NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|50401172|sp|Q9KT84|]
View 

RecName: Full=Regulatory protein LuxO

Protein Classification

sigma-54-dependent Fis family transcriptional regulator (domain architecture ID 10824974)

sigma-54-dependent Fis family transcriptional regulator containing a REC domain, similar to Escherichia coli transcriptional regulators AtoC and NR(I), which function in the regulation of genes involved in acetoacetate metabolism and nitrogen assimilation, respectively

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Sigma54_activat pfam00158
Sigma-54 interaction domain;
132-299 5.45e-104

Sigma-54 interaction domain;


:

Pssm-ID: 278583  Cd Length: 168  Bit Score: 309.33  E-value: 5.45e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   132 FIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTG 211
Cdd:pfam00158   1 IIGESPAMQEVLELAKRVAPTDATVLITGESGTGKELVARAIHQLSPRADGPFVAVNCAAIPEELLESELFGHEKGAFTG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   212 AATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYY 291
Cdd:pfam00158  81 ADSDRKGLFELADGGTLFLDEIGELPLELQAKLLRVLQEGEFERVGGTKPIKVDVRIIAATNRDLEEAVAEGRFREDLYY 160

                  ....*...
gi 50401172   292 RLYVIPLH 299
Cdd:pfam00158 161 RLNVVPIE 168
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
2-112 2.09e-31

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


:

Pssm-ID: 238088  Cd Length: 113  Bit Score: 116.52  E-value: 2.09e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:cd00156   3 VDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGDDE 82
                        90       100       110
                ....*....|....*....|....*....|.
gi 50401172  82 TAVEAMRHGAQDFLIKPCEADRLRVTVNNAI 112
Cdd:cd00156  83 DAVEALKAGADDYLTKPFSPEELLARIRALL 113
HTH_8 pfam02954
Bacterial regulatory protein, Fis family;
405-442 4.52e-09

Bacterial regulatory protein, Fis family;


:

Pssm-ID: 281020  Cd Length: 40  Bit Score: 52.38  E-value: 4.52e-09
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 50401172   405 WMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQ 442
Cdd:pfam02954   1 EEVEKELIEAALERTGGNKSRAARLLGISRRTLYRKLK 38
AtoC COG2204
DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, ...
2-445 0e+00

DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains [Signal transduction mechanisms];


:

Pssm-ID: 225114 [Multi-domain]  Cd Length: 464  Bit Score: 541.52  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:COG2204  10 VDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDPDLPVIVMTGHGDID 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  82 TAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKAS---KLKNDVDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFI 158
Cdd:COG2204  90 TAVEALRLGAFDFLEKPFDLDRLLAIVERALELRElqrENRRSLKRAKSLGGELVGESPAMQQLRRLIAKVAPSDASVLI 169
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 159 TGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDL 238
Cdd:COG2204 170 TGESGTGKELVARAIHQASPRAKGPFIAVNCAAIPENLLESELFGHEKGAFTGAITRRIGRFEQANGGTLFLDEIGEMPL 249
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 239 DLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLL 318
Cdd:COG2204 250 ELQVKLLRVLQEREFERVGGNKPIKVDVRIIAATNRDLEEEVAAGRFREDLYYRLNVVPLRLPPLRERKEDIPLLAEHFL 329
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 319 GFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLnQMSAPINRALPLAHENKVSV 398
Cdd:COG2204 330 KRFAAELGRPPKGFSPEALAALLAYDWPGNVRELENVVERAVILSEGPEIEVEDLPLEI-LAPAAEALAGPAGEAALPGL 408
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....*..
gi 50401172 399 HEIFPLWMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQTWN 445
Cdd:COG2204 409 PLGEALAEVERQLILQALERTGGNKSEAAERLGISRKTLYRKLKEYG 455
 
Name Accession Description Interval E-value
Sigma54_activat pfam00158
Sigma-54 interaction domain;
132-299 5.45e-104

Sigma-54 interaction domain;


Pssm-ID: 278583  Cd Length: 168  Bit Score: 309.33  E-value: 5.45e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   132 FIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTG 211
Cdd:pfam00158   1 IIGESPAMQEVLELAKRVAPTDATVLITGESGTGKELVARAIHQLSPRADGPFVAVNCAAIPEELLESELFGHEKGAFTG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   212 AATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYY 291
Cdd:pfam00158  81 ADSDRKGLFELADGGTLFLDEIGELPLELQAKLLRVLQEGEFERVGGTKPIKVDVRIIAATNRDLEEAVAEGRFREDLYY 160

                  ....*...
gi 50401172   292 RLYVIPLH 299
Cdd:pfam00158 161 RLNVVPIE 168
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
2-112 2.09e-31

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 116.52  E-value: 2.09e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:cd00156   3 VDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGDDE 82
                        90       100       110
                ....*....|....*....|....*....|.
gi 50401172  82 TAVEAMRHGAQDFLIKPCEADRLRVTVNNAI 112
Cdd:cd00156  83 DAVEALKAGADDYLTKPFSPEELLARIRALL 113
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
2-109 7.15e-28

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 278500  Cd Length: 111  Bit Score: 106.46  E-value: 7.15e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172     2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:pfam00072   4 VDDDPLIRELLRQLLEKEGYVVAEADDGKEALELLKEERPDLILLDINMPGMDGLELLKRIRRRDPDTPVIILTAHGDED 83
                          90       100
                  ....*....|....*....|....*...
gi 50401172    82 TAVEAMRHGAQDFLIKPCEADRLRVTVN 109
Cdd:pfam00072  84 DAVEALEAGADDFLSKPFDPDELLAAIR 111
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
139-302 5.05e-23

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707  Cd Length: 151  Bit Score: 94.52  E-value: 5.05e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 139 MQAVYRTIDSAA--SSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVkgaftgAATER 216
Cdd:cd00009   3 QEEAIEALREALelPPPKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASDLLEGLVVAELFGHF------LVRLL 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 217 QGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFqkvgsSKMKSVDVRFVCATNRDPwkevqEGRFREDLYYRLyVI 296
Cdd:cd00009  77 FELAEKAKPGVLFIDEIDSLSRGAQNALLRVLETLND-----LRIDRENVRVIGATNRPL-----LGDLDRALYDRL-DI 145

                ....*.
gi 50401172 297 PLHLPP 302
Cdd:cd00009 146 RIVIPL 151
CheY COG0784
CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];
2-115 1.95e-20

CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];


Pssm-ID: 223855  Cd Length: 130  Bit Score: 86.82  E-value: 1.95e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTG-RDAIESI-GRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGS 79
Cdd:COG0784  11 VDDEPVNRRLLKRLLEDLGYEVVEAADGeEEALELLrELPQPDLILLDINMPGMDGIELLRRLRARGPNIPVILLTAYAD 90
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 50401172  80 IDTAVEAMRHGAQDFLIKP-CEADRLRVTVNNAIRKA 115
Cdd:COG0784  91 EADRERALAAGADDYLTKPiFLEEELLAALRRLLARA 127
HTH_8 pfam02954
Bacterial regulatory protein, Fis family;
405-442 4.52e-09

Bacterial regulatory protein, Fis family;


Pssm-ID: 281020  Cd Length: 40  Bit Score: 52.38  E-value: 4.52e-09
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 50401172   405 WMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQ 442
Cdd:pfam02954   1 EEVEKELIEAALERTGGNKSRAARLLGISRRTLYRKLK 38
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
2-51 6.78e-07

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 46.41  E-value: 6.78e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 50401172      2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLP 51
Cdd:smart00448   6 VDDDPLLRELLKALLEKEGYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PRK10610 PRK10610
chemotaxis regulatory protein CheY; Provisional
1-114 1.73e-05

chemotaxis regulatory protein CheY; Provisional


Pssm-ID: 170568  Cd Length: 129  Bit Score: 43.04  E-value: 1.73e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDI-DINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKS--PDVPIVFMTAH 77
Cdd:PRK10610  10 VVDDFSTMRRIVRNLLKELGFnNVEEAEDGVDALNKLQAGGFGFVISDWNMPNMDGLELLKTIRADGamSALPVLMVTAE 89
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 50401172   78 GSIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRK 114
Cdd:PRK10610  90 AKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK 126
AtoC COG2204
DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, ...
2-445 0e+00

DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains [Signal transduction mechanisms];


Pssm-ID: 225114 [Multi-domain]  Cd Length: 464  Bit Score: 541.52  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:COG2204  10 VDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDPDLPVIVMTGHGDID 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  82 TAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKAS---KLKNDVDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFI 158
Cdd:COG2204  90 TAVEALRLGAFDFLEKPFDLDRLLAIVERALELRElqrENRRSLKRAKSLGGELVGESPAMQQLRRLIAKVAPSDASVLI 169
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 159 TGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDL 238
Cdd:COG2204 170 TGESGTGKELVARAIHQASPRAKGPFIAVNCAAIPENLLESELFGHEKGAFTGAITRRIGRFEQANGGTLFLDEIGEMPL 249
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 239 DLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLL 318
Cdd:COG2204 250 ELQVKLLRVLQEREFERVGGNKPIKVDVRIIAATNRDLEEEVAAGRFREDLYYRLNVVPLRLPPLRERKEDIPLLAEHFL 329
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 319 GFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLnQMSAPINRALPLAHENKVSV 398
Cdd:COG2204 330 KRFAAELGRPPKGFSPEALAALLAYDWPGNVRELENVVERAVILSEGPEIEVEDLPLEI-LAPAAEALAGPAGEAALPGL 408
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....*..
gi 50401172 399 HEIFPLWMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQTWN 445
Cdd:COG2204 409 PLGEALAEVERQLILQALERTGGNKSEAAERLGISRKTLYRKLKEYG 455
ntrC TIGR01818
nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response ...
2-441 3.93e-130

nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc. [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 273818 [Multi-domain]  Cd Length: 463  Bit Score: 387.17  E-value: 3.93e-130
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172     2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:TIGR01818   4 VDDDRSIRWVLEKALSRAGYEVRTFGNAASVLRALARGQPDLLITDVRMPGEDGLDLLPQIKKRHPQLPVIVMTAHSDLD 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    82 TAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKND--VDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFIT 159
Cdd:TIGR01818  84 TAVAAYQRGAFEYLPKPFDLDEAVTLVERALAHAQEQVALpaDAGEAEDSAELIGEAPAMQEVFRAIGRLSRSDITVLIN 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   160 GESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLD 239
Cdd:TIGR01818 164 GESGTGKELVARALHRHSPRANGPFIALNMAAIPKDLIESELFGHEKGAFTGANTRRQGRFEQADGGTLFLDEIGDMPLD 243
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   240 LQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLG 319
Cdd:TIGR01818 244 AQTRLLRVLADGEFYRVGGRTPIKVDVRIVAATHQNLEALVRQGKFREDLFHRLNVIRIHLPPLRERREDIPRLARHFLA 323
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   320 FMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLN-------------------QM 380
Cdd:TIGR01818 324 LAARELDVEPKLLDPEALERLKQLRWPGNVRQLENLCRWLTVMASGDEVLVSDLPAELAltgrpasapdsdgqdswdeAL 403
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 50401172   381 SAPINRALPLAHENkvSVHEIFPLWmtEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKL 441
Cdd:TIGR01818 404 EAWAKQALSRGEQG--LLDRALPEF--ERPLLEAALQHTRGHKQEAAALLGWGRNTLTRKL 460
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
1-444 1.39e-119

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099 [Multi-domain]  Cd Length: 457  Bit Score: 359.93  E-value: 1.39e-119
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSI 80
Cdd:PRK11361   9 IVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHETRTPVILMTAYAEV 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASkLKNDVDNKNQ----NYQ--GFIGSSQTMQAVYRTIDSAASSKA 154
Cdd:PRK11361  89 ETAVEALRCGAFDYVIKPFDLDELNLIVQRALQLQS-MKKEIRHLHQalstSWQwgHILTNSPAMMDICKDTAKIALSQA 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  155 SIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELC 234
Cdd:PRK11361 168 SVLISGESGTGKELIARAIHYNSRRAKGPFIKVNCAALPESLLESELFGHEKGAFTGAQTLRQGLFERANEGTLLLDEIG 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  235 EMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIA 314
Cdd:PRK11361 248 EMPLVLQAKLLRILQEREFERIGGHQTIKVDIRIIAATNRDLQAMVKEGTFREDLFYRLNVIHLILPPLRDRREDISLLA 327
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  315 YSLLGFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLNQMSAPINRALPLAHEN 394
Cdd:PRK11361 328 NHFLQKFSSENQRDIIDIDPMAMSLLTAWSWPGNIRELSNVIERAVVMNSGPIIFSEDLPPQIRQPVCNAGEVKTAPVGE 407
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|
gi 50401172  395 KVSVHEIFplwMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQTW 444
Cdd:PRK11361 408 RNLKEEIK---RVEKRIIMEVLEQQEGNRTRTALMLGISRRALMYKLQEY 454
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
155-293 2.40e-11

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 61.24  E-value: 2.40e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    155 SIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIES---ELFGHVKGAFTGAATERQG--AAEAADGGTLF 229
Cdd:smart00382   4 VILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQlllIIVGGKKASGSGELRLRLAlaLARKLKPDVLI 83
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 50401172    230 LDELCEMDLDLQTKLLRFIQtgtFQKVGSSKMKSVDVRFVCATNR--DPWKEVQEGRFREDLYYRL 293
Cdd:smart00382  84 LDEITSLLDAEQEALLLLLE---ELRLLLLLKSEKNLTVILTTNDekDLGPALLRRRFDRRIVLLL 146
 
Name Accession Description Interval E-value
Sigma54_activat pfam00158
Sigma-54 interaction domain;
132-299 5.45e-104

Sigma-54 interaction domain;


Pssm-ID: 278583  Cd Length: 168  Bit Score: 309.33  E-value: 5.45e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   132 FIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTG 211
Cdd:pfam00158   1 IIGESPAMQEVLELAKRVAPTDATVLITGESGTGKELVARAIHQLSPRADGPFVAVNCAAIPEELLESELFGHEKGAFTG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   212 AATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYY 291
Cdd:pfam00158  81 ADSDRKGLFELADGGTLFLDEIGELPLELQAKLLRVLQEGEFERVGGTKPIKVDVRIIAATNRDLEEAVAEGRFREDLYY 160

                  ....*...
gi 50401172   292 RLYVIPLH 299
Cdd:pfam00158 161 RLNVVPIE 168
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
2-112 2.09e-31

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 116.52  E-value: 2.09e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:cd00156   3 VDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGDDE 82
                        90       100       110
                ....*....|....*....|....*....|.
gi 50401172  82 TAVEAMRHGAQDFLIKPCEADRLRVTVNNAI 112
Cdd:cd00156  83 DAVEALKAGADDYLTKPFSPEELLARIRALL 113
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
2-109 7.15e-28

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 278500  Cd Length: 111  Bit Score: 106.46  E-value: 7.15e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172     2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:pfam00072   4 VDDDPLIRELLRQLLEKEGYVVAEADDGKEALELLKEERPDLILLDINMPGMDGLELLKRIRRRDPDTPVIILTAHGDED 83
                          90       100
                  ....*....|....*....|....*...
gi 50401172    82 TAVEAMRHGAQDFLIKPCEADRLRVTVN 109
Cdd:pfam00072  84 DAVEALEAGADDFLSKPFDPDELLAAIR 111
Sigma54_activ_2 pfam14532
Sigma-54 interaction domain;
133-303 3.47e-27

Sigma-54 interaction domain;


Pssm-ID: 291216  Cd Length: 138  Bit Score: 105.48  E-value: 3.47e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   133 IGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESelfghvkgaftga 212
Cdd:pfam14532   1 LGRSAAIQEIKRRLEQAAQSTLPVLLTGEPGSGKEFCARYLHNPSTPWLDPFVIEYLAHLPQDLLEQ------------- 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   213 aterqgaaeaADGGTLFLDELCEMDLDLQTKLLRFIQtgtfqkvgssKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYR 292
Cdd:pfam14532  68 ----------AKGGTLYLKDIADLSKALQKGLLLLIA----------KAEKYNVRLVCTSSKSLTQLAAAGLFDEKLYFE 127
                         170
                  ....*....|.
gi 50401172   293 LYVIPLHLPPL 303
Cdd:pfam14532 128 LSELRLHVPPL 138
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
139-302 5.05e-23

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707  Cd Length: 151  Bit Score: 94.52  E-value: 5.05e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 139 MQAVYRTIDSAA--SSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVkgaftgAATER 216
Cdd:cd00009   3 QEEAIEALREALelPPPKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASDLLEGLVVAELFGHF------LVRLL 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 217 QGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFqkvgsSKMKSVDVRFVCATNRDPwkevqEGRFREDLYYRLyVI 296
Cdd:cd00009  77 FELAEKAKPGVLFIDEIDSLSRGAQNALLRVLETLND-----LRIDRENVRVIGATNRPL-----LGDLDRALYDRL-DI 145

                ....*.
gi 50401172 297 PLHLPP 302
Cdd:cd00009 146 RIVIPL 151
CheY COG0784
CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];
2-115 1.95e-20

CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];


Pssm-ID: 223855  Cd Length: 130  Bit Score: 86.82  E-value: 1.95e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTG-RDAIESI-GRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGS 79
Cdd:COG0784  11 VDDEPVNRRLLKRLLEDLGYEVVEAADGeEEALELLrELPQPDLILLDINMPGMDGIELLRRLRARGPNIPVILLTAYAD 90
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 50401172  80 IDTAVEAMRHGAQDFLIKP-CEADRLRVTVNNAIRKA 115
Cdd:COG0784  91 EADRERALAAGADDYLTKPiFLEEELLAALRRLLARA 127
HTH_8 pfam02954
Bacterial regulatory protein, Fis family;
405-442 4.52e-09

Bacterial regulatory protein, Fis family;


Pssm-ID: 281020  Cd Length: 40  Bit Score: 52.38  E-value: 4.52e-09
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 50401172   405 WMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQ 442
Cdd:pfam02954   1 EEVEKELIEAALERTGGNKSRAARLLGISRRTLYRKLK 38
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
2-51 6.78e-07

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 46.41  E-value: 6.78e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 50401172      2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLP 51
Cdd:smart00448   6 VDDDPLLRELLKALLEKEGYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PRK10610 PRK10610
chemotaxis regulatory protein CheY; Provisional
1-114 1.73e-05

chemotaxis regulatory protein CheY; Provisional


Pssm-ID: 170568  Cd Length: 129  Bit Score: 43.04  E-value: 1.73e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDI-DINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKS--PDVPIVFMTAH 77
Cdd:PRK10610  10 VVDDFSTMRRIVRNLLKELGFnNVEEAEDGVDALNKLQAGGFGFVISDWNMPNMDGLELLKTIRADGamSALPVLMVTAE 89
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 50401172   78 GSIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRK 114
Cdd:PRK10610  90 AKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK 126
AAA_16 pfam13191
AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the ...
132-249 5.17e-04

AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.


Pssm-ID: 289934  Cd Length: 167  Bit Score: 39.44  E-value: 5.17e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   132 FIGSSQTMQAVYRTIDSAAS-SKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINC------AAIPKDLIESELFGH 204
Cdd:pfam13191   2 LVGREAELERLLDALERVRSgRPGSVLLTGPSGTGKTSLLRELARRLARDGGLFLRGKCdecipyAPLLQALTRRGLLRQ 81
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 50401172   205 VKGAFTGAATERQGAAEAADGGTLFlDELCEMDLDLQTKLLRFIQ 249
Cdd:pfam13191  82 LLTEEESALLEPWRARLLEALGPLP-PLPPDEANRLLDALLRLLD 125
AAA pfam00004
ATPase family associated with various cellular activities (AAA); AAA family proteins often ...
156-274 2.94e-03

ATPase family associated with various cellular activities (AAA); AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.


Pssm-ID: 278434  Cd Length: 130  Bit Score: 36.42  E-value: 2.94e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   156 IFITGESGTGKEVCAEAIHAASKRgdkPFIAINCAAI-PKDLIESElfGHVKGAFTgaaterqgAAEAADGGTLFLDEL- 233
Cdd:pfam00004   1 LLLYGPPGTGKTTLAKAVAKELGA---PFVEISGSELvSKYVGESE--KRLRELFE--------AAKKLAPCVIFIDEId 67
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 50401172   234 ----------CEMDLDLQTKLLRFIQtgTFQKVGSskmksvDVRFVCATNR 274
Cdd:pfam00004  68 alagsrgsggDSESRRVVNQLLTELD--GFTSSLS------KVIVIAATNR 110
AAA_5 pfam07728
AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not ...
155-276 3.12e-03

AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 285029  Cd Length: 135  Bit Score: 36.49  E-value: 3.12e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   155 SIFITGESGTGKEVCAEaiHAASKRGDKPFIAINCaaiPKDLIESELFGH----------VKGAFTGAATErqgaaeaad 224
Cdd:pfam07728   1 GVLLVGPPGTGKSTLAR--RLAAALSNRPVFYVQL---TRDTTEEDLKGRrnigngttewVDGPLVRAARE--------- 66
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 50401172   225 GGTLFLDELCEMDLDLQTKLLRFIQTGTFQK---VGSSKMKSVDVRFVCATNRDP 276
Cdd:pfam07728  67 GEIAVLDEINRANPEVLNSLLSLLDERRLLLpegGELVQAAPDDFRLIATMNPLD 121
AAA_22 pfam13401
AAA domain;
151-252 3.39e-03

AAA domain;


Pssm-ID: 290137  Cd Length: 130  Bit Score: 36.16  E-value: 3.39e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   151 SSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAA--IPKDLIES--ELFGHVKGAFTGAATE-----RQGAAE 221
Cdd:pfam13401   3 SGAGILVLTGESGTGKTTLLRRLLEQLDEADDSVVFVDLPSgtSPKDLLRAllRALGLPLSKEGLSKEEllaalQQALLA 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 50401172   222 AADGGTLFLDE----------LCEMDLDLQTKLLRFIQTGT 252
Cdd:pfam13401  83 LGRRVVLIIDEaqhlslealeELRDLLNLSRKGLQLILVGT 123
AtoC COG2204
DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, ...
2-445 0e+00

DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains [Signal transduction mechanisms];


Pssm-ID: 225114 [Multi-domain]  Cd Length: 464  Bit Score: 541.52  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:COG2204  10 VDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDPDLPVIVMTGHGDID 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  82 TAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKAS---KLKNDVDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFI 158
Cdd:COG2204  90 TAVEALRLGAFDFLEKPFDLDRLLAIVERALELRElqrENRRSLKRAKSLGGELVGESPAMQQLRRLIAKVAPSDASVLI 169
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 159 TGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDL 238
Cdd:COG2204 170 TGESGTGKELVARAIHQASPRAKGPFIAVNCAAIPENLLESELFGHEKGAFTGAITRRIGRFEQANGGTLFLDEIGEMPL 249
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 239 DLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLL 318
Cdd:COG2204 250 ELQVKLLRVLQEREFERVGGNKPIKVDVRIIAATNRDLEEEVAAGRFREDLYYRLNVVPLRLPPLRERKEDIPLLAEHFL 329
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 319 GFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLnQMSAPINRALPLAHENKVSV 398
Cdd:COG2204 330 KRFAAELGRPPKGFSPEALAALLAYDWPGNVRELENVVERAVILSEGPEIEVEDLPLEI-LAPAAEALAGPAGEAALPGL 408
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....*..
gi 50401172 399 HEIFPLWMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQTWN 445
Cdd:COG2204 409 PLGEALAEVERQLILQALERTGGNKSEAAERLGISRKTLYRKLKEYG 455
ntrC TIGR01818
nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response ...
2-441 3.93e-130

nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc. [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 273818 [Multi-domain]  Cd Length: 463  Bit Score: 387.17  E-value: 3.93e-130
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172     2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:TIGR01818   4 VDDDRSIRWVLEKALSRAGYEVRTFGNAASVLRALARGQPDLLITDVRMPGEDGLDLLPQIKKRHPQLPVIVMTAHSDLD 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    82 TAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKND--VDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFIT 159
Cdd:TIGR01818  84 TAVAAYQRGAFEYLPKPFDLDEAVTLVERALAHAQEQVALpaDAGEAEDSAELIGEAPAMQEVFRAIGRLSRSDITVLIN 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   160 GESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLD 239
Cdd:TIGR01818 164 GESGTGKELVARALHRHSPRANGPFIALNMAAIPKDLIESELFGHEKGAFTGANTRRQGRFEQADGGTLFLDEIGDMPLD 243
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   240 LQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLG 319
Cdd:TIGR01818 244 AQTRLLRVLADGEFYRVGGRTPIKVDVRIVAATHQNLEALVRQGKFREDLFHRLNVIRIHLPPLRERREDIPRLARHFLA 323
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   320 FMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLN-------------------QM 380
Cdd:TIGR01818 324 LAARELDVEPKLLDPEALERLKQLRWPGNVRQLENLCRWLTVMASGDEVLVSDLPAELAltgrpasapdsdgqdswdeAL 403
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 50401172   381 SAPINRALPLAHENkvSVHEIFPLWmtEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKL 441
Cdd:TIGR01818 404 EAWAKQALSRGEQG--LLDRALPEF--ERPLLEAALQHTRGHKQEAAALLGWGRNTLTRKL 460
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
1-444 1.39e-119

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099 [Multi-domain]  Cd Length: 457  Bit Score: 359.93  E-value: 1.39e-119
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSI 80
Cdd:PRK11361   9 IVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHETRTPVILMTAYAEV 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASkLKNDVDNKNQ----NYQ--GFIGSSQTMQAVYRTIDSAASSKA 154
Cdd:PRK11361  89 ETAVEALRCGAFDYVIKPFDLDELNLIVQRALQLQS-MKKEIRHLHQalstSWQwgHILTNSPAMMDICKDTAKIALSQA 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  155 SIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELC 234
Cdd:PRK11361 168 SVLISGESGTGKELIARAIHYNSRRAKGPFIKVNCAALPESLLESELFGHEKGAFTGAQTLRQGLFERANEGTLLLDEIG 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  235 EMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIA 314
Cdd:PRK11361 248 EMPLVLQAKLLRILQEREFERIGGHQTIKVDIRIIAATNRDLQAMVKEGTFREDLFYRLNVIHLILPPLRDRREDISLLA 327
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  315 YSLLGFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLNQMSAPINRALPLAHEN 394
Cdd:PRK11361 328 NHFLQKFSSENQRDIIDIDPMAMSLLTAWSWPGNIRELSNVIERAVVMNSGPIIFSEDLPPQIRQPVCNAGEVKTAPVGE 407
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|
gi 50401172  395 KVSVHEIFplwMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQTW 444
Cdd:PRK11361 408 RNLKEEIK---RVEKRIIMEVLEQQEGNRTRTALMLGISRRALMYKLQEY 454
RocR COG3829
Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding Fis domains ...
112-443 7.68e-119

Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding Fis domains [Transcription, Signal transduction mechanisms];


Pssm-ID: 226350 [Multi-domain]  Cd Length: 560  Bit Score: 361.62  E-value: 7.68e-119
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 112 IRKASKLKNDVDNknQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAA 191
Cdd:COG3829 229 LEESEGLLRLKAK--YTFDDIIGESPAMLRVLELAKRIAKTDSTVLILGESGTGKELFARAIHNLSPRANGPFIAINCAA 306
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 192 IPKDLIESELFGHVKGAFTGA-ATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVC 270
Cdd:COG3829 307 IPETLLESELFGYEKGAFTGAsKGGKPGLFELANGGTLFLDEIGEMPLPLQAKLLRVLQEKEIERVGGTKPIPVDVRIIA 386
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 271 ATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKDFVRLSAEVVERFRQYEWPGNVR 350
Cdd:COG3829 387 ATNRNLEKMIAEGTFREDLYYRLNVIPITIPPLRERKEDIPLLAEYFLDKFSRRYGRNVKGLSPDALALLLRYDWPGNVR 466
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 351 QLQNVL-RNVVVLNEGREITLDMLPP-------PLNQMSAPIN-RALPLAHENkvsvheifplwmTEKQAIEQAIEACDG 421
Cdd:COG3829 467 ELENVIeRAVNLVESDGLIDADDLPAfaleekePRPETTKQIEvGSLKEALEE------------YEKHLIREALERHGG 534
                       330       340
                ....*....|....*....|..
gi 50401172 422 NIPRAATYLDVSPSTIYRKLQT 443
Cdd:COG3829 535 NKSKAAKELGISRTTLYRKLKK 556
PEP_resp_reg TIGR02915
PEP-CTERM-box response regulator transcription factor; Members of this protein family share ...
20-438 6.59e-116

PEP-CTERM-box response regulator transcription factor; Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see SP|Q06065). These proteins have a Fis family DNA binding sequence (pfam02954), a response regulator receiver domain (pfam00072), and sigma-54 interaction domain (pfam00158). [Regulatory functions, DNA interactions]


Pssm-ID: 274348 [Multi-domain]  Cd Length: 445  Bit Score: 350.20  E-value: 6.59e-116
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    20 DIDINIVGTGRDAIESIGRREPDLILLDLRLPD-----MTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDF 94
Cdd:TIGR02915  20 DYELAVAADRESAIALVRRHEPAVVTLDLGLPPdadgaSEGLAALQQILAIAPDTKVIVITGNDDRENAVKAIGLGAYDF 99
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    95 LIKPCEADRLRVTVNNAIRKAS------KLKNDVDNknQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEV 168
Cdd:TIGR02915 100 YQKPIDPDVLKLIVDRAFHLYTletenrRLQSALGG--TALRGLITSSPGMQKICRTIEKIAPSDITVLLLGESGTGKEV 177
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   169 CAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFI 248
Cdd:TIGR02915 178 LARALHQLSDRKDKRFVAINCAAIPENLLESELFGYEKGAFTGAVKQTLGKIEYAHGGTLFLDEIGDLPLNLQAKLLRFL 257
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   249 QTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKD 328
Cdd:TIGR02915 258 QERVIERLGGREEIPVDVRIVCATNQDLKRMIAEGTFREDLFYRIAEISITIPPLRSRDGDAVLLANAFLERFARELKRK 337
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   329 FVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLP-PPLNQMSAPINRALPLAHENkvsvheifplwmT 407
Cdd:TIGR02915 338 TKGFTDDALRALEAHAWPGNVRELENKVKRAVIMAEGNQITAEDLGlDARERAETPLEVNLREVRER------------A 405
                         410       420       430
                  ....*....|....*....|....*....|.
gi 50401172   408 EKQAIEQAIEACDGNIPRAATYLDVSPSTIY 438
Cdd:TIGR02915 406 EREAVRKAIARVDGNIARAAELLGITRPTLY 436
PRK10365 PRK10365
transcriptional regulatory protein ZraR; Provisional
1-441 6.66e-114

transcriptional regulatory protein ZraR; Provisional


Pssm-ID: 182412 [Multi-domain]  Cd Length: 441  Bit Score: 345.09  E-value: 6.66e-114
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSI 80
Cdd:PRK10365  10 VVDDDISHCTILQALLRGWGYNVALANSGRQALEQVREQVFDLVLCDVRMAEMDGIATLKEIKALNPAIPVLIMTAYSSV 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKNDVDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITG 160
Cdd:PRK10365  90 ETAVEALKTGALDYLIKPLDFDNLQATLEKALAHTHSIDAETPAVTASQFGMVGKSPAMQHLLSEIALVAPSEATVLIHG 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  161 ESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLDL 240
Cdd:PRK10365 170 DSGTGKELVARAIHASSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRFVEADGGTLFLDEIGDISPMM 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  241 QTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGF 320
Cdd:PRK10365 250 QVRLLRAIQEREVQRVGSNQTISVDVRLIAATHRDLAAEVNAGRFRQDLYYRLNVVAIEVPSLRQRREDIPLLAGHFLQR 329
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  321 MSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPpplnqmSAPINRALPLAHEnkvsvHE 400
Cdd:PRK10365 330 FAERNRKAVKGFTPQAMDLLIHYDWPGNIRELENAVERAVVLLTGEYISERELP------LAIASTPIPLGQS-----QD 398
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|.
gi 50401172  401 IFPLWMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKL 441
Cdd:PRK10365 399 IQPLVEVEKEVILAALEKTGGNKTEAARQLGITRKTLLAKL 439
FhlA COG3604
Transcriptional regulator containing GAF, AAA-type ATPase, and DNA-binding Fis domains ...
131-442 1.19e-111

Transcriptional regulator containing GAF, AAA-type ATPase, and DNA-binding Fis domains [Transcription, Signal transduction mechanisms];


Pssm-ID: 226132 [Multi-domain]  Cd Length: 550  Bit Score: 342.78  E-value: 1.19e-111
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 131 GFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFT 210
Cdd:COG3604 224 GIIGRSPAMRQLLKEIEVVAKSDSTVLIRGETGTGKELVARAIHQLSPRRDKPFVKLNCAALPESLLESELFGHEKGAFT 303
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 211 GAATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLY 290
Cdd:COG3604 304 GAINTRRGRFELADGGTLFLDEIGELPLALQAKLLRVLQEGEIERVGGDRTIKVDVRVIAATNRDLEEMVRDGEFRADLY 383
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 291 YRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLN-----EG 365
Cdd:COG3604 384 YRLSVFPLELPPLRERPEDIPLLAGYFLEKFRRRLGRAILSLSAEALELLSSYEWPGNVRELENVVERAVLLAgrltrRG 463
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 366 REITL-----DMLPPPLNQM--SAPINRALPLAHENKVSVHEifplwmTEKQAIEQAIEACDGNIPRAATYLDVSPSTIY 438
Cdd:COG3604 464 DLCTLelslsALLWKTLPAPepSALPEPALPGEHTLREATEE------FERQLIIAALEETNGNWAGAARRLGLTRRTLL 537

                ....
gi 50401172 439 RKLQ 442
Cdd:COG3604 538 YRMK 541
glnG PRK10923
nitrogen regulation protein NR(I); Provisional
1-442 3.31e-111

nitrogen regulation protein NR(I); Provisional


Pssm-ID: 182842 [Multi-domain]  Cd Length: 469  Bit Score: 338.77  E-value: 3.31e-111
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSI 80
Cdd:PRK10923   8 VVDDDSSIRWVLERALAGAGLTCTTFENGNEVLEALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDL 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIrkaSKLKNDVDNKNQNYQG----FIGSSQTMQAVYRTIDSAASSKASI 156
Cdd:PRK10923  88 DAAVSAYQQGAFDYLPKPFDIDEAVALVERAI---SHYQEQQQPRNIQVNGpttdIIGEAPAMQDVFRIIGRLSRSSISV 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  157 FITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEM 236
Cdd:PRK10923 165 LINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQADGGTLFLDEIGDM 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  237 DLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYS 316
Cdd:PRK10923 245 PLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLEQRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPRLARH 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  317 LLGFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLNQMSAPIN----------- 385
Cdd:PRK10923 325 FLQVAARELGVEAKLLHPETEAALTRLAWPGNVRQLENTCRWLTVMAAGQEVLIQDLPGELFESTVPEStsqmqpdswat 404
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 50401172  386 -------RALPLAHENKVSvhEIFPLWmtEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQ 442
Cdd:PRK10923 405 llaqwadRALRSGHQNLLS--EAQPEL--ERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLK 464
PRK05022 PRK05022
anaerobic nitric oxide reductase transcription regulator; Provisional
107-439 4.52e-103

anaerobic nitric oxide reductase transcription regulator; Provisional


Pssm-ID: 235331 [Multi-domain]  Cd Length: 509  Bit Score: 319.04  E-value: 4.52e-103
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  107 TVNNAIR------KASKLKNDVDNKNQNYQG---FIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAAS 177
Cdd:PRK05022 155 TLRNALLieqlesQAELPQDVAEFLRQEALKegeMIGQSPAMQQLKKEIEVVAASDLNVLILGETGVGKELVARAIHAAS 234
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  178 KRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVG 257
Cdd:PRK05022 235 PRADKPLVYLNCAALPESLAESELFGHVKGAFTGAISNRSGKFELADGGTLFLDEIGELPLALQAKLLRVLQYGEIQRVG 314
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  258 SSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDV-------IEIAYSLLGFMSkeegkdfV 330
Cdd:PRK05022 315 SDRSLRVDVRVIAATNRDLREEVRAGRFRADLYHRLSVFPLSVPPLRERGDDVlllagyfLEQNRARLGLRS-------L 387
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  331 RLSAEVVERFRQYEWPGNVRQLQNVLRNVVVL----NEGREITL---DMLPPPLNQMSAPINRALPLAHEN---KVSVhE 400
Cdd:PRK05022 388 RLSPAAQAALLAYDWPGNVRELEHVISRAALLararGAGRIVTLeaqHLDLPAEVALPPPEAAAAPAAVVSqnlREAT-E 466
                        330       340       350
                 ....*....|....*....|....*....|....*....
gi 50401172  401 IFplwmtEKQAIEQAIEACDGNIPRAATYLDVSPSTIYR 439
Cdd:PRK05022 467 AF-----QRQLIRQALAQHQGNWAAAARALELDRANLHR 500
PRK15115 PRK15115
response regulator GlrR; Provisional
1-362 1.04e-99

response regulator GlrR; Provisional


Pssm-ID: 185070 [Multi-domain]  Cd Length: 444  Bit Score: 308.30  E-value: 1.04e-99
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSI 80
Cdd:PRK15115  10 LVDDDPGLLKLLGMRLTSEGYSVVTAESGQEALRVLNREKVDLVISDLRMDEMDGMQLFAEIQKVQPGMPVIILTAHGSI 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKNDvdnknQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITG 160
Cdd:PRK15115  90 PDAVAATQQGVFSFLTKPVDRDALYKAIDDALEQSAPATDE-----RWREAIVTRSPLMLRLLEQARMVAQSDVSVLING 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  161 ESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLDL 240
Cdd:PRK15115 165 QSGTGKEILAQAIHNASPRASKPFIAINCGALPEQLLESELFGHARGAFTGAVSNREGLFQAAEGGTLFLDEIGDMPAPL 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  241 QTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGf 320
Cdd:PRK15115 245 QVKLLRVLQERKVRPLGSNRDIDIDVRIISATHRDLPKAMARGEFREDLYYRLNVVSLKIPALAERTEDIPLLANHLLR- 323
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|...
gi 50401172  321 MSKEEGKDFVR-LSAEVVERFRQYEWPGNVRQLQNVLRNVVVL 362
Cdd:PRK15115 324 QAAERHKPFVRaFSTDAMKRLMTASWPGNVRQLVNVIEQCVAL 366
nifA TIGR01817
Nif-specific regulatory protein; This model represents NifA, a DNA-binding regulatory protein ...
131-445 5.39e-92

Nif-specific regulatory protein; This model represents NifA, a DNA-binding regulatory protein for nitrogen fixation. The model produces scores between the trusted and noise cutoffs for a well-described NifA homolog in Aquifex aeolicus (which lacks nitrogenase), for transcriptional activators of alternative nitrogenases (VFe or FeFe instead of MoFe), and truncated forms. [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, DNA interactions]


Pssm-ID: 273817 [Multi-domain]  Cd Length: 534  Bit Score: 291.23  E-value: 5.39e-92
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   131 GFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFT 210
Cdd:TIGR01817 197 GIIGKSPAMRQVVDQARVVARSNSTVLLRGESGTGKELIAKAIHYLSPRAKRPFVKVNCAALSETLLESELFGHEKGAFT 276
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   211 GAATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLY 290
Cdd:TIGR01817 277 GAIAQRKGRFELADGGTLFLDEIGEISPAFQAKLLRVLQEGEFERVGGNRTLKVDVRLVAATNRDLEEAVAKGEFRADLY 356
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   291 YRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKDfVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITL 370
Cdd:TIGR01817 357 YRINVVPIFLPPLRERREDIPLLAEAFLEKFNRENGRP-LTITPSAIRVLMSCKWPGNVRELENCLERTATLSRSGTITR 435
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   371 DMLPPPLNQmsapiNRALPLAHENKVSVHEIFPLWMT-----------------------EKQAIEQAIEACDGNIPRAA 427
Cdd:TIGR01817 436 SDFSCQSGQ-----CLSPMLAKTCPHGHISIDPLAGTtpphspasaalpgepglsgptlsERERLIAALEQAGWVQAKAA 510
                         330
                  ....*....|....*...
gi 50401172   428 TYLDVSPSTIYRKLQTWN 445
Cdd:TIGR01817 511 RLLGMTPRQVGYALRKLN 528
AcoR COG3284
Transcriptional regulator of acetoin/glycerol metabolism [Transcription];
140-441 1.05e-87

Transcriptional regulator of acetoin/glycerol metabolism [Transcription];


Pssm-ID: 225822 [Multi-domain]  Cd Length: 606  Bit Score: 281.94  E-value: 1.05e-87
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 140 QAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRgDKPFIAINCAAIPKDLIESELFGHVKGAFTGA-ATERQG 218
Cdd:COG3284 323 ATLLRKAERVAATDLPVLLQGETGTGKEVLARAIHQNSEA-AGPFVAVNCAAIPEALIESELFGYVAGAFTGArRKGYKG 401
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 219 AAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKsVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPL 298
Cdd:COG3284 402 KLEQADGGTLFLDEIGDMPLALQSRLLRVLQEGVVTPLGGTRIK-VDIRVIAATHRDLAQLVEQGRFREDLYYRLNAFVI 480
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 299 HLPPLRARGDDVIEIAYSLlgfmsKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLN 378
Cdd:COG3284 481 TLPPLRERSDRIPLLDRIL-----KRENDWRLQLDDDALARLLAYRWPGNIRELDNVIERLAALSDGGRIRVSDLPPELL 555
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 50401172 379 QmsapiNRALPLAHenkvsvheifplwmTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKL 441
Cdd:COG3284 556 E-----EQATPRED--------------IEKAALLAALQATNGNISEAARLLGISRSTLYRKL 599
PspF COG1221
Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain ...
130-442 9.11e-86

Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription, Signal transduction mechanisms];


Pssm-ID: 224142 [Multi-domain]  Cd Length: 403  Bit Score: 270.79  E-value: 9.11e-86
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 130 QGFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHA-ASKRGDKPFIAINCAAIPKDLIESELFGHVKGA 208
Cdd:COG1221  78 DDLIGESPSLQELREQIKAYAPSGLPVLIIGETGTGKELFARLIHAlSARRAEAPFIAFNCAAYSENLQEAELFGHEKGA 157
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 209 FTGAATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGrfrED 288
Cdd:COG1221 158 FTGAQGGKAGLFEQANGGTLFLDEIHRLPPEGQEKLLRVLEEGEYRRVGGSQPRPVDVRLICATTEDLEEAVLAG---AD 234
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 289 LYYRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREI 368
Cdd:COG1221 235 LTRRLNILTITLPPLRERKEDILLLAEHFLKSEARRLGLPLSVDSPEALRALLAYDWPGNIRELKNLVERAVAQASGEGQ 314
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 369 TLDMLPPPLNQMSAPINRALPLAHENKVSV-HEIFPLWMTEKQAIEQ-----AIEACDGNIPRAATYLDVSPSTIYRKLQ 442
Cdd:COG1221 315 DLEDLIISIRLDELPGLNDVPAGISLQLNLpELPLSLRETSLEQVEErllqkALEQNKGNKKKAARLLGISRKTLRYRLK 394
TyrR COG3283
Transcriptional regulator of aromatic amino acids metabolism [Transcription, Amino acid ...
106-369 3.21e-80

Transcriptional regulator of aromatic amino acids metabolism [Transcription, Amino acid transport and metabolism];


Pssm-ID: 225821 [Multi-domain]  Cd Length: 511  Bit Score: 259.68  E-value: 3.21e-80
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 106 VTVNNAIRKASKLKNDVDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFI 185
Cdd:COG3283 180 VMLRSTNRMGEQLQNVAAQDVSGFEQIVAVSPKMKHVVEQAQKLAMLDAPLLITGETGTGKDLLAKACHLASPRHSKPFL 259
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 186 AINCAAIPKDLIESELFGHVKGAftgaaTERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVD 265
Cdd:COG3283 260 ALNCASLPEDAAESELFGHAPGD-----EGKKGFFEQANGGTVLLDEIGEMSPRLQAKLLRFLNDGTFRRVGEDHEVHVD 334
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 266 VRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKDFVRLSAEVVERFRQYEW 345
Cdd:COG3283 335 VRVICATQVNLVELVQKGKFREDLFYRLNVLTLNLPPLRERPQDIMPLAELFVQQFSDELGVPRPKLAADLLTVLTRYAW 414
                       250       260
                ....*....|....*....|....
gi 50401172 346 PGNVRQLQNVLRNVVVLNEGREIT 369
Cdd:COG3283 415 PGNVRQLKNAIYRALTLLEGYELR 438
phageshock_pspF TIGR02974
psp operon transcriptional activator PspF; Members of this protein family are PspF, the ...
133-430 1.11e-78

psp operon transcriptional activator PspF; Members of this protein family are PspF, the sigma-54-dependent transcriptional activator of the phage shock protein (psp) operon, in Escherichia coli and numerous other species. The psp operon is induced by a number of stress conditions, including heat shock, ethanol, and filamentous phage infection. Changed com_name to adhere to TIGR role notes conventions. 09/15/06 - DMH [Regulatory functions, DNA interactions]


Pssm-ID: 274371 [Multi-domain]  Cd Length: 329  Bit Score: 249.91  E-value: 1.11e-78
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   133 IGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGA 212
Cdd:TIGR02974   2 IGESNAFLEVLEQVSRLAPLDRPVLIIGERGTGKELIAARLHYLSKRWQGPLVKLNCAALSENLLDSELFGHEAGAFTGA 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   213 ATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYR 292
Cdd:TIGR02974  82 QKRHQGRFERADGGTLFLDELATASLLVQEKLLRVIEYGEFERVGGSQTLQVDVRLVCATNADLPALAAEGRFRADLLDR 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   293 LYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKD-FVRLSAEVVERFRQYEWPGNVRQLQNVL-RNVVVLNEG----R 366
Cdd:TIGR02974 162 LAFDVITLPPLRERQEDIMLLAEHFAIRMARELGLPlFPGFTPQAREQLLEYHWPGNVRELKNVVeRSVYRHGLEeapiD 241
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 50401172   367 EITLDmlP------PPLNQMSAPINRALPLAHENKVSVHEIFPL----WMT--EKQAIEQAIEACDGNIPRAATYL 430
Cdd:TIGR02974 242 EIIID--PfaspwrPKQAAPAVDEVNSTPTDLPSPSSIAAAFPLdlkqAQQdyEIELLQQALAEAQFNQRKAAELL 315
propionate_PrpR TIGR02329
propionate catabolism operon regulatory protein PrpR; At least five distinct pathways exists ...
80-442 4.53e-75

propionate catabolism operon regulatory protein PrpR; At least five distinct pathways exists for the catabolism of propionate by way of propionyl-CoA. Members of this family represent the transcriptional regulatory protein PrpR, whose gene is found in most cases divergently transcribed from an operon for the methylcitric acid cycle of propionate catabolism. 2-methylcitric acid, a catabolite by this pathway, is a coactivator of PrpR. [Regulatory functions, DNA interactions]


Pssm-ID: 274079 [Multi-domain]  Cd Length: 526  Bit Score: 246.31  E-value: 4.53e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    80 IDTAVEAMRHGAqdFLIkpcEADRLRVTVNNAI--------RKASKLKNDVDNKNQN-YQ--GFIGSSQTMQAVYRTIDS 148
Cdd:TIGR02329 156 TDLAEQAGLHGV--FLY---SADSVRQAFDDALdvaratrlRQAATLRSATRNQLRTrYRldDLLGASAPMEQVRALVRL 230
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   149 AASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATE-RQGAAEAADGGT 227
Cdd:TIGR02329 231 YARSDATVLILGESGTGKELVAQAIHQLSGRRDFPFVAINCGAIAESLLEAELFGYEEGAFTGARRGgRTGLIEAAHRGT 310
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   228 LFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARG 307
Cdd:TIGR02329 311 LFLDEIGEMPLPLQTRLLRVLEEREVVRVGGTEPVPVDVRVVAATHCALTTAVQQGRFRRDLFYRLSILRIALPPLRERP 390
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   308 DDVIEIAYSLL----GFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVV---LNEGREITLDML---PPPL 377
Cdd:TIGR02329 391 GDILPLAAEYLvqaaAALRLPDSEAAAQVLAGVADPLQRYPWPGNVRELRNLVERLALelsAMPAGALTPDVLralAPEL 470
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 50401172   378 NQMSAPINRALPLAHENKvsvheifplwMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQ 442
Cdd:TIGR02329 471 AEASGKGKTSALSLRERS----------RVEALAVRAALERFGGDRDAAAKALGISRTTLWRRLK 525
PRK15429 PRK15429
formate hydrogenlyase transcriptional activator FhlA; Provisional
101-444 5.40e-75

formate hydrogenlyase transcriptional activator FhlA; Provisional


Pssm-ID: 237965 [Multi-domain]  Cd Length: 686  Bit Score: 250.13  E-value: 5.40e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  101 ADRLRVTVNNAI--RKASKLKN-----------DVDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKE 167
Cdd:PRK15429 334 AERVAIAVDNALayQEIHRLKErlvdenlalteQLNNVDSEFGEIIGRSEAMYSVLKQVEMVAQSDSTVLILGETGTGKE 413
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  168 VCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRF 247
Cdd:PRK15429 414 LIARAIHNLSGRNNRRMVKMNCAAMPAGLLESDLFGHERGAFTGASAQRIGRFELADKSSLFLDEVGDMPLELQPKLLRV 493
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  248 IQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGK 327
Cdd:PRK15429 494 LQEQEFERLGSNKIIQTDVRLIAATNRDLKKMVADREFRSDLYYRLNVFPIHLPPLRERPEDIPLLVKAFTFKIARRMGR 573
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  328 DFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDmLPP--PLNQMSAPINRALPLAHENkvsvheifplw 405
Cdd:PRK15429 574 NIDSIPAETLRTLSNMEWPGNVRELENVIERAVLLTRGNVLQLS-LPDitLPEPETPPAATVVAQEGED----------- 641
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|..
gi 50401172  406 mtEKQAIEQAIEACDGNI--PR-AATYLDVSPSTIYRKLQTW 444
Cdd:PRK15429 642 --EYQLIVRVLKETNGVVagPKgAAQRLGLKRTTLLSRMKRL 681
PRK10820 PRK10820
DNA-binding transcriptional regulator TyrR; Provisional
106-375 5.60e-75

DNA-binding transcriptional regulator TyrR; Provisional


Pssm-ID: 236769 [Multi-domain]  Cd Length: 520  Bit Score: 246.14  E-value: 5.60e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  106 VTVNNAIRKASKLKNDVDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFI 185
Cdd:PRK10820 180 VMLRSTARMGRQLQNLAVNDDSAFSQIVAVSPKMRQVVEQARKLAMLDAPLLITGDTGTGKDLLAYACHLRSPRGKKPFL 259
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  186 AINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVD 265
Cdd:PRK10820 260 ALNCASIPDDVVESELFGHAPGAYPNALEGKKGFFEQANGGSVLLDEIGEMSPRMQAKLLRFLNDGTFRRVGEDHEVHVD 339
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  266 VRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKDFVRLSAEVVERFRQYEW 345
Cdd:PRK10820 340 VRVICATQKNLVELVQKGEFREDLYYRLNVLTLNLPPLRDRPQDIMPLTELFVARFADEQGVPRPKLAADLNTVLTRYGW 419
                        250       260       270
                 ....*....|....*....|....*....|.
gi 50401172  346 PGNVRQLQNVLRNVVVLNEGREITL-DMLPP 375
Cdd:PRK10820 420 PGNVRQLKNAIYRALTQLEGYELRPqDILLP 450
PRK15424 PRK15424
propionate catabolism operon regulatory protein PrpR; Provisional
102-442 9.56e-74

propionate catabolism operon regulatory protein PrpR; Provisional


Pssm-ID: 237963 [Multi-domain]  Cd Length: 538  Bit Score: 243.09  E-value: 9.56e-74
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  102 DRLRVTVNNAIRKASKLKNdvdnknqnyqgFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAA----- 176
Cdd:PRK15424 202 HNTHYATRNALRTRYVLGD-----------LLGQSPQMEQVRQTILLYARSSAAVLIQGETGTGKELAAQAIHREyfarh 270
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  177 ----SKRGdKPFIAINCAAIPKDLIESELFGHVKGAFTGAATE-RQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTG 251
Cdd:PRK15424 271 darqGKKS-HPFVAVNCGAIAESLLEAELFGYEEGAFTGSRRGgRAGLFEIAHGGTLFLDEIGEMPLPLQTRLLRVLEEK 349
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  252 TFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDvieIAYSLLGFMSKEEGKDFVR 331
Cdd:PRK15424 350 EVTRVGGHQPVPVDVRVISATHCDLEEDVRQGRFRRDLFYRLSILRLQLPPLRERVAD---ILPLAESFLKQSLAALSAP 426
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  332 LSAEVVERFRQ-------YEWPGNVRQLQNVL-RNVVVLNEGREITLDmlPPPLNQMSAPINRALPLAHENkvsvheifp 403
Cdd:PRK15424 427 FSAALRQGLQQcetlllhYDWPGNVRELRNLMeRLALFLSVEPTPDLT--PQFLQLLLPELARESAKTPAP--------- 495
                        330       340       350
                 ....*....|....*....|....*....|....*....
gi 50401172  404 lwMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQ 442
Cdd:PRK15424 496 --RLLAATLQQALERFNGDKTAAANYLGISRTTLWRRLK 532
pspF PRK11608
phage shock protein operon transcriptional activator; Provisional
156-433 7.97e-64

phage shock protein operon transcriptional activator; Provisional


Pssm-ID: 236936 [Multi-domain]  Cd Length: 326  Bit Score: 211.07  E-value: 7.97e-64
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  156 IFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCE 235
Cdd:PRK11608  32 VLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNENLLDSELFGHEAGAFTGAQKRHPGRFERADGGTLFLDELAT 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  236 MDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAY 315
Cdd:PRK11608 112 APMLVQEKLLRVIEYGELERVGGSQPLQVNVRLVCATNADLPAMVAEGKFRADLLDRLAFDVVQLPPLRERQSDIMLMAE 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  316 SLLGFMSKEEGKD-FVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLD-MLPPPLNQMSAPINRALPLAHE 393
Cdd:PRK11608 192 HFAIQMCRELGLPlFPGFTERARETLLNYRWPGNIRELKNVVERSVYRHGTSEYPLDnIIIDPFKRRPAEEAIAVSETTS 271
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 50401172  394 NKVsvheiFPL----WM--TEKQAIEQAIEACDGNIPRAATYLDVS 433
Cdd:PRK11608 272 LPT-----LPLdlreWQhqQEKELLQRSLQQAKFNQKRAAELLGLT 312
PRK11388 PRK11388
DNA-binding transcriptional regulator DhaR; Provisional
102-441 2.48e-57

DNA-binding transcriptional regulator DhaR; Provisional


Pssm-ID: 183114 [Multi-domain]  Cd Length: 638  Bit Score: 201.06  E-value: 2.48e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  102 DRLRVTVNNAIRKASklkndvdnknQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGD 181
Cdd:PRK11388 307 EQMRQLMTSQLGKVS----------HTFDHMPQDSPQMRRLIHFGRQAAKSSFPVLLCGEEGVGKALLAQAIHNESERAA 376
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  182 KPFIAINCAAIPKDLIESELFGhvkGAFTGAATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKM 261
Cdd:PRK11388 377 GPYIAVNCQLYPDEALAEEFLG---SDRTDSENGRLSKFELAHGGTLFLEKVEYLSPELQSALLQVLKTGVITRLDSRRL 453
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  262 KSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKDFvRLSAEVVERFR 341
Cdd:PRK11388 454 IPVDVRVIATTTADLAMLVEQNRFSRQLYYALHAFEITIPPLRMRREDIPALVNNKLRSLEKRFSTRL-KIDDDALARLV 532
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  342 QYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLNQMSAPINRALPLAHENkVSVHEIfplwmtEKQAIEQAIEACDG 421
Cdd:PRK11388 533 SYRWPGNDFELRSVIENLALSSDNGRIRLSDLPEHLFTEQATDDVSATRLSTS-LSLAEL------EKEAIINAAQVCGG 605
                        330       340
                 ....*....|....*....|
gi 50401172  422 NIPRAATYLDVSPSTIYRKL 441
Cdd:PRK11388 606 RIQEMAALLGIGRTTLWRKM 625
RtcR COG4650
Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a ...
149-391 1.41e-40

Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription, Signal transduction mechanisms];


Pssm-ID: 226997 [Multi-domain]  Cd Length: 531  Bit Score: 152.01  E-value: 1.41e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 149 AASSKASIFITGESGTGKEVCAEAIHA---ASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADG 225
Cdd:COG4650 204 AIRSRAPILLNGPTGAGKSFLARRIYElkqARHQFSGAFVEVNCATLRGDTAMSALFGHVKGAFTGARESREGLLRSADG 283
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 226 GTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRA 305
Cdd:COG4650 284 GMLFLDEIGELGADEQAMLLKAIEEKRFYPFGSDRQVSSDFQLIAGTVRDLRQLVAEGKFREDLYARINLWTFTLPGLRQ 363
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 306 RGDDV-IEIAYSLLGFmSKEEGkDFVRLSAEVVERF------RQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLN 378
Cdd:COG4650 364 RQEDIePNLDYELERH-ASLTG-DSVRFNTEARRAWlafatsPQATWRGNFRELSASVTRMATLADSGRITLDVVEDEIN 441
                       250
                ....*....|...
gi 50401172 379 QMSAPINRALPLA 391
Cdd:COG4650 442 RLRYNWQESRPSA 454
OmpR COG0745
DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain ...
2-124 2.44e-21

DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 91.59  E-value: 2.44e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIgRREPDLILLDLRLPDMTGMDVLYAVKEKS-PDVPIVFMTAHGSI 80
Cdd:COG0745   6 VEDDPELAELLKEYLEEEGYEVDVAADGEEALEAA-REQPDLVLLDLMLPDLDGLELCRRLRAKKgSGPPIIVLTARDDE 84
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....
gi 50401172  81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKNDVDN 124
Cdd:COG0745  85 EDRVLGLEAGADDYLTKPFSPRELLARLRALLRRNAGASRAEAS 128
CitB COG4565
Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms] ...
2-120 1.58e-19

Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms];


Pssm-ID: 226931 [Multi-domain]  Cd Length: 224  Bit Score: 86.15  E-value: 1.58e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDiDINIVGT---GRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHG 78
Cdd:COG4565   6 IEDDPMVAEIHRRYVKQIP-GFSVVGTagtLEEAKMIIEEFKPDLILLDIYMPDGNGIELLPELRSQHYPVDVIVITAAS 84
                        90       100       110       120
                ....*....|....*....|....*....|....*....|..
gi 50401172  79 SIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKN 120
Cdd:COG4565  85 DMETIKEALRYGVVDYLIKPFTFERLQQALTRYRQKRHALES 126
CitB COG2197
DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains [Signal ...
1-117 1.31e-18

DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 225107 [Multi-domain]  Cd Length: 211  Bit Score: 83.51  E-value: 1.31e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   1 MVEDTASVAALYRSYLTpLDIDINIVGT---GRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAH 77
Cdd:COG2197   5 IVDDHPLVREGLRQLLE-LEPDLEVVGEasnGEEALDLARELKPDVVLLDLSMPGMDGLEALKQLRARGPDIKVVVLTAH 83
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 50401172  78 GSIDTAVEAMRHGAQDFLIKPCEADRLrvtvNNAIRKASK 117
Cdd:COG2197  84 DDPAYVIRALRAGADGYLLKDASPEEL----VEAIRAVAA 119
FixJ COG4566
Two-component response regulator, FixJ family, consists of REC and HTH domains [Signal ...
40-128 2.77e-18

Two-component response regulator, FixJ family, consists of REC and HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226932 [Multi-domain]  Cd Length: 202  Bit Score: 82.34  E-value: 2.77e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  40 EPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLK 119
Cdd:COG4566  48 RPGCLLLDVRMPGMSGLELQDRLAERGIRLPVIFLTGHGDIPMAVQAMKAGAVDFLEKPFSEQDLLDAVERALARDASRR 127

                ....*....
gi 50401172 120 NDVDNKNQN 128
Cdd:COG4566 128 AEADRQAAI 136
YesN COG4753
Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding ...
22-114 2.90e-17

Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 227095 [Multi-domain]  Cd Length: 475  Bit Score: 82.79  E-value: 2.90e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  22 DINIVGT---GRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKP 98
Cdd:COG4753  27 GIEVVGTaanGKEALELIQETQPDIVITDINMPGMDGLDLIKAIKEQSPDTEFIILSGYDEFEYAKKAMKLGVKDYLLKP 106
                        90
                ....*....|....*.
gi 50401172  99 CEADRLRVTVNNAIRK 114
Cdd:COG4753 107 VDKAELEEALKKIIGK 122
fixJ PRK09390
response regulator FixJ; Provisional
33-115 2.93e-16

response regulator FixJ; Provisional


Pssm-ID: 181815 [Multi-domain]  Cd Length: 202  Bit Score: 76.58  E-value: 2.93e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   33 IESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAI 112
Cdd:PRK09390  40 LDALPGLRFGCVVTDVRMPGIDGIELLRRLKARGSPLPVIVMTGHGDVPLAVEAMKLGAVDFIEKPFEDERLIGAIERAL 119

                 ...
gi 50401172  113 RKA 115
Cdd:PRK09390 120 AQA 122
COG4567 COG4567
Two-component response regulator, ActR/RegA family, consists of REC and Fis-type HTH domains ...
3-102 5.43e-14

Two-component response regulator, ActR/RegA family, consists of REC and Fis-type HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226933 [Multi-domain]  Cd Length: 182  Bit Score: 69.37  E-value: 5.43e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   3 EDTASVAALYRSyLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDT 82
Cdd:COG4567  17 DDTPFLRTLARA-MERRGFAVVTAESVEEALAAARTAPPAYAVVDLKLGDGSGLAVIEALRERRADMRIVVLTGYASIAT 95
                        90       100
                ....*....|....*....|
gi 50401172  83 AVEAMRHGAQDFLIKPCEAD 102
Cdd:COG4567  96 AVEAVKLGACDYLAKPADAD 115
PRK10651 PRK10651
transcriptional regulator NarL; Provisional
16-104 3.23e-13

transcriptional regulator NarL; Provisional


Pssm-ID: 182619 [Multi-domain]  Cd Length: 216  Bit Score: 67.36  E-value: 3.23e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   16 LTPLDIDINIVG---TGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQ 92
Cdd:PRK10651  25 LISMAPDITVVGeasNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNHEEDVVTALKRGAD 104
                         90
                 ....*....|..
gi 50401172   93 DFLIKPCEADRL 104
Cdd:PRK10651 105 GYLLKDMEPEDL 116
cztR_silR_copR TIGR01387
heavy metal response regulator; Members of this family contain a response regulator receiver ...
1-122 3.08e-12

heavy metal response regulator; Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions]


Pssm-ID: 130454 [Multi-domain]  Cd Length: 218  Bit Score: 64.44  E-value: 3.08e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172     1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSI 80
Cdd:TIGR01387   3 VVEDEQKTAEYLQQGLSESGYVVDAASNGRDGLHLALKDDYDLIILDVMLPGMDGWQILQTLRRSGKQTPVLFLTARDSV 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 50401172    81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKNDV 122
Cdd:TIGR01387  83 ADKVKGLDLGADDYLVKPFSFSELLARVRTLLRRSHSLNSTV 124
dpiA PRK10046
two-component response regulator DpiA; Provisional
1-108 3.94e-12

two-component response regulator DpiA; Provisional


Pssm-ID: 182208 [Multi-domain]  Cd Length: 225  Bit Score: 64.27  E-value: 3.94e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYL--TPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHG 78
Cdd:PRK10046   9 IVEDETPLAEMHAEYIrhIPGFSQILLAGNLAQARMMIERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFTTAAS 88
                         90       100       110
                 ....*....|....*....|....*....|
gi 50401172   79 SIDTAVEAMRHGAQDFLIKPCEADRLRVTV 108
Cdd:PRK10046  89 DMETVSEAVRCGVFDYLIKPIAYERLGQTL 118
RpfG COG3437
Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains ...
2-147 8.41e-12

Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains [Signal transduction mechanisms];


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 65.07  E-value: 8.41e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSP---DVPIVFMTAHG 78
Cdd:COG3437  20 VDDEPDNLEALRQLLRMIGYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAEVLNKLKAMSPstrRIPVILLTAYA 99
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  79 SIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKAsklKNDVDNKNQN-YQGFIGSSQTMQAVYRTID 147
Cdd:COG3437 100 DSEDRQRALEAGADDYLSKPISPKELVARVSSHLQLK---RNEDFLLDQNlYLELQELRRRTEELAQIED 166
orf27 CHL00148
Ycf27; Reviewed
1-128 1.29e-11

Ycf27; Reviewed


Pssm-ID: 214376 [Multi-domain]  Cd Length: 240  Bit Score: 63.20  E-value: 1.29e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSpDVPIVFMTAHGSI 80
Cdd:CHL00148  11 VVDDEAYIRKILETRLSIIGYEVITASDGEEALKLFRKEQPDLVILDVMMPKLDGYGVCQEIRKES-DVPIIMLTALGDV 89
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 50401172   81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKNDVDNKNQN 128
Cdd:CHL00148  90 SDRITGLELGADDYVVKPFSPKELEARIRSVLRRTNKKSFSSKIPNSS 137
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
155-293 2.40e-11

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 61.24  E-value: 2.40e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    155 SIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIES---ELFGHVKGAFTGAATERQG--AAEAADGGTLF 229
Cdd:smart00382   4 VILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQlllIIVGGKKASGSGELRLRLAlaLARKLKPDVLI 83
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 50401172    230 LDELCEMDLDLQTKLLRFIQtgtFQKVGSSKMKSVDVRFVCATNR--DPWKEVQEGRFREDLYYRL 293
Cdd:smart00382  84 LDEITSLLDAEQEALLLLLE---ELRLLLLLKSEKNLTVILTTNDekDLGPALLRRRFDRRIVLLL 146
SAPR COG3947
Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains [Signal ...
1-145 3.20e-11

Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226456 [Multi-domain]  Cd Length: 361  Bit Score: 63.34  E-value: 3.20e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGsi 80
Cdd:COG3947   5 IVDDDAAIVKLLSVILSRAGHEVRSCSHPVEALDLLEVFKPDLIFLDIVMPYMNGIEFAEQVRDIESAVPIIFISSHA-- 82
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 50401172  81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKNDVDNKN-QNYQGF-IGSSQTMQAVYRT 145
Cdd:COG3947  83 EYADDSFGMNLDDYLPKPVTPEKLNRAIDRRLKRVELTAEEESGTQiSCFGGTeVVLRQGQQVKWIS 149
PleD COG3706
Two-component response regulator, PleD family, consists of two REC domains and a diguanylate ...
2-113 5.33e-11

Two-component response regulator, PleD family, consists of two REC domains and a diguanylate cyclase (GGDEF) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 62.72  E-value: 5.33e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVK--EKSPDVPIVFMTAHGS 79
Cdd:COG3706 138 VDDDATQRERLRRILQVEGFRVVEATDGEEALLQLAELPPDLVLLDANMPDMDGLELCTRLRqlERTRDIPIILLSSKDD 217
                        90       100       110
                ....*....|....*....|....*....|....
gi 50401172  80 IDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIR 113
Cdd:COG3706 218 DELVVRAFELGVNDYITKPIEEGELRARLRRQLR 251
PRK11697 PRK11697
putative two-component response-regulatory protein YehT; Provisional
22-117 8.03e-11

putative two-component response-regulatory protein YehT; Provisional


Pssm-ID: 236956 [Multi-domain]  Cd Length: 238  Bit Score: 60.63  E-value: 8.03e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   22 DINIVGTGRDAIESIG---RREPDLILLDLRLPDMTGMDVLYAV-KEKSPDvpIVFMTAHGsiDTAVEAMRHGAQDFLIK 97
Cdd:PRK11697  26 DIEIVGECSNAIEAIGaihRLKPDVVFLDIQMPRISGLELVGMLdPEHMPY--IVFVTAFD--EYAIKAFEEHAFDYLLK 101
                         90       100
                 ....*....|....*....|
gi 50401172   98 PCEADRLRVTVNNAIRKASK 117
Cdd:PRK11697 102 PIDPARLAKTLARLRQERSP 121
PRK11083 PRK11083
DNA-binding response regulator CreB; Provisional
29-98 1.15e-10

DNA-binding response regulator CreB; Provisional


Pssm-ID: 236838 [Multi-domain]  Cd Length: 228  Bit Score: 59.98  E-value: 1.15e-10
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 50401172   29 GRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTA-HGSIDTAVeAMRHGAQDFLIKP 98
Cdd:PRK11083  36 GLPALDKLRQQPPDLVILDVGLPDISGFELCRQLLAFHPALPVIFLTArSDEVDRLV-GLEIGADDYVAKP 105
PRK10336 PRK10336
DNA-binding transcriptional regulator QseB; Provisional
1-116 1.32e-10

DNA-binding transcriptional regulator QseB; Provisional


Pssm-ID: 182387 [Multi-domain]  Cd Length: 219  Bit Score: 59.52  E-value: 1.32e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSI 80
Cdd:PRK10336   5 LIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGQREPVLILTARDAL 84
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 50401172   81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKAS 116
Cdd:PRK10336  85 AERVEGLRLGADDYLCKPFALIEVAARLEALMRRTN 120
PRK10693 PRK10693
response regulator of RpoS; Provisional
29-108 1.36e-10

response regulator of RpoS; Provisional


Pssm-ID: 182652 [Multi-domain]  Cd Length: 303  Bit Score: 60.77  E-value: 1.36e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   29 GRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPC-EADRLRVT 107
Cdd:PRK10693   6 GVDALELLGGFTPDLIICDLAMPRMNGIEFVEHLRNRGDQTPVLVISATENMADIAKALRLGVQDVLLKPVkDLNRLREM 85

                 .
gi 50401172  108 V 108
Cdd:PRK10693  86 V 86
LytT COG3279
DNA-binding response regulator, LytR/AlgR family [Transcription, Signal transduction ...
22-170 1.57e-10

DNA-binding response regulator, LytR/AlgR family [Transcription, Signal transduction mechanisms];


Pssm-ID: 225818 [Multi-domain]  Cd Length: 244  Bit Score: 59.68  E-value: 1.57e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  22 DINIVGTGR---DAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGsiDTAVEAMRHGAQDFLIKP 98
Cdd:COG3279  26 DIEIVGEAEngeEALQLLQGLRPDLVFLDIAMPDINGIELAARIRKGDPRPAIVFVTAHD--EYAVAAFEVEALDYLLKP 103
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 50401172  99 CEADRLRVTVNNAIRKA----SKLKNDVDNKNQNYQGFIGSSQTMQAvYRTIDSAASSKASIFITGESGTGKEVCA 170
Cdd:COG3279 104 ISEERLAKTLERLRRYAqlqlLELLADTEKVLRFIPIKGGERIILVP-LDDILYFEAEDKYVRVHTTDGRDLETYL 178
PRK11091 PRK11091
aerobic respiration control sensor protein ArcB; Provisional
1-109 4.49e-10

aerobic respiration control sensor protein ArcB; Provisional


Pssm-ID: 236842 [Multi-domain]  Cd Length: 779  Bit Score: 60.34  E-value: 4.49e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPD---VPIVFMTAH 77
Cdd:PRK11091 530 LVEDIELNVIVARSVLEKLGNSVDVAMTGKEALEMFDPDEYDLVLLDIQLPDMTGLDIARELRERYPRedlPPLVALTAN 609
                         90       100       110
                 ....*....|....*....|....*....|..
gi 50401172   78 GSIDTAvEAMRHGAQDFLIKPCEADRLRVTVN 109
Cdd:PRK11091 610 VLKDKK-EYLDAGMDDVLSKPLSVPALTAMIK 640
PRK10701 PRK10701
DNA-binding transcriptional regulator RstA; Provisional
2-97 7.71e-10

DNA-binding transcriptional regulator RstA; Provisional


Pssm-ID: 236738 [Multi-domain]  Cd Length: 240  Bit Score: 57.72  E-value: 7.71e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVlyaVKEKSP--DVPIVFMTahgS 79
Cdd:PRK10701   7 VEDDAEVGSLIAAYLAKHDIDVTVEPRGDRAEATILREQPDLVLLDIMLPGKDGMTI---CRDLRPkwQGPIVLLT---S 80
                         90       100
                 ....*....|....*....|....
gi 50401172   80 IDTaveAMRH------GAQDFLIK 97
Cdd:PRK10701  81 LDS---DMNHilalemGACDYILK 101
PRK09836 PRK09836
DNA-binding transcriptional activator CusR; Provisional
42-116 1.43e-09

DNA-binding transcriptional activator CusR; Provisional


Pssm-ID: 182102 [Multi-domain]  Cd Length: 227  Bit Score: 56.86  E-value: 1.43e-09
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 50401172   42 DLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKAS 116
Cdd:PRK09836  46 DLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGA 120
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
2-98 1.52e-09

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 56.57  E-value: 1.52e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172     2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVK--EKSPDVPIVFMTAHGS 79
Cdd:TIGR02154   8 VEDEPAIRELIAYNLEKAGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLRrrPETRAIPIIMLTARGE 87
                          90
                  ....*....|....*....
gi 50401172    80 IDTAVEAMRHGAQDFLIKP 98
Cdd:TIGR02154  88 EEDRVRGLETGADDYITKP 106
PRK15479 PRK15479
transcriptional regulatory protein TctD; Provisional
1-116 2.87e-09

transcriptional regulatory protein TctD; Provisional


Pssm-ID: 185376 [Multi-domain]  Cd Length: 221  Bit Score: 55.88  E-value: 2.87e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSI 80
Cdd:PRK15479   5 LAEDNRELAHWLEKALVQNGFAVDCVFDGLAADHLLQSEMYALAVLDINMPGMDGLEVLQRLRKRGQTLPVLLLTARSAV 84
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 50401172   81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKAS 116
Cdd:PRK15479  85 ADRVKGLNVGADDYLPKPFELEELDARLRALLRRSA 120
pleD PRK09581
response regulator PleD; Reviewed
29-98 3.46e-09

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 57.22  E-value: 3.46e-09
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 50401172   29 GRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEkSPD---VPIVFMTAHGSIDTAVEAMRHGAQDFLIKP 98
Cdd:PRK09581  35 GAEAIAICEREQPDIILLDVMMPGMDGFEVCRRLKS-DPAtthIPVVMVTALDDPEDRVRGLEAGADDFLTKP 106
PRK10529 PRK10529
DNA-binding transcriptional activator KdpE; Provisional
30-116 4.17e-09

DNA-binding transcriptional activator KdpE; Provisional


Pssm-ID: 182522 [Multi-domain]  Cd Length: 225  Bit Score: 55.20  E-value: 4.17e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   30 RDAIESiGRREPDLILLDLRLPDMTGMDVLYAVKEKSPdVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADRLRVTVN 109
Cdd:PRK10529  36 RGLLEA-ATRKPDLIILDLGLPDGDGIEFIRDLRQWSA-IPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLR 113

                 ....*..
gi 50401172  110 NAIRKAS 116
Cdd:PRK10529 114 VALRRHS 120
PRK10643 PRK10643
DNA-binding transcriptional regulator BasR; Provisional
24-114 4.17e-09

DNA-binding transcriptional regulator BasR; Provisional


Pssm-ID: 182612 [Multi-domain]  Cd Length: 222  Bit Score: 55.43  E-value: 4.17e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   24 NIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADR 103
Cdd:PRK10643  28 DCASTAREAEALLESGHYSLVVLDLGLPDEDGLHLLRRWRQKKYTLPVLILTARDTLEDRVAGLDVGADDYLVKPFALEE 107
                         90
                 ....*....|.
gi 50401172  104 LRVTVNNAIRK 114
Cdd:PRK10643 108 LHARIRALIRR 118
PRK12555 PRK12555
chemotaxis-specific methylesterase; Provisional
2-98 7.44e-09

chemotaxis-specific methylesterase; Provisional


Pssm-ID: 237135 [Multi-domain]  Cd Length: 337  Bit Score: 55.66  E-value: 7.44e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    2 VEDTASVAALYRSYLTpLDIDINIVGTGRD---AIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPdVPIVFMTAhg 78
Cdd:PRK12555   6 VNDSPLAVEALRRALA-RDPDHEVVWVATDgaqAVERCAAQPPDVILMDLEMPRMDGVEATRRIMAERP-CPILIVTS-- 81
                         90       100
                 ....*....|....*....|....
gi 50401172   79 SIDTAV----EAMRHGAQDFLIKP 98
Cdd:PRK12555  82 LTERNAsrvfEAMGAGALDAVDTP 105
CheB COG2201
Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains ...
2-98 7.97e-09

Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains [Cell motility, Signal transduction mechanisms];


Pssm-ID: 225111 [Multi-domain]  Cd Length: 350  Bit Score: 55.76  E-value: 7.97e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   2 VEDTASVAALYRSYLTPlDIDINIVGT---GRDAIESIGRREPDLILLDLRLPDMTGMDVLyAVKEKSPDVPIVF---MT 75
Cdd:COG2201   7 VDDSALMRKVISDILNS-DPDIEVVGTarnGREAIDKVKKLKPDVITLDVEMPVMDGLEAL-RKIMRLRPLPVIMvssLT 84
                        90       100
                ....*....|....*....|...
gi 50401172  76 AHGSIDTAvEAMRHGAQDFLIKP 98
Cdd:COG2201  85 EEGAEATL-EALELGAVDFIAKP 106
PRK15369 PRK15369
two component system sensor kinase SsrB; Provisional
24-97 8.00e-09

two component system sensor kinase SsrB; Provisional


Pssm-ID: 185267 [Multi-domain]  Cd Length: 211  Bit Score: 54.31  E-value: 8.00e-09
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 50401172   24 NIVG---TGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIK 97
Cdd:PRK15369  30 KIVGqvdNGLEVYNACRQLEPDIVILDLGLPGMNGLDVIPQLHQRWPAMNILVLTARQEEHMASRTLAAGALGYVLK 106
PRK00742 PRK00742
chemotaxis-specific methylesterase; Provisional
22-98 1.25e-08

chemotaxis-specific methylesterase; Provisional


Pssm-ID: 234828 [Multi-domain]  Cd Length: 354  Bit Score: 55.16  E-value: 1.25e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   22 DINIVGT---GRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPdVPIVF---MTAHGSiDTAVEAMRHGAQDFL 95
Cdd:PRK00742  28 DIEVVGTapdGLEAREKIKKLNPDVITLDVEMPVMDGLDALEKIMRLRP-TPVVMvssLTERGA-EITLRALELGAVDFV 105

                 ...
gi 50401172   96 IKP 98
Cdd:PRK00742 106 TKP 108
spore_0_A TIGR02875
sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a ...
1-115 1.28e-08

sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a transcription factor critical for the initiation of sporulation. It contains a response regulator receiver domain (pfam00072). In Bacillus subtilis, it works together with response regulator Spo0F and the phosphotransferase Spo0B, both of which are missing from at least some sporulating species and thus not part of the endospore forming bacteria minimal gene set. Spo0A, however, is universal among endospore-forming species. [Cellular processes, Sporulation and germination]


Pssm-ID: 131922 [Multi-domain]  Cd Length: 262  Bit Score: 54.41  E-value: 1.28e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172     1 MVEDTASVAALYRSYLTPLDiDINIVGT---GRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVP--IVFMT 75
Cdd:TIGR02875   7 IADDNKEFCNLLKEYLAAQP-DMEVVGVahnGVDALELIKEQQPDVVVLDIIMPHLDGIGVLEKLNEIELSARprVIMLS 85
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 50401172    76 AHGSIDTAVEAMRHGAQDFLIKPCE----ADRLRVTVNNAIRKA 115
Cdd:TIGR02875  86 AFGQEKITQRAVALGADYYVLKPFDleilAARIRQLAWGTNADI 129
PRK10161 PRK10161
transcriptional regulator PhoB; Provisional
32-118 3.44e-08

transcriptional regulator PhoB; Provisional


Pssm-ID: 182277 [Multi-domain]  Cd Length: 229  Bit Score: 52.80  E-value: 3.44e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   32 AIESIGRREPDLILLDLRLPDMTGMDVLYAVKEK--SPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADRLRVTVN 109
Cdd:PRK10161  38 AVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKREsmTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIK 117

                 ....*....
gi 50401172  110 NAIRKASKL 118
Cdd:PRK10161 118 AVMRRISPM 126
PLN03029 PLN03029
type-a response regulator protein; Provisional
40-130 4.94e-08

type-a response regulator protein; Provisional


Pssm-ID: 215544 [Multi-domain]  Cd Length: 222  Bit Score: 51.96  E-value: 4.94e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   40 EPDLILLDLRLPDMTGMDVLYAVKEKSP--DVPIVFMTAHGSIDTAVEAMRHGAQDFLIKP---CEADRLRVTVNNAirk 114
Cdd:PLN03029  72 EVNLIITDYCMPGMTGYDLLKKIKESSSlrNIPVVIMSSENVPSRITRCLEEGAEEFFLKPvqlSDLNRLKPHMMKT--- 148
                         90
                 ....*....|....*.
gi 50401172  115 asKLKNDVDNKNQNYQ 130
Cdd:PLN03029 149 --KSKNQKQENQEKQE 162
PRK11517 PRK11517
transcriptional regulatory protein YedW; Provisional
1-118 6.64e-08

transcriptional regulatory protein YedW; Provisional


Pssm-ID: 183172 [Multi-domain]  Cd Length: 223  Bit Score: 51.82  E-value: 6.64e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKeKSPDVPIVFMTAHGSI 80
Cdd:PRK11517   5 LIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLR-TAKQTPVICLTARDSV 83
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 50401172   81 DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKL 118
Cdd:PRK11517  84 DDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHAL 121
PRK10710 PRK10710
DNA-binding transcriptional regulator BaeR; Provisional
1-98 2.14e-07

DNA-binding transcriptional regulator BaeR; Provisional


Pssm-ID: 182665 [Multi-domain]  Cd Length: 240  Bit Score: 50.45  E-value: 2.14e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSpDVPIVFMTAH-GS 79
Cdd:PRK10710  15 IVEDEPKLGQLLIDYLQAASYATTLLSHGDEVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFS-DIPIVMVTAKiEE 93
                         90
                 ....*....|....*....
gi 50401172   80 IDTAVeAMRHGAQDFLIKP 98
Cdd:PRK10710  94 IDRLL-GLEIGADDYICKP 111
marine_sort_RR TIGR03787
proteobacterial dedicated sortase system response regulator; This model describes a family of ...
1-97 3.77e-07

proteobacterial dedicated sortase system response regulator; This model describes a family of DNA-binding response regulator proteins, associated with an adjacent histidine kinase (TIGR03785) to form a two-component system. This system co-occurs with, and often is adjacent to, a proteobacterial variant form of the protein sorting transpeptidase called sortase (TIGR03784), and a single target protein for the sortase. We give this protein the gene symbol pdsR, for Proteobacterial Dedicated Sortase system Response regulator.


Pssm-ID: 163499 [Multi-domain]  Cd Length: 227  Bit Score: 49.75  E-value: 3.77e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172     1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMT--GMDVLYAVKEKSPDVPIVFMTAHG 78
Cdd:TIGR03787   5 IVEDEAAIRENYADALKRQGYQVTTYADRPSAMQAFRQRLPDLAIIDIGLGEEIdgGFMLCQDLRSLSATLPIIFLTARD 84
                          90       100
                  ....*....|....*....|
gi 50401172    79 S-IDTaVEAMRHGAQDFLIK 97
Cdd:TIGR03787  85 SdFDT-VSGLRLGADDYLTK 103
PRK10360 PRK10360
DNA-binding transcriptional activator UhpA; Provisional
16-125 5.68e-07

DNA-binding transcriptional activator UhpA; Provisional


Pssm-ID: 182408 [Multi-domain]  Cd Length: 196  Bit Score: 48.43  E-value: 5.68e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   16 LTPLDIDINIV---GTGRDAIESIGRREPDLILLDLRLPDMTGMDVLyavKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQ 92
Cdd:PRK10360  20 LLGLEPDLQVVaefGSGREALAGLPGRGVQVCICDISMPDISGLELL---SQLPKGMATIMLSVHDSPALVEQALNAGAR 96
                         90       100       110
                 ....*....|....*....|....*....|...
gi 50401172   93 DFLIKPCEADRLRVTVNNAIRKASKLKNDVDNK 125
Cdd:PRK10360  97 GFLSKRCSPDELIAAVHTVATGGCYLTPDIAIK 129
PRK10430 PRK10430
DNA-binding transcriptional activator DcuR; Provisional
1-124 6.88e-07

DNA-binding transcriptional activator DcuR; Provisional


Pssm-ID: 182454 [Multi-domain]  Cd Length: 239  Bit Score: 48.95  E-value: 6.88e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLD--IDINIVGTGRDAIESI--GRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTA 76
Cdd:PRK10430   6 IVDDDAMVAELNRRYVAQIPgfQCCGTASTLEQAKEIIfnSDTPIDLILLDIYMQQENGLDLLPVLHEAGCKSDVIVISS 85
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 50401172   77 HGSIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKN-------DVDN 124
Cdd:PRK10430  86 AADAATIKDSLHYGVVDYLIKPFQASRFEEALTGWRQKKMALEKhqyydqaELDQ 140
PRK14084 PRK14084
two-component response regulator; Provisional
42-127 7.05e-07

two-component response regulator; Provisional


Pssm-ID: 184495 [Multi-domain]  Cd Length: 246  Bit Score: 48.98  E-value: 7.05e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   42 DLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIdtAVEAMRHGAQDFLIKPCEADRlrvtVNNAIRKASKLKND 121
Cdd:PRK14084  48 DIIFLDINLMDESGIELAAKIQKMKEPPAIIFATAHDQF--AVKAFELNATDYILKPFEQKR----IEQAVNKVRATKAK 121

                 ....*.
gi 50401172  122 VDNKNQ 127
Cdd:PRK14084 122 DDNNAS 127
PRK10403 PRK10403
transcriptional regulator NarP; Provisional
27-117 1.27e-05

transcriptional regulator NarP; Provisional


Pssm-ID: 182431 [Multi-domain]  Cd Length: 215  Bit Score: 44.84  E-value: 1.27e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   27 GTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADRLRv 106
Cdd:PRK10403  39 GDGASAIDLANRLDPDVILLDLNMKGMSGLDTLNALRRDGVTAQIIILTVSDASSDVFALIDAGADGYLLKDSDPEVLL- 117
                         90
                 ....*....|.
gi 50401172  107 tvnNAIRKASK 117
Cdd:PRK10403 118 ---EAIRAGAK 125
ompR PRK09468
osmolarity response regulator; Provisional
2-98 2.47e-05

osmolarity response regulator; Provisional


Pssm-ID: 181883 [Multi-domain]  Cd Length: 239  Bit Score: 44.19  E-value: 2.47e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSID 81
Cdd:PRK09468  11 VDDDMRLRALLERYLTEQGFQVRSAANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQNNPTPIIMLTAKGEEV 90
                         90
                 ....*....|....*..
gi 50401172   82 TAVEAMRHGAQDFLIKP 98
Cdd:PRK09468  91 DRIVGLEIGADDYLPKP 107
PRK09191 PRK09191
two-component response regulator; Provisional
24-76 2.53e-05

two-component response regulator; Provisional


Pssm-ID: 236402 [Multi-domain]  Cd Length: 261  Bit Score: 44.45  E-value: 2.53e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 50401172   24 NIVGTGR---DAIESIGRREPDLILLDLRLPD-MTGMDvlyAVKE--KSPDVPIVFMTA 76
Cdd:PRK09191 163 RVTGIARtraEAVALAKKTRPGLILADIQLADgSSGID---AVNDilKTFDVPVIFITA 218
PRK10955 PRK10955
DNA-binding transcriptional regulator CpxR; Provisional
1-128 2.82e-05

DNA-binding transcriptional regulator CpxR; Provisional


Pssm-ID: 182864 [Multi-domain]  Cd Length: 232  Bit Score: 44.02  E-value: 2.82e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRrEPDLILLDLRLPDMTGMDVLYAVKEKSpDVPIVFMTAHGSI 80
Cdd:PRK10955   6 LVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDD-SIDLLLLDVMMPKKNGIDTLKELRQTH-QTPVIMLTARGSE 83
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 50401172   81 DTAVEAMRHGAQDFLIKPCEaDRLRVTVNNAIRKASKLKNDVDNKNQN 128
Cdd:PRK10955  84 LDRVLGLELGADDYLPKPFN-DRELVARIRAILRRSHWSEQQQNNDNG 130
PRK10766 PRK10766
DNA-binding transcriptional regulator TorR; Provisional
2-124 3.12e-05

DNA-binding transcriptional regulator TorR; Provisional


Pssm-ID: 182711 [Multi-domain]  Cd Length: 221  Bit Score: 43.87  E-value: 3.12e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSpDVPIVFMTAHG-SI 80
Cdd:PRK10766   8 VEDEPVTRARLQGYFEQEGYTVSEAASGAGMREIMQNQHVDLILLDINLPGEDGLMLTRELRSRS-TVGIILVTGRTdSI 86
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 50401172   81 DTAVeAMRHGAQDFLIKPCEADRLRVTVNN------AIRKASKLKNDVDN 124
Cdd:PRK10766  87 DRIV-GLEMGADDYVTKPLELRELLVRVKNllwrisLARQAQPHAQEEDN 135
PRK09483 PRK09483
response regulator; Provisional
23-113 3.36e-05

response regulator; Provisional


Pssm-ID: 236538 [Multi-domain]  Cd Length: 217  Bit Score: 43.56  E-value: 3.36e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   23 INIVG---TGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPC 99
Cdd:PRK09483  27 IKVVGeacCGEDAVKWCRTNAVDVVLMDMNMPGIGGLEATRKILRYTPDVKIIMLTVHTENPLPAKVMQAGAAGYLSKGA 106
                         90
                 ....*....|....
gi 50401172  100 EADRlrvtVNNAIR 113
Cdd:PRK09483 107 APQE----VVSAIR 116
spore_lon_C TIGR02903
ATP-dependent protease, Lon family; Members of this protein family resemble the widely ...
144-249 4.44e-05

ATP-dependent protease, Lon family; Members of this protein family resemble the widely distributed ATP-dependent protease La, also called Lon and LonA. It resembles even more closely LonB, which is a LonA paralog found in genomes if and only if the species is capable of endospore formation (as in Bacillus subtilis, Clostridium tetani, and select other members of the Firmicutes) and expressed specifically in the forespore compartment. Members of this family are restricted to a subset of spore-forming species, and are very likely to participate in the program of endospore formation. We propose the designation LonC. [Protein fate, Degradation of proteins, peptides, and glycopeptides, Cellular processes, Sporulation and germination]


Pssm-ID: 274344 [Multi-domain]  Cd Length: 615  Bit Score: 44.42  E-value: 4.44e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   144 RTIDSAASSKAS-----IFITGESGTGKEVCAE-AIHAASKRG------DKPFIAINCAAI---PKDlIESELFGHVKG- 207
Cdd:TIGR02903 161 RAIKALLAKVASpfpqhIILYGPPGVGKTTAARlALEEAKKLKhtpfaeDAPFVEVDGTTLrwdPRE-VTNPLLGSVHDp 239
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 50401172   208 ---------AFTGAATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQ 249
Cdd:TIGR02903 240 iyqgarrdlAETGVPEPKTGLVTDAHGGVLFIDEIGELDPLLQNKLLKVLE 290
PRK10816 PRK10816
DNA-binding transcriptional regulator PhoP; Provisional
1-98 5.08e-05

DNA-binding transcriptional regulator PhoP; Provisional


Pssm-ID: 182755 [Multi-domain]  Cd Length: 223  Bit Score: 43.19  E-value: 5.08e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    1 MVEDTAsvaaLYRSYLTpldIDINIVGTGRDAIES-------IGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVF 73
Cdd:PRK10816   5 VVEDNA----LLRHHLK---VQLQDAGHQVDAAEDakeadyyLNEHLPDIAIVDLGLPDEDGLSLIRRWRSNDVSLPILV 77
                         90       100
                 ....*....|....*....|....*
gi 50401172   74 MTAHGSIDTAVEAMRHGAQDFLIKP 98
Cdd:PRK10816  78 LTARESWQDKVEVLSAGADDYVTKP 102
PRK15347 PRK15347
two component system sensor kinase SsrA; Provisional
16-98 2.57e-04

two component system sensor kinase SsrA; Provisional


Pssm-ID: 237951 [Multi-domain]  Cd Length: 921  Bit Score: 41.94  E-value: 2.57e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172   16 LTPLDIDINIVGTGRDAIEsIGRREP-DLILLDLRLPDMTGMDVL----YAVKEKSPDVPIVFMTAHGSIDTAVEAMRHG 90
Cdd:PRK15347 710 LVELGQQVTTAASGTEALE-LGRQHRfDLVLMDIRMPGLDGLETTqlwrDDPNNLDPDCMIVALTANAAPEEIHRCKKAG 788

                 ....*...
gi 50401172   91 AQDFLIKP 98
Cdd:PRK15347 789 MNHYLTKP 796
PRK09959 PRK09959
hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional
1-105 2.93e-04

hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional


Pssm-ID: 182169 [Multi-domain]  Cd Length: 1197  Bit Score: 42.03  E-value: 2.93e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172     1 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSI 80
Cdd:PRK09959  963 IADDHPTNRLLLKRQLNLLGYDVDEATDGVQALHKVSMQHYDLLITDVNMPNMDGFELTRKLREQNSSLPIWGLTANAQA 1042
                          90       100
                  ....*....|....*....|....*
gi 50401172    81 DTAVEAMRHGAQDFLIKPCEADRLR 105
Cdd:PRK09959 1043 NEREKGLSCGMNLCLFKPLTLDVLK 1067
AmiR COG3707
Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding ...
21-124 4.91e-04

Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226230 [Multi-domain]  Cd Length: 194  Bit Score: 40.01  E-value: 4.91e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172  21 IDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDvPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCE 100
Cdd:COG3707  31 QRVGEAADGLEAVEVCERLQPDVVILDIEMPRRDIIEALLLASENVAR-PIVALTAYSDPALIEAAIEAGVMAYIVKPLD 109
                        90       100
                ....*....|....*....|....*..
gi 50401172 101 ADRLRVTVNNAIRKA---SKLKNDVDN 124
Cdd:COG3707 110 ESRLLPILDVAVSRFeerRALRRELAK 136
PRK09935 PRK09935
transcriptional regulator FimZ; Provisional
27-97 7.67e-04

transcriptional regulator FimZ; Provisional


Pssm-ID: 182154 [Multi-domain]  Cd Length: 210  Bit Score: 39.47  E-value: 7.67e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 50401172   27 GTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIK 97
Cdd:PRK09935  36 DDYRITIDYLRTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFVSK 106
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
1-116 8.35e-04

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362 [Multi-domain]  Cd Length: 968  Bit Score: 40.53  E-value: 8.35e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172     1 MVED---TASVAAlyrSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSP---DVPIVFM 74
Cdd:TIGR02956 707 LVEDnevNQMVAQ---GFLTRLGHKVTLAESGQSALECFHQHAFDLALLDINLPDGDGVTLLQQLRAIYGaknEVKFIAF 783
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 50401172    75 TAHgSIDTAVEAMRHGAQD-FLIKPCEADRLRVTVNNAIRKAS 116
Cdd:TIGR02956 784 SAH-VFNEDVAQYLAAGFDgFLAKPVVEEQLTAMIAVILAGGK 825
PRK13557 PRK13557
histidine kinase; Provisional
2-104 8.61e-04

histidine kinase; Provisional


Pssm-ID: 237425 [Multi-domain]  Cd Length: 540  Bit Score: 40.42  E-value: 8.61e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172    2 VEDTASVAALYRSYLTPLDIDINIVGTGRDAIESI-GRREPDLILLDLRLP-DMTGMDVLYAVKEKSPDVPIVFMTahGS 79
Cdd:PRK13557 421 VDDRPDVAELARMILEDFGYRTLVASNGREALEILdSHPEVDLLFTDLIMPgGMNGVMLAREARRRQPKIKVLLTT--GY 498
                         90       100
                 ....*....|....*....|....*....
gi 50401172   80 IDTAVEamRHGAQ----DFLIKPCEADRL 104
Cdd:PRK13557 499 AEASIE--RTDAGgsefDILNKPYRRAEL 525
LonB COG1067
Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] ...
197-275 4.02e-03

Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223994 [Multi-domain]  Cd Length: 647  Bit Score: 38.11  E-value: 4.02e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401172 197 IESELFGHVK-----GAFTGAATER--QGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKS------ 263
Cdd:COG1067 191 IADQLLGSVRhdpyqGGLGTTGHIRvkPGAVHKANGGVLIIDEIGLLAQPLQWKLLKALLDKEQPIWGSSEPSSgapvrp 270
                        90
                ....*....|....*.
gi 50401172 264 ----VDVRFVCATNRD 275
Cdd:COG1067 271 esvpLDLKLILAGNRE 286
PleD COG3706
Two-component response regulator, PleD family, consists of two REC domains and a diguanylate ...
28-98 4.13e-03

Two-component response regulator, PleD family, consists of two REC domains and a diguanylate cyclase (GGDEF) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 38.07  E-value: 4.13e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 50401172  28 TGRDAIESIGRREPDLILLDLRLPDMTGMDVlyAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKP 98
Cdd:COG3706  20 KGLIALAILLDHKPDYKLLDVMMPGMDGFEL--CRRLKAEPATVVMVTALDDSAPRVRGLKAGADDFLTKP 88
PRK13765 PRK13765
ATP-dependent protease Lon; Provisional
218-263 4.17e-03

ATP-dependent protease Lon; Provisional


Pssm-ID: 237495 [Multi-domain]  Cd Length: 637  Bit Score: 38.06  E-value: 4.17e-03
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 50401172  218 GAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKS 263
Cdd:PRK13765 220 GAIHKAHKGVLFIDEINTLDLESQQSLLTAMQEKKFPITGQSERSS 265
PRK13435 PRK13435
response regulator; Provisional
23-76 4.69e-03

response regulator; Provisional


Pssm-ID: 184052 [Multi-domain]  Cd Length: 145  Bit Score: 36.18  E-value: 4.69e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 50401172   23 INIVGTGRDAIESIGRREPDLILLDLRLPD-MTGMDVLYAVkEKSPDVPIVFMTA 76
Cdd:PRK13435  33 VGIAMSSEQAIALGRRRQPDVALVDVHLADgPTGVEVARRL-SADGGVEVVFMTG 86
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH