRIASGDLDVPLE------SGRDEIGELARAFNQM 63
 
Name Accession Description Interval E-value
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
270-560 1.95e-93

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 300.33  E-value: 1.95e-93
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  270 VAAGDLtshfdAHRVDPQAKDEISRVMRALQTMNDGLVRIVTDVRSGTDTIATASHEIMAGNNDLSARTEQQAASLQETA 349
Cdd:PRK15041 232 IAGGDL-----VKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETA 306
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  350 ASMSELTATVKLNLENARQANMIGSNAVSTVEKGSVSVEQLVTTVNAISTNSGKIADIISLIEGIAFQTNILALNAAVEA 429
Cdd:PRK15041 307 ASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEA 386
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  430 ARAGEQGRGFAVVASEVRSLAQRSSSAAKEIKDLIETSIDTVRDGVSKADEVGQHIVEVKQAIRRVADLVGEITAASEEQ 509
Cdd:PRK15041 387 ARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQ 466
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 53719488  510 TRGIEQVDAAVSQMDRVTQQNAALVEQAAAASKAMDDQAGNLRAAASIFKL 560
Cdd:PRK15041 467 SRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRI 517
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
270-564 4.29e-91

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 294.22  E-value: 4.29e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  270 VAAGDLTSHFDAhrvdpQAKDEISRVMRALQTMNDGLVRIVTDVRSGTDTIATASHEIMAGNNDLSARTEQQAASLQETA 349
Cdd:PRK15048 230 IAGGNLANTLTI-----DGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETA 304
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  350 ASMSELTATVKLNLENARQANMIGSNAVSTVEKGSVSVEQLVTTVNAISTNSGKIADIISLIEGIAFQTNILALNAAVEA 429
Cdd:PRK15048 305 ASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEA 384
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  430 ARAGEQGRGFAVVASEVRSLAQRSSSAAKEIKDLIETSIDTVRDGVSKADEVGQHIVEVKQAIRRVADLVGEITAASEEQ 509
Cdd:PRK15048 385 ARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQ 464
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 53719488  510 TRGIEQVDAAVSQMDRVTQQNAALVEQAAAASKAMDDQAGNLRAAASIFKLPGRA 564
Cdd:PRK15048 465 SRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAASP 519
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
220-560 8.92e-90

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 290.05  E-value: 8.92e-90
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  220 IARAQASAQTWKIISAAVAIGILAFFALM----LHMMFKRVLAGLEAAASTASRVAAGDLtshfdAHRVDPQAKDEISRV 295
Cdd:PRK09793 174 LEAASAQSQRNYQISALVFISMIIVAAIYissaLWWTRKMIVQPLAIIGSHFDSIAAGNL-----ARPIAVYGRNEITAI 248
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  296 MRALQTMNDGLVRIVTDVRSGTDTIATASHEIMAGNNDLSARTEQQAASLQETAASMSELTATVKLNLENARQANMIGSN 375
Cdd:PRK09793 249 FASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKN 328
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  376 AVSTVEKGSVSVEQLVTTVNAISTNSGKIADIISLIEGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSSS 455
Cdd:PRK09793 329 AATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQ 408
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488  456 AAKEIKDLIETSIDTVRDGVSKADEVGQHIVEVKQAIRRVADLVGEITAASEEQTRGIEQVDAAVSQMDRVTQQNAALVE 535
Cdd:PRK09793 409 AAKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQNASLVE 488
                        330       340
                 ....*....|....*....|....*
gi 53719488  536 QAAAASKAMDDQAGNLRAAASIFKL 560
Cdd:PRK09793 489 EAAVATEQLANQADHLSSRVAVFTL 513
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
205-560 1.57e-66

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 224.87  E-value: 1.57e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 205 IDDFLKLLDARTEGAIARAQASAQTWKIISAAVAIGILAFFALMLHMMFKRVLAGLEAAASTASRVAAGDLTshfdaHRV 284
Cdd:COG0840  33 LGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLT-----KRI 107
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 285 DPQAKDEISRVMRALQTMNDGLVRIVTDVRSGTDTIATASHEIMAGNNDLSARTEQQAASLQETAASMSELTATVKLNLE 364
Cdd:COG0840 108 DESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAF 187
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 365 NARQANMIGSNAVSTVEKGSVSVEQLVTTVNAI-----------STNSGKIADIISLIEGIAFQTNILALNAAVEAARAG 433
Cdd:COG0840 188 NAKEAAALASEASQVAEEGGEEVRQAVEQMQEIaeelaevvkklSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAG 267
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 434 EQGRGFAVVASEVRSLAQRSSSAAKEIKDLIET--------------SIDTVRDGVSKADEVGQHIVEVKQAIRRVADLV 499
Cdd:COG0840 268 EAGRGFAVVADEVRKLAERSADSAKEIGLLIEEiqneaadavehmeeSASEVSEGVKLVEETGSSLGEIAAAIEEVSQLI 347
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 53719488 500 GEITAASEEQTRGIEQVDAAVSQMDRVTQQNAALVEQAAAASKAMDDQAGNLRAAASIFKL 560
Cdd:COG0840 348 SEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
312-559 4.67e-60

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 202.90  E-value: 4.67e-60
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488    312 DVRSGTDTIATASHEIMAGNNDLSARTEQQAASLQETAASMSELTATVKLNLENARQANMIGSNAVSTVEKGSVSVEQLV 391
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488    392 TTVNAISTNSGKIADIISLIEGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSSSAAKEIKDLIET----- 466
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488    467 ---------SIDTVRDGVSKADEVGQHIVEVKQAIRRVADLVGEITAASEEQTRGIEQVDAAVSQMDRVTQQNAALVEQA 537
Cdd:smart00283 161 neavaameeSSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 53719488    538 AAASKAMDDQAGNLRAAASIFK 559
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
339-530 1.86e-52

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 180.13  E-value: 1.86e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 339 EQQAASLQETAASMSELTATVKLNLENARQANMIGSNAVSTVEKGSVSVEQLVTTVNAISTNSGKIADIISLIEGIAFQT 418
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488 419 NILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSSSAAKEIKDLIETSIDTVRDGVSKADEVGQHIVEVKQAIRRVADL 498
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190
                ....*....|....*....|....*....|..
gi 53719488 499 VGEITAASEEQTRGIEQVDAAVSQMDRVTQQN 530
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEI 192
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
364-558 1.16e-47

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 167.24  E-value: 1.16e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488   364 ENARQANmigSNAVSTVEKGSVSVEQLVTTVNAISTNSGKIADIISLIEGIAFQTNILALNAAVEAARAGEQGRGFAVVA 443
Cdd:pfam00015   2 DLAQLAS---EEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVA 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53719488   444 SEVRSLAQRSSSAAKEIKDLIETSI--------------DTVRDGVSKADEVGQHIVEVKQAIRRVADLVGEITAASEEQ 509
Cdd:pfam00015  79 DEVRKLAERSAQAAKEIEALIEEIVkqtndstasiqqtrTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQ 158
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 53719488   510 TRGIEQVDAAVSQMDRVTQQNAALVEQAAAASKAMDDQAGNLRAAASIF 558
Cdd:pfam00015 159 SAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
HAMP pfam00672
HAMP domain;
232-302 5.02e-03

HAMP domain;


Pssm-ID: 307012  Cd Length: 69  Bit Score: 36.78  E-value: 5.02e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 53719488   232 IISAAVAIGILAFFALMLHmmfKRVLAGLEAAASTASRVAAGDLTSHFDahrvdpQAKDEISRVMRALQTM 302
Cdd:pfam00672   2 LLVLLIALLLALLLAWLLA---RRILRPLRRLAEAARRIASGDLDVPLE------SGRDEIGELARAFNQM 63
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
254-311 8.17e-03

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 36.07  E-value: 8.17e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 53719488    254 KRVLAGLEAAASTASRVAAGDLTshfdaHRVDPQAKDEISRVMRALQTMNDGLVRIVT 311
Cdd:smart00304   1 RRLLRPLRRLAEAAQRIADGDLT-----VRLPVDGRDEIGELARAFNEMADRLEETIA 53
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH