NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|5032097|ref|NP_005620|]
View 

sodium- and chloride-dependent creatine transporter 1 isoform 1 [Homo sapiens]

Protein Classification

SLC6sbd_CT1 domain-containing protein (domain architecture ID 10183829)

SLC6sbd_CT1 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SLC6sbd_CT1 cd11509
Na(+)- and Cl(-)-dependent creatine transporter 1; solute-binding domain; CT1 (also called ...
52-621 0e+00

Na(+)- and Cl(-)-dependent creatine transporter 1; solute-binding domain; CT1 (also called CRTR, CRT) transports creatine. Human CT1 is encoded by the SLC6A8 gene. CT1 is ubiquitously expressed, with highest levels found in skeletal muscle and kidney. Creatine is absorbed from food or synthesized from arginine and plays an important role in energy metabolism. Deficiency in human CT1 leads to X-linked cerebral creatine transporter deficiency. In males, this disorder is characterized by language and speech delays, autistic-like behavior, seizures in about 50% of cases, and can also involve midfacial hypoplasia, and short stature. In females, it is characterized by mild cognitive impairment with behavior and learning problems. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


:

Pssm-ID: 271397  Cd Length: 589  Bit Score: 1025.17  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFK 131
Cdd:cd11509   1 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYLLIAFVGGIPIFFLEIALGQFMKAGGINAWNIAPLFK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCAN-----ASLANLTCDQLADR 206
Cdd:cd11509  81 GLGYASMVIVFFCNTYYIMVLAWGFYYLVKSFTNTLPWATCGNPWNTPNCTEIFRHADCNNgassaGSLANLTCDELANR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  207 RSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGAL 286
Cdd:cd11509 161 RSPVIEFWERKVLRLSGGLEEPGALNWELTLCLLATWVLVYFCVWKGVKSTGKVVYFTATFPYVVLVVLLVRGVTLPGAL 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  287 DGIIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFM 366
Cdd:cd11509 241 DGIIYYLKPDWSKLGEAQVWIDAGTQIFFSYAIGLGALTALGSYNRFHNNCYKDAFILALINSGTSFFAGFVVFSILGFM 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  367 AAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRFQREIS 446
Cdd:cd11509 321 ASEQGVDISKVAESGPGLAFIAYPKAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGILDLLPAKYYFRYQREVV 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  447 VALCCALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFF 526
Cdd:cd11509 401 VALCCLLCFLIDLSMVTEGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIARMIGYRPLPWMKWCWSVI 480
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  527 TPLVCMGIFIFNVVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEY 606
Cdd:cd11509 481 TPLVCMGIFLFHVVNYKPLTYNKTYVYPWWGEAIGWCLALSSMLCIPLTVLYKLLRAKGSLKERWQKLTTPVWGLHHLEY 560
                       570
                ....*....|....*
gi 5032097  607 RAQDADVRGLTTLTP 621
Cdd:cd11509 561 RAPDADVRGLPTLLP 575
 
Name Accession Description Interval E-value
SLC6sbd_CT1 cd11509
Na(+)- and Cl(-)-dependent creatine transporter 1; solute-binding domain; CT1 (also called ...
52-621 0e+00

Na(+)- and Cl(-)-dependent creatine transporter 1; solute-binding domain; CT1 (also called CRTR, CRT) transports creatine. Human CT1 is encoded by the SLC6A8 gene. CT1 is ubiquitously expressed, with highest levels found in skeletal muscle and kidney. Creatine is absorbed from food or synthesized from arginine and plays an important role in energy metabolism. Deficiency in human CT1 leads to X-linked cerebral creatine transporter deficiency. In males, this disorder is characterized by language and speech delays, autistic-like behavior, seizures in about 50% of cases, and can also involve midfacial hypoplasia, and short stature. In females, it is characterized by mild cognitive impairment with behavior and learning problems. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271397  Cd Length: 589  Bit Score: 1025.17  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFK 131
Cdd:cd11509   1 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYLLIAFVGGIPIFFLEIALGQFMKAGGINAWNIAPLFK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCAN-----ASLANLTCDQLADR 206
Cdd:cd11509  81 GLGYASMVIVFFCNTYYIMVLAWGFYYLVKSFTNTLPWATCGNPWNTPNCTEIFRHADCNNgassaGSLANLTCDELANR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  207 RSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGAL 286
Cdd:cd11509 161 RSPVIEFWERKVLRLSGGLEEPGALNWELTLCLLATWVLVYFCVWKGVKSTGKVVYFTATFPYVVLVVLLVRGVTLPGAL 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  287 DGIIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFM 366
Cdd:cd11509 241 DGIIYYLKPDWSKLGEAQVWIDAGTQIFFSYAIGLGALTALGSYNRFHNNCYKDAFILALINSGTSFFAGFVVFSILGFM 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  367 AAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRFQREIS 446
Cdd:cd11509 321 ASEQGVDISKVAESGPGLAFIAYPKAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGILDLLPAKYYFRYQREVV 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  447 VALCCALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFF 526
Cdd:cd11509 401 VALCCLLCFLIDLSMVTEGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIARMIGYRPLPWMKWCWSVI 480
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  527 TPLVCMGIFIFNVVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEY 606
Cdd:cd11509 481 TPLVCMGIFLFHVVNYKPLTYNKTYVYPWWGEAIGWCLALSSMLCIPLTVLYKLLRAKGSLKERWQKLTTPVWGLHHLEY 560
                       570
                ....*....|....*
gi 5032097  607 RAQDADVRGLTTLTP 621
Cdd:cd11509 561 RAPDADVRGLPTLLP 575
SNF pfam00209
Sodium:neurotransmitter symporter family; These are twelve xTM-containing region transporters.
52-581 0e+00

Sodium:neurotransmitter symporter family; These are twelve xTM-containing region transporters.


Pssm-ID: 306675  Cd Length: 517  Bit Score: 776.46  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097     52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:pfam00209   1 RETWSGKLDFLLSVIGFAVGLGNVWRFPYLCYKNGGGAFLIPYLIMLIFAGIPLFFLELALGQYTREGAIGVWRkICPLF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097    131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCANaslanltcdqLADRRSPV 210
Cdd:pfam00209  81 KGIGYASMVIAFYIGIYYNVIIAWALYYLFSSFTTELPWASCNNSWNTPNCTEFFSPNNTTN----------TLNKTSPV 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097    211 IEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGII 290
Cdd:pfam00209 151 EEFWERKVLKLSDGIEDLGGLRWPLALCLLVAWVVVYFCIWKGVKSSGKVVYFTATFPYVVLLVLLVRGVTLPGAADGIL 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097    291 YYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQ 370
Cdd:pfam00209 231 FYLTPDWSKLLEPQVWIDAATQIFFSLGIGFGVLIAFASYNKFHNNCYRDALIVSFINSATSFLAGFVIFSVLGFMAQEQ 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097    371 GVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPasYYFRFQREISVALC 450
Cdd:pfam00209 311 GVPISEVAESGPGLAFIAYPEAVTMMPLSPFWSVLFFLMLITLGLDSQFGGVEGIITALVDEFP--ILLRKRRELFTLIV 388
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097    451 CALCFVIDLSMVTDGGMYVFQLFDYYSASgTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLV 530
Cdd:pfam00209 389 CVISFLIGLILVTEGGIYVFTLFDYYAAS-FGLLFVAFFECIAVAWVYGIDRFYDDIKEMLGFRPGLFWRLCWKFVSPLI 467
                         490       500       510       520       530
                  ....*....|....*....|....*....|....*....|....*....|.
gi 5032097    531 CMGIFIFNVVYYEPLVYNNtYVYPWWGEAMGWAFALSSMLCVPLHLLGCLL 581
Cdd:pfam00209 468 LLFLFIFSIVQYKPLTYNN-YVYPNWANALGWLMALSSMLCIPLYSIYKLL 517
YocR COG0733
Na+-dependent transporter, SNF family [General function prediction only];
52-536 3.56e-56

Na+-dependent transporter, SNF family [General function prediction only];


Pssm-ID: 223805  Cd Length: 439  Bit Score: 198.60  E-value: 3.56e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVW---NICP 128
Cdd:COG0733   5 REQWSSRLGFILAAAGSAVGLGNIWRFPYMAGENGGGAFLLPYLIFLLLVGIPLLLAEFAIGRRGRKNAVGAFrklAPKK 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  129 LFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPwatcghtwntpdcveifrhedcanaslanltcdqladrrs 208
Cdd:COG0733  85 KWEWIGWFGVLGGFLILSFYSVIGGWILSYLVKSLTGALP---------------------------------------- 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  209 PVIEFWENKVLRLSGGlevpgalNWEVTLCLLACWVLVYFCVWKGVKS-TGKIVYFTATFPYVVLVVLLVRGVLLPGALD 287
Cdd:COG0733 125 DTGEQFAQLFGQTISN-------PGLAVIFHLLFLVLTALIVSRGVKKgIEKANKIMMPLLFVLFIILVIRAVTLPGAME 197
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  288 GIIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMA 367
Cdd:COG0733 198 GLKFLFKPDFSKLTDPKVWLAALGQAFFSLSLGFGIMITYSSYLSKKSDLVSSALSIVLLNTLISLLAGLVIFPALFSFG 277
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  368 AEqgvhiskvAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDllpasyYFRFQREISV 447
Cdd:COG0733 278 AD--------ASQGPGLVFIVLPAVFNQMPLGTLFGILFFLLLLFAALTSAISMLEVLVAALID------KFGISRKKAT 343
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  448 ALCCALCFVIDLSMVTDGGMYVFQLFDYYsASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWmKWCWSFFT 527
Cdd:COG0733 344 WLIGILIFLLGIPSILSFGLSIFDLVDFV-VSNILMPLGALLIAIFVGWVLKKELLREELNAGSAKLFKIW-LYLVRYIA 421

                ....*....
gi 5032097  528 PLVCMGIFI 536
Cdd:COG0733 422 PIVILVVLI 430
 
Name Accession Description Interval E-value
SLC6sbd_CT1 cd11509
Na(+)- and Cl(-)-dependent creatine transporter 1; solute-binding domain; CT1 (also called ...
52-621 0e+00

Na(+)- and Cl(-)-dependent creatine transporter 1; solute-binding domain; CT1 (also called CRTR, CRT) transports creatine. Human CT1 is encoded by the SLC6A8 gene. CT1 is ubiquitously expressed, with highest levels found in skeletal muscle and kidney. Creatine is absorbed from food or synthesized from arginine and plays an important role in energy metabolism. Deficiency in human CT1 leads to X-linked cerebral creatine transporter deficiency. In males, this disorder is characterized by language and speech delays, autistic-like behavior, seizures in about 50% of cases, and can also involve midfacial hypoplasia, and short stature. In females, it is characterized by mild cognitive impairment with behavior and learning problems. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271397  Cd Length: 589  Bit Score: 1025.17  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFK 131
Cdd:cd11509   1 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYLLIAFVGGIPIFFLEIALGQFMKAGGINAWNIAPLFK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCAN-----ASLANLTCDQLADR 206
Cdd:cd11509  81 GLGYASMVIVFFCNTYYIMVLAWGFYYLVKSFTNTLPWATCGNPWNTPNCTEIFRHADCNNgassaGSLANLTCDELANR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  207 RSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGAL 286
Cdd:cd11509 161 RSPVIEFWERKVLRLSGGLEEPGALNWELTLCLLATWVLVYFCVWKGVKSTGKVVYFTATFPYVVLVVLLVRGVTLPGAL 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  287 DGIIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFM 366
Cdd:cd11509 241 DGIIYYLKPDWSKLGEAQVWIDAGTQIFFSYAIGLGALTALGSYNRFHNNCYKDAFILALINSGTSFFAGFVVFSILGFM 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  367 AAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRFQREIS 446
Cdd:cd11509 321 ASEQGVDISKVAESGPGLAFIAYPKAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGILDLLPAKYYFRYQREVV 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  447 VALCCALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFF 526
Cdd:cd11509 401 VALCCLLCFLIDLSMVTEGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIARMIGYRPLPWMKWCWSVI 480
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  527 TPLVCMGIFIFNVVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEY 606
Cdd:cd11509 481 TPLVCMGIFLFHVVNYKPLTYNKTYVYPWWGEAIGWCLALSSMLCIPLTVLYKLLRAKGSLKERWQKLTTPVWGLHHLEY 560
                       570
                ....*....|....*
gi 5032097  607 RAQDADVRGLTTLTP 621
Cdd:cd11509 561 RAPDADVRGLPTLLP 575
SLC6sbd-TauT-like cd11496
Na(+)- and Cl(-)-dependent taurine transporter TauT, and related proteins; solute-binding ...
52-597 0e+00

Na(+)- and Cl(-)-dependent taurine transporter TauT, and related proteins; solute-binding domain; This subgroup represents the solute-binding domain of TauT-like Na(+)- and Cl(-)-dependent transporters. Family members include: human TauT which transports taurine, human GAT1, GAT2, and GAT3, and BGT1, which transport gamma-aminobutyric acid (GABA), and human CT1 which transports creatine. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271387  Cd Length: 543  Bit Score: 842.24  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFK 131
Cdd:cd11496   1 RGKWSNKIDFLLSVAGYAIGLGNVWRFPYLCYKNGGGAFLIPYFIFLVLCGIPIFFLETSLGQYTSQGGITAWKICPLFK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCANASLanlTCDQLADRRSPVI 211
Cdd:cd11496  81 GIGYASAVIVFWLNIYYIVILAWALFYLFNSFTSPLPWTTCDNWWNTECCVEFYSNNNLSNSRE---NASNNTNATSPVE 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  212 EFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGIIY 291
Cdd:cd11496 158 EFWERRVLGISDGIDEIGSIRWELVLCLLLAWVIVYFCIWKGVKSTGKVVYFTATFPYVMLIILLIRGVTLPGASDGIKF 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  292 YLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQG 371
Cdd:cd11496 238 YLKPDLTKLLDPQVWIDAGTQIFFSYGIGLGSLTALGSYNKFNNNCYKDSIILCFLNSGTSFFAGFAIFSILGFMAQEQG 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  372 VHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRFQREISVALCC 451
Cdd:cd11496 318 VPISEVAESGPGLAFIAYPRAVSLLPLPQLWAVLFFIMLLLLGLDSQFVGVEGFVTAIVDLYPRVLRRRYRREIFVAIVC 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  452 ALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLVC 531
Cdd:cd11496 398 LVSFLIGLPMVTEGGIYVFQLFDYYAASGICLLWLAFFECIAISWVYGADRFYDNIKDMIGYRPGPWWKYCWLFGTPAIC 477
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 5032097  532 MGIFIFNVVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQP 597
Cdd:cd11496 478 LGIFIFSLVKYTPLTYGNTYVYPWWAEAIGWFLALSSMLCIPLYAIYELLRTPGTFKERLRKLTTP 543
SNF pfam00209
Sodium:neurotransmitter symporter family; These are twelve xTM-containing region transporters.
52-581 0e+00

Sodium:neurotransmitter symporter family; These are twelve xTM-containing region transporters.


Pssm-ID: 306675  Cd Length: 517  Bit Score: 776.46  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097     52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:pfam00209   1 RETWSGKLDFLLSVIGFAVGLGNVWRFPYLCYKNGGGAFLIPYLIMLIFAGIPLFFLELALGQYTREGAIGVWRkICPLF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097    131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCANaslanltcdqLADRRSPV 210
Cdd:pfam00209  81 KGIGYASMVIAFYIGIYYNVIIAWALYYLFSSFTTELPWASCNNSWNTPNCTEFFSPNNTTN----------TLNKTSPV 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097    211 IEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGII 290
Cdd:pfam00209 151 EEFWERKVLKLSDGIEDLGGLRWPLALCLLVAWVVVYFCIWKGVKSSGKVVYFTATFPYVVLLVLLVRGVTLPGAADGIL 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097    291 YYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQ 370
Cdd:pfam00209 231 FYLTPDWSKLLEPQVWIDAATQIFFSLGIGFGVLIAFASYNKFHNNCYRDALIVSFINSATSFLAGFVIFSVLGFMAQEQ 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097    371 GVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPasYYFRFQREISVALC 450
Cdd:pfam00209 311 GVPISEVAESGPGLAFIAYPEAVTMMPLSPFWSVLFFLMLITLGLDSQFGGVEGIITALVDEFP--ILLRKRRELFTLIV 388
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097    451 CALCFVIDLSMVTDGGMYVFQLFDYYSASgTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLV 530
Cdd:pfam00209 389 CVISFLIGLILVTEGGIYVFTLFDYYAAS-FGLLFVAFFECIAVAWVYGIDRFYDDIKEMLGFRPGLFWRLCWKFVSPLI 467
                         490       500       510       520       530
                  ....*....|....*....|....*....|....*....|....*....|.
gi 5032097    531 CMGIFIFNVVYYEPLVYNNtYVYPWWGEAMGWAFALSSMLCVPLHLLGCLL 581
Cdd:pfam00209 468 LLFLFIFSIVQYKPLTYNN-YVYPNWANALGWLMALSSMLCIPLYSIYKLL 517
SLC6sbd_TauT cd11510
Na(+)- and Cl(-)-dependent taurine transporter; solute-binding domain; TauT is a Na(+)- and Cl ...
52-597 0e+00

Na(+)- and Cl(-)-dependent taurine transporter; solute-binding domain; TauT is a Na(+)- and Cl(-)-dependent, high-affinity, low-capacity transporter of taurine and beta-alanine. Human TauT is encoded by the SLC6A6 gene. TauT is expressed in brain, retina, liver, kidney, heart, spleen, and pancreas. It may play a part in the supply of taurine to the intestinal epithelium and in the between-meal-capture of taurine. It may also participate in re-absorbing taurine that has been deconjugated from bile acids in the distal lumen. Functional TauT protects kidney cells from nephrotoxicity caused by the chemotherapeutic agent cisplatin; cisplatin down-regulates TauT in a p53-dependent manner. In mice, TauT has been shown to be important for the maintenance of skeletal muscle function and total exercise capacity. TauT-/- mice develop additional clinically important diseases, some of which are characterized by apoptosis, including vision loss, olfactory dysfunction, and chronic liver disease. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271398  Cd Length: 542  Bit Score: 682.35  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:cd11510   1 REKWASKIDFLLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQYTSEGGITCWEkLCPIF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVE-IFRHEDCANASLANLTcdqladRRSP 209
Cdd:cd11510  81 TGIGYASIVIVSLLNIYYIVILAWALYYLFQSFQSELPWAHCNQKWNTPCCVEdTLRKNKTLWASINATN------FTSP 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  210 VIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGI 289
Cdd:cd11510 155 VTEFWERNVLSLSAGIEHVGTIKWDLALCLLLVWVVCFFCIWKGVKSTGKVVYFTATFPFLMLIVLLIRGVTLPGAAEGI 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  290 IYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAE 369
Cdd:cd11510 235 KFYLYPDITRLGDPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCLLLGCLNSGTSFVSGFAIFSVLGFMAQE 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  370 QGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRFQREISVAL 449
Cdd:cd11510 315 QGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAI 394
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  450 CCALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPL 529
Cdd:cd11510 395 VCFISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECIAVAWVYGGDNMYDAIEDMIGYRPGPWMKYSWIVITPV 474
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 5032097  530 VCMGIFIFNVVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQP 597
Cdd:cd11510 475 LCVGCFIFSLVKYEPLTYNKVYVYPEWAIGLGWVLALSSMICIPMVAVIRIIQTDGPLIERIKALTTP 542
SLC6sbd_BGT1 cd11511
Na(+)- and Cl(-)-dependent betaine/GABA transporter-1, and related proteins; solute-binding ...
52-597 0e+00

Na(+)- and Cl(-)-dependent betaine/GABA transporter-1, and related proteins; solute-binding domain; BGT1 is a relatively low-affinity transporter of gamma-aminobutyric acid (GABA), and can also transport betaine. GABA is the main inhibitory neurotransmitter within the mammalian CNS. Human BGT1 is encoded by the SLC6A12 gene, and is similar to mouse GAT2. Mouse GAT2 plays a role in transporting GABA across the blood-brain barrier. In addition to being expressed in cells of the central nervous system, BGT1 is expressed in peripheral tissues, including kidney, liver, and heart. An association has been shown between the SLC6A12 gene and the occurrence of aspirin-intolerant asthma, and BGT1 is a drug target for antiepileptic drugs. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 212080  Cd Length: 541  Bit Score: 655.07  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVW-NICPLF 130
Cdd:cd11511   2 RGQWRNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYLIFLFTCGIPLFFLETALGQYTSQGGVTAWrKICPIF 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCANASL-ANLTcdqladrrSP 209
Cdd:cd11511  82 EGIGYASQVIESYLNVYYIIILSWALFYLFSSFTSVLPWATCNNPWNSDLCVDFLNHSGADNRTPpENAT--------SP 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  210 VIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGI 289
Cdd:cd11511 154 VMEFWEKRVLGLTDGIHKLGTVRWELALCLLLAWIICYFCIWKGVKSTGKVVYFTATFPYLMLVILLVRGVTLPGAAEGI 233
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  290 IYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAE 369
Cdd:cd11511 234 IFYLKPDLSRLADPQVWMDAGTQILFSYAICQGCLTALGSYNKYTNNCYRDCIMLCFLNSATSFVAGFAIFSVLGFMARE 313
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  370 QGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRFQREISVAL 449
Cdd:cd11511 314 QGVPISEVAESGPGLAFIAYPTAVTMMPVSQLWSCLFFLMLIFLGLDSQFVCVESMVTASIDMFPGVFRKKGRRELLILA 393
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  450 CCALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPL 529
Cdd:cd11511 394 IAVICYLLGLLLVTEGGMYIFQLFDYYAASGTCLLFLAIFEVICIGWVYGANRFYDNIEDMIGYRPWPLIKICWLVFTPG 473
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 5032097  530 VCMGIFIFNVVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQP 597
Cdd:cd11511 474 LCLAVFLFSLIKYTPLKYNNSYVYPPWGYVLGWLMALSSMVCIPLYAIFILLKTKGSLKQRLMQLISP 541
SLC6sbd_GAT2 cd11507
Na(+)- and Cl(-)-dependent GABA transporter 2; solute-binding domain; This family includes ...
52-597 0e+00

Na(+)- and Cl(-)-dependent GABA transporter 2; solute-binding domain; This family includes human GAT2 (hGAT2) which transports gamma-aminobutyric acid (GABA). GABA is the main inhibitory neurotransmitter within the mammalian CNS. hGAT2 is encoded by the SLC6A13 gene, and is similar to mouse GAT-3, and rat GAT2. hGAT2 is expressed in brain, kidney, lung, and testis. hGAT2 is a potential drug target for treatment of epilepsy. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271396  Cd Length: 544  Bit Score: 648.58  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVW-NICPLF 130
Cdd:cd11507   1 RGQWNNKVEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLFTCGIPVFFLETALGQYTSQGGVTAWrKICPLF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCANASLANLTcdqladrrSPV 210
Cdd:cd11507  81 EGIGYASQVIVMLLNCYYIIVLAWALFYLFSSFTIDLPWGSCGHEWNTENCMEFQKANSTLNVTSENAT--------SPV 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 IEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGII 290
Cdd:cd11507 153 IEFWERRVLKISDGIQHLGSLRWELALCLLLAWIICYFCIWKGVKSTGKVVYFTATFPYLMLVVLLIRGVSLPGALQGIQ 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  291 YYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQ 370
Cdd:cd11507 233 FYLYPDLSRLQDPQVWMDAGTQIFFSYAICLGCLTALGSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMAEEQ 312
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  371 GVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRFQREISVALC 450
Cdd:cd11507 313 GVPISEVAESGPGLAFIAYPRAVVMLPFSPLWACFFFFMVVLLGLDSQFVCVESLVTALVDMYPTIFRKKNRRELLILAV 392
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  451 CALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLV 530
Cdd:cd11507 393 SIVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFETLCVAWVYGADRFYDNIEDMIGYRPWAIIKYCWLFITPAV 472
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 5032097  531 CMGIFIFNVVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQP 597
Cdd:cd11507 473 CMATFLFSLIKYTPLTYNKKYVYPWWGDALGWLLALSSMVCIPLWVGYKLSTIKGSLRERFRQLTCP 539
SLC6sbd_GAT1 cd11506
Na(+)- and Cl(-)-dependent GABA transporter 1; solute-binding domain; GAT1 transports ...
50-597 0e+00

Na(+)- and Cl(-)-dependent GABA transporter 1; solute-binding domain; GAT1 transports gamma-aminobutyric acid (GABA). GABA is the main inhibitory neurotransmitter within the mammalian CNS. Human GAT1 is encoded by the SLC6A1 gene. GAT1 is expressed in brain and peripheral nervous system. The antiepileptic drug, Tiagabine, inhibits GAT1. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 212075  Cd Length: 598  Bit Score: 626.23  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   50 PPRETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPL 129
Cdd:cd11506  41 PDRDTWKGKFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPM 120
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  130 FKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVeifrhedcANASLANLTcdqlaDRRSP 209
Cdd:cd11506 121 FKGVGLAAAVLSFWLNIYYIVIIAWAIYYLYNSFTTTLPWKSCDNPWNTDRCF--------SNYSMANTT-----NMTSA 187
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  210 VIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGI 289
Cdd:cd11506 188 VVEFWERNMHQMTDGLEKPGQIRWPLAITLAIAWVLVYFCIWKGVGWTGKVVYFSATYPYIMLFILFFRGVTLPGAKEGI 267
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  290 IYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAE 369
Cdd:cd11506 268 LFYITPNFSKLSDSEVWLDAATQIFFSYGLGLGSLIALGSYNPFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHV 347
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  370 QGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASyyFRFQREISVAL 449
Cdd:cd11506 348 TKRPIADVAASGPGLAFLAYPEAVTQLPISPLWAVLFFSMLLMLGIDSQFCTVEGFITALVDEFPRL--LRNRREIFIAV 425
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  450 CCALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPL 529
Cdd:cd11506 426 VCIVSYLIGLSNITQGGIYVFKLFDYYSASGMSLLFLVFFECVSISWFYGVNRFYDNIEEMVGYRPCIWWKLCWSFFTPI 505
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 5032097  530 VCMGIFIFNVVYYEPLVYNNtYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQP 597
Cdd:cd11506 506 IVAGVFLFSAVQMTPLTMGN-YVFPKWGQGVGWFMALSSMVLIPGYMAYMFLTLKGSLKQRLQVMIQP 572
SLC6sbd_GAT3 cd11508
Na(+)- and Cl(-)-dependent GABA transporter 3; solute-binding domain; This family includes ...
52-597 0e+00

Na(+)- and Cl(-)-dependent GABA transporter 3; solute-binding domain; This family includes human GAT3 (hGAT3) a high-affinity transporter of gamma-aminobutyric acid (GABA). GABA is the main inhibitory neurotransmitter within the mammalian CNS. hGAT3 is encoded by the SLC6A11 gene, and is similar to mouse GAT4, and rat GAT3/GATB. GAT3 is expressed primarily in the glia of the brain, and is a potential drug target for antiepileptic drugs. This subgroup belongs to the solute carrier 6 (SLC6) transporter family


Pssm-ID: 212077  Cd Length: 542  Bit Score: 610.83  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVW-NICPLF 130
Cdd:cd11508   2 RGHWNNKVEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGITCWrKVCPLF 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEI--FRHEDCANASLANLTcdqladrrS 208
Cdd:cd11508  82 EGIGYATQVIEAHLNVYYIIILAWAIFYLFNCFTTELPWATCGHEWNTENCVEFqkLNSSNCSHVSLQNAT--------S 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  209 PVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDG 288
Cdd:cd11508 154 PVMEFWERRVLAISDGIEHIGNLRWELALCLLAAWTICYFCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEG 233
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  289 IIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAA 368
Cdd:cd11508 234 IKFYLYPDLSRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAY 313
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  369 EQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRFQREISVA 448
Cdd:cd11508 314 EQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVTAVVDMYPKVFRRGYRRELLIL 393
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  449 LCCALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTP 528
Cdd:cd11508 394 ALSIVSYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVAIFECICIGWVYGSNRFYDNIEDMIGYRPLSLIKWCWMVITP 473
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 5032097  529 LVCMGIFIFNVVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQP 597
Cdd:cd11508 474 GICAGIFIFFLVKYKPLKYNNVYTYPDWGYGIGWLMALSSMICIPLWICIKMWKTEGTFPEKLQKLTTP 542
SLC6sbd_SERT-like cd11497
Na(+)- and Cl(-)-dependent monoamine transporters, SERT, NET, DAT1 and related proteins; ...
52-597 0e+00

Na(+)- and Cl(-)-dependent monoamine transporters, SERT, NET, DAT1 and related proteins; solute binding domain; This subgroup represents the solute-binding domain of transmembrane transporters that transport monoamine neurotransmitters from synaptic spaces into presynaptic neurons. Members include: NET which transports norepinephrine, SERT which transports serotonin, and DAT1 which transports dopamine. These transporters may play a role in diseases including depression, anxiety disorders, attention-deficit hyperactivity disorder, and in the control of human behavior and emotional states. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271388  Cd Length: 537  Bit Score: 570.02  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:cd11497   1 RETWGKKIDFLLSVIGFAVDLGNVWRFPYLCYKNGGGAFLIPYLIMLIFGGLPLFYMELALGQFNRSGCITVWKkICPLF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRhedcanasLANLTCDQLADRRSPV 210
Cdd:cd11497  81 KGVGYAICIIAFYVAFYYNVIIAWALYYLFSSFTSELPWTSCNNPWNTPNCTDVSN--------RNNSSSINGTGLTSPA 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 IEFWENKVLRL--SGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDG 288
Cdd:cd11497 153 EEYFERKVLELqkSEGIDDLGPIKWQLALCLFAVFIIVYFSLWKGVKSSGKVVWVTATMPYVVLSILLIRGLTLPGASDG 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  289 IIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAA 368
Cdd:cd11497 233 IKYYLTPDFSKLKDPEVWIDAATQIFFSLGPGFGVLLALSSYNKFHNNCYRDALVTSSINCATSFFSGFVIFSVLGYMAH 312
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  369 EQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPAsyyFRFQREISVA 448
Cdd:cd11497 313 KQNVPIEDVATEGPGLVFIVYPEAIATLPGSTFWAIIFFLMLITLGLDSTFGGLEAVITGLCDEFPF---LSRRRELFVL 389
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  449 LCCALCFVIDLSMVTDGGMYVFQLFDYYSAsGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTP 528
Cdd:cd11497 390 GLVIICFLLALPTVTYGGIYVVTLLDRYAA-GISILFIVFFEAVAVSWFYGVDRFSDDIEEMLGFRPGLYWRVCWKFISP 468
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  529 LVCMGIFIFNVVYYEPLVYnNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAER-WQHLTQP 597
Cdd:cd11497 469 IFLLFIVIFSLVSYEPLQY-QDYVYPPWANVVGWVIACSSIVLIPIYAIYKLISTPGTFRQRiAYCITPE 537
SLC6sbd_PROT cd11500
Na(+)- and Cl(-)-dependent L-proline transporter PROT; solute-binding domain; PROT is a ...
52-600 0e+00

Na(+)- and Cl(-)-dependent L-proline transporter PROT; solute-binding domain; PROT is a high-affinity L-proline transporter that transports L-proline, and may have a role in excitatory neurotransmission. Human PROT is encoded by the SLC6A7 gene, a potential susceptible gene for asthma. PROT is expressed in the brain. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271390  Cd Length: 541  Bit Score: 546.27  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFK 131
Cdd:cd11500   1 RGQWGGKLEFLLSCIGYCVGLGNVWRFPYLCYRNGGGAFLIPYFIMLAFCGIPLFFMELSLGQYGSLGPLTVWKCCPIFK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHedcaNASLANLTCdqladRRSPVI 211
Cdd:cd11500  81 GIGYGMLLVSGLVCIYYNVIIAWTLFYLFASFTSVLPWEHCGNWWNTESCLEHRGN----GALTVNLTR-----TVSPSE 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  212 EFWENKVLRL--SGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGI 289
Cdd:cd11500 152 EYWNRRVLGIqgSSGIGDPGEVRWELALCLLLAWVIVFFCLFKGVKSSGKVVYFTATFPYIILIVLLVRGVTLEGALKGI 231
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  290 IYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAE 369
Cdd:cd11500 232 QFYLTPDFHRLASSQVWYDAASQIFYSLGIGFGGLLTMASYNKFNNNIYRDTLIITLGNCITSVFAGFAIFSVLGHMAHE 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  370 QGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPasYYFRFQREISVAL 449
Cdd:cd11500 312 LGVPVKDVADAGPGLAFVAYPEALTLLPVSPFWSILFFFMLLTLGLDSQFAMLETIVTAVTDEFP--YLLRKYKTWFLGL 389
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  450 CCALCFVIDLSMVTDGGMYVFQLFDYYSAsGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPL 529
Cdd:cd11500 390 ICVGMYLLGLLLVTDGGMYWLTLMDWYSA-SFGLMVLALFMCLAISWVYGIQRFCRDIKMMIGFEPNLYFKACWMFISPA 468
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 5032097  530 VCMGIFIFNVVYYEPLVYNNtYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPI--WG 600
Cdd:cd11500 469 LLLFILVYSIVKYQPSEYGS-YRYPPWAELLGILMGLLSCLMIPIGAIVAILREEGSLWERLKQACRPAmdWG 540
SLC6sbd_SERT-like_u1 cd11556
uncharacterized subgroup of the SERT-like Na(+)- and Cl(-)-dependent monoamine transporter ...
52-597 4.93e-180

uncharacterized subgroup of the SERT-like Na(+)- and Cl(-)-dependent monoamine transporter subfamily; solute binding domain; SERT-like Na(+)- and Cl(-)-dependent monoamine transporters, transport monoamine neurotransmitters from synaptic spaces into presynaptic neurons. Members include: the norepinephrine transporter NET, the serotonin transporter SERT , and the dopamine transporter DAT1. These latter may play a role in diseases or disorders including depression, anxiety disorders, and attention-deficit hyperactivity disorder, and in the control of human behavior and emotional states. They belongs to the solute carrier 6 (SLC6) transporter family. Members of this subgroup are uncharacterized.


Pssm-ID: 271405  Cd Length: 552  Bit Score: 526.27  E-value: 4.93e-180
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:cd11556   1 RETWSKKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYGIMLVVGGIPLFYMELALGQYNRKGAITSWGrLCPLF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHED------CANASLANLTCDQLA 204
Cdd:cd11556  81 KGIGYAVVLIAFYVDFFYNVIIAWSLYYFFASFTFNLPWTSCNNSWNTPNCREFHWSEDgtvpcrSANQSFSAENQSAQS 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  205 DR-RSPVIEFWENKVLRL--SGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVL 281
Cdd:cd11556 161 ENfTSAASEYFERGVLELnrSEGVHDLGNIRWDIALCLFAVYLICYFSLWKGIHTSGKVVWFTALFPYVVLFILLIRGVT 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  282 LPGALDGIIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFS 361
Cdd:cd11556 241 LPGSFNGIQYYLTPNFEALKKAEVWVDAATQVFFSLGPGFGVLLAYASYNKFHNNVYKDALLTSFINCATSFLSGFVIFS 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  362 ILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPAsyyFRF 441
Cdd:cd11556 321 VLGYMAHRSGVPIEDVATEGPGLVFVVYPEALSTMPGSTFWSLIFFMMLMTLGLDSSFGGSEAIITALSDEFPI---IKR 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  442 QREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSAsGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKW 521
Cdd:cd11556 398 HRELFVGCLFSFYFVIGLASCTQGGFYFFHLLDRYAA-GYSILIAVLFEAIAVSWIYGTDRFCQDIKEMLGFPPGIYWKV 476
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 5032097  522 CWSFFTPLVCMGIFIFNVVYYEPLVYNNtYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQP 597
Cdd:cd11556 477 CWKFIAPIFLLFIITYGLIGYQPLTYDD-YVYPTWANALGWCIAGSSISMIPIVAIYKLLSTPGTLRQRFKILTTP 551
SLC6sbd-B0AT-like cd10332
System B(0) neutral amino acid transporter AT1, 2 and 3, and related proteins; solute-binding ...
52-574 1.60e-165

System B(0) neutral amino acid transporter AT1, 2 and 3, and related proteins; solute-binding domain; This subgroup includes the solute-binding domain of transmembrane transporters, which transport, i) neutral amino acids: NTT4 (also called XT1), SBAT1 (also called B0AT2, v7-3, NTT7-3), and B0AT1 (also called HND); the human genes encoding these are SLC6A17, SLC6A15, and SLC6A19 respectively, ii) glycine: B0AT3 (also called Xtrp2, XT2), iii) imino acids, such as proline, pipecolate, MeAIB, and sarcosine: SIT1 (also called XTRP3, XT3, IMINO). The human genes encoding B0AT3 and SIT1 are SLC6A18 and SLC6A20 respectively. Transporters in this subgroup may play a role in disorders including major depression, Hartnup disorder, increased susceptibility to myocardial infarction, and iminoglycinuria. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271364  Cd Length: 531  Bit Score: 487.93  E-value: 1.60e-165
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:cd10332   1 RPAWDNKLQFLLATIGYAVGLGNVWRFPYLCQKNGGGAFLIPYFIMLILEGIPLFFLELAIGQRLRKGSIGVWNtISPYL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEifrheDCANASlanltcdqladrrsPV 210
Cdd:cd10332  81 GGVGIASVVVSFLVALYYNVIIAWCFFYLFNSFQYPLPWSSCPTNGNGTGYVE-----ECAKSS--------------PT 141
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 IEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGII 290
Cdd:cd10332 142 QYFWYRTTLDISPSIDESGGLNWWMTLCLLLAWIIVYLCMMKGIKSSGKVVYFTATFPYIVLIIFFIRGLTLKGAGDGLK 221
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  291 YYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQ 370
Cdd:cd10332 222 HMFTPKFEKLLDPQVWLDAATQIFFSLGLGFGSLIAFSSYNPPKNNCQRDAVLVSLINCFTSIFASIVVFSVLGFKINNV 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  371 GVHISKV--------------AESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLlpaS 436
Cdd:cd10332 302 TLTENQTlgltncsledeldeAVQGTGLAFIVFTEAITKMPGAPFWSVLFFLMLLTLGLGSMFGTLEGVVTPLFDS---K 378
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  437 YYFRFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSASgTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPC 516
Cdd:cd10332 379 ILPKVPKEYLTGLVCLVCFLIGLIFTQRSGNYWVQMFDSYAGT-LPLLIIALFEMIAVSYVYGLDRFEEDIEYMTGKRPG 457
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 5032097  517 PWMKWCWSFFTPLVCMGIFIFNVVYY--EPLVY---NNTYV------YPWWGEAMGWAFALSSMLCVPL 574
Cdd:cd10332 458 WYWKITWRYVSPLLMLVILVASIIQLitKPPTYsawNAELAkteslpYPNWGLAVIILLILLSILPIPG 526
SLC6sbd_GlyT2 cd11499
Na(+)- and Cl(-)-dependent glycine transporter GlyT2; solute-binding domain; GlyT2 (also ...
52-609 2.54e-162

Na(+)- and Cl(-)-dependent glycine transporter GlyT2; solute-binding domain; GlyT2 (also called NET1) is a membrane-bound transporter that re-uptakes glycine from the synaptic cleft. Human GlyT2 is encoded by the SLC6A5 gene. GlyT2 is expressed in brain and spinal cord. GlyT2 may play a role in pain, and in spasticity. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271389  Cd Length: 597  Bit Score: 482.20  E-value: 2.54e-162
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFK 131
Cdd:cd11499   1 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLALAGLPIFLLEVSLGQFASQGPVSVWKAIPALQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDC------------------VEIFRHEDC--- 190
Cdd:cd11499  81 GCGIAMLIISVLIAIYYNIIMCYTLFYLFASLVEVLPWASCNNPWNTPECkdkdmllldsciisdrpiIQIKNSTFCmta 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  191 -ANASLANLTCDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPY 269
Cdd:cd11499 161 yPNVTMVNFTSVDNKTFVSGSEEYFKYNVLKISAGIEYPGEIRWPLAACLFLAWLIVYASLAKGIKTSGKVVYFTATFPY 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  270 VVLVVLLVRGVLLPGALDGIIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINS 349
Cdd:cd11499 241 VVLVILLIRGVTLPGAGSGIWYFITPKWEKLNDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNS 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  350 GTSFFAGFVVFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGL 429
Cdd:cd11499 321 ATSIFAGFVIFSVIGFMAHELKVPIESVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSV 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  430 LDLLPAsyYFRFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSASgTTLLWQAFWECVVVAWVYGADRFMDDIAC 509
Cdd:cd11499 401 SDEFPK--YLRTHKPQFTLVCCLSFFIMGFPMITQGGIYMLQLVDTYAAS-YSLVIIAIFELVGISYIYGLQRFCEDIEM 477
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  510 MIGYRPCPWMKWCWSFFTPLVCMGIFIFNVVYYEPLVYNNtYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAE 589
Cdd:cd11499 478 MIGFQPNKFWKVCWAFVTPTILTFILAFSFYQWEPMTYGS-YTYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGSFIE 556
                       570       580
                ....*....|....*....|..
gi 5032097  590 RWQHLT--QPIWGLHHLEYRAQ 609
Cdd:cd11499 557 RLKLVCspQPDWGPFLAKHRGE 578
SLC6sbd_DAT1 cd11514
Na(+)- and Cl(-)-dependent dopamine transporter 1; solute-binding domain; DAT1 (also called ...
52-597 8.50e-162

Na(+)- and Cl(-)-dependent dopamine transporter 1; solute-binding domain; DAT1 (also called DAT), is a plasma membrane transport protein that functions at the dopaminergic synapses to transport dopamine from the extracellular space back into the presynaptic nerve terminal. Human DAT1 is encoded by the SLC6A3 gene, and is expressed in the brain. DAT1 may play a role in diseases or disorders related to dopaminergic neurons, including attention-deficit hyperactivity disorder (ADHD), Tourette syndrome, Parkinson's disease, alcoholism, drug abuse, schizophrenia, extraversion, and risky behavior. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 212083  Cd Length: 555  Bit Score: 479.43  E-value: 8.50e-162
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFK 131
Cdd:cd11514   1 RETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLFFMVIAGMPLFYMELALGQFNREGAAGVWKICPIFK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCANASLANLTCdqladRRSPVI 211
Cdd:cd11514  81 GVGFTVILISLYVGFFYNVIIAWALFYLFSSFTGELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTY-----KTTPAA 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  212 EFWENKVLRL--SGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGI 289
Cdd:cd11514 156 EYFERGVLHLheSHGIHDLGPPRWQLTSCLVVVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGI 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  290 IYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAE 369
Cdd:cd11514 236 KAYLSVDFLRLCEASVWIDAATQICFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFFSGFVVFSFLGYMAQK 315
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  370 QGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPasyYFRFQREISVAL 449
Cdd:cd11514 316 HNVPIGDVAKDGPGLIFIIYPEAIATLPLSSVWAVIFFIMLLTLGIDSAMGGMESVITGLIDEFK---FLHRHRELFTLF 392
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  450 CCALCFVIDLSMVTDGGMYVFQLFDYYsASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPL 529
Cdd:cd11514 393 IVLSTFLISLFCVTNGGIYVFTLLDHF-AAGTSILFGVLIEAIGIAWFYGVGRFSDDIEEMIGQRPGLYWRLCWKFVSPC 471
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 5032097  530 VCMGIFIFNVVYYEPLVYNNtYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQP 597
Cdd:cd11514 472 FLLFVVVVSIVTFRPPKYGS-YIFPDWANMVGWCLAISSMAMVPLYAIYKFCSLPGSFREKLAYAITP 538
SLC6sbd_NET cd11512
Na(+)- and Cl(-)-dependent norepinephrine transporter NET; solute-binding domain; NET (also ...
52-597 7.65e-160

Na(+)- and Cl(-)-dependent norepinephrine transporter NET; solute-binding domain; NET (also called NAT1, NET1), is a transmembrane transporter that transports the neurotransmitter norepinephrine from synaptic spaces into presynaptic neurons. Human NET is encoded by the SLC6A2 gene. NET is expressed in brain, peripheral nervous system, adrenal gland, and placenta. NET may play a role in diseases or disorders including depression, orthostatic intolerance, anorexia nervosa, cardiovascular diseases, alcoholism, and attention-deficit hyperactivity disorder. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 212081  Cd Length: 560  Bit Score: 474.84  E-value: 7.65e-160
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFK 131
Cdd:cd11512   1 RETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPCFK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEifrhEDCANASLANLTCDQLADRRSPVI 211
Cdd:cd11512  81 GVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTSELPWTTCGNVWNSPNCTD----PKLLNASVLGNGTKYSKYKLTPAA 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  212 EFWENKVLRL--SGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGI 289
Cdd:cd11512 157 EFYERGVLHLheSAGIHDLGLPRWQLTLCLFVVVIVLFFSLWKGVKTSGKVVWITATLPYVVLFVLLIHGVTLPGAFNGI 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  290 IYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAE 369
Cdd:cd11512 237 NAYLHIDFKRLKEATVWIDAATQIFYSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFAIFSILGYMAHE 316
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  370 QGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRFQREISVAL 449
Cdd:cd11512 317 HKVKIEDVATEGAGLVFILYPEAISTLSGSTFWAVVFFIMLLTLGIDSSMGGMEAVITGLADDFSILKKHRKLFTFGVAF 396
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  450 ccaLCFVIDLSMVTDGGMYVFQLFDYYsASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPL 529
Cdd:cd11512 397 ---ITFLLALFCITNGGIYVLTLLDTF-AAGTSILFAVLMEAIGVSWFYGVDRFSDDIQQMMGFRPGLYWRLCWKFVSPA 472
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 5032097  530 VCMGIFIFNVVYYEPLVYNNtYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQP 597
Cdd:cd11512 473 FLLFVVIVSIINFKPLTYDD-YNFPPWANRTGWGIALSSMLLVPIYVIYKFFTVPGTFEERLAYCITP 539
SLC6sbd cd10324
Solute carrier 6 family, neurotransmitter transporters; solute-binding domain; This family ...
53-539 7.15e-159

Solute carrier 6 family, neurotransmitter transporters; solute-binding domain; This family represents the solute-binding domain of SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family). These use sodium and chloride electrochemical gradients to catalyze the thermodynamically uphill movement of a variety of substrates, and include neurotransmitter transporters (NTTs). The latter are Na+/Cl--dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. NTTs are widely expressed in the mammalian brain, and are involved in regulating neurotransmitter signaling and homeostasis, through facilitating the uptake of released neurotransmitters from the extracellular space into neurons and glial cells. NTTs are the target of a range of therapeutic drugs for the treatment of psychiatric diseases, such as major depression, anxiety disorders, attention deficit hyperactivity disorder and epilepsy. In addition, they are the primary targets of cocaine, amphetamines and other psychostimulants. This family also includes Drosophila Blot which is expressed primarily in epithelial tissues of ectodermal origin and in the nervous system of the embryo and larvae, but in addition found in the developing oocyte and the freshly laid egg. A lack or reduction of Blot function during oogenesis results in early arrest of embryonic development. 12 transmembrane helices (TMs) appears to be common for eukaryotic and some prokaryotic and archaeal SLC6s, (a core inverted topology repeat, TM1-5 and TM6-10, plus TMs11-12; TMs numbered to conform to the SLC6 Aquifex aeolicus LeuT), although a majority of bacterial, and some archaeal SLC6s lack TM12, for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.


Pssm-ID: 271359  Cd Length: 415  Bit Score: 466.62  E-value: 7.15e-159
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   53 ETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSI-NVWNICPLFK 131
Cdd:cd10324   1 EQWGSKLEFLLSCIGYAVGLGNIWRFPYLAYENGGGAFLIPYLIMLFLVGIPLFYLELALGQYTSRGPVgAFWRIAPLFK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFtttlpwatcghtwntpdcveifrhedcanaslanltcdqladrrspvi 211
Cdd:cd10324  81 GVGYAQVLVSFLVAIYYNVIIAWTLYYLFASF------------------------------------------------ 112
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  212 efwenkvlrlsgglevpgaLNWEVTLCLLACWVLVYFCvwKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGIIY 291
Cdd:cd10324 113 -------------------INWELFLCLLLAWILVYLC--KGVKSIGKGVKFTGPFPYVLLLFLLIRGVTLPGAGDGILF 171
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  292 YLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQG 371
Cdd:cd10324 172 YLTPDWSKLLDPKVWIAAATQIFFSLGIGFGGLITYASYNKFKNNIYRDALIVAILNTLTSLLAGFVIFSILGFLAHEPG 251
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  372 VHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPasyYFRFQREISVALCC 451
Cdd:cd10324 252 TPVEDVVASGPGLAFIVYPEAIAQMPGPQLWSVLFFLMLFLLGLDSQFAMVEVIVTALADEFP---KLRKRRWLVTLGVC 328
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  452 ALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLwQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLVC 531
Cdd:cd10324 329 VVGFLLGLPYTTPGGIYVLDLFDYYAAGFSLLV-IALLELIAIAWIYGVDRFLEDIEFMLGIRPSIYWRICWKFITPVVL 407

                ....*...
gi 5032097  532 MGIFIFNV 539
Cdd:cd10324 408 LIILVFSL 415
SLC6sbd_GlyT1 cd11498
Na(+)- and Cl(-)-dependent glycine transporter GlyT1; solute-binding domain; GlyT1 is a ...
52-607 7.59e-154

Na(+)- and Cl(-)-dependent glycine transporter GlyT1; solute-binding domain; GlyT1 is a membrane-bound transporter that re-uptakes glycine from the synaptic cleft. Human GlyT1 is encoded by the SLC6A9 gene. GlyT1 is expressed in brain, pancreas, uterus, stomach, spleen, liver, and retina. GlyT1 may play a role in schizophrenia. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 212067  Cd Length: 585  Bit Score: 460.15  E-value: 7.59e-154
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFK 131
Cdd:cd11498  17 RGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPMFK 96
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCANAS------LANLT--CDQL 203
Cdd:cd11498  97 GVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTRVLPWTYCNNPWNTPDCAGVLSTNRSNATFanmsavVSNLTelLNRT 176
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  204 ADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLP 283
Cdd:cd11498 177 LKRTSPSEEYWRRYVLNISDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLE 256
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  284 GALDGIIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSIL 363
Cdd:cd11498 257 GAISGIMYYLTPQWDKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSIL 336
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  364 GFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRFQR 443
Cdd:cd11498 337 GFMANHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAVVDEIGNDWIIRNKT 416
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  444 EISVALCCAlCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFWeCVVVAWVYGADRFMDDIACMIGYRPCPWMKWCW 523
Cdd:cd11498 417 YVTLGVAII-GFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIM-CIAIMYIYGHRNYFKDIEMMLGFPPPLFFQICW 494
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  524 SFFTPLVCMGIFIFNVVYYEPLVYNNtYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKG-TMAERWQHLTQPI--WG 600
Cdd:cd11498 495 RFVSPAIIFFILIFTVIQYRPITYND-YVYPGWAIVIGFLMALSSVICIPIYAIFKICMSEGdTFLERLKNAVKPSkdWG 573

                ....*..
gi 5032097  601 LHHLEYR 607
Cdd:cd11498 574 PALQEHR 580
SLC6sbd_SERT cd11513
Na(+)- and Cl(-)-dependent serotonin transporter SERT; solute-binding domain; SERT (also ...
52-597 1.87e-152

Na(+)- and Cl(-)-dependent serotonin transporter SERT; solute-binding domain; SERT (also called 5-HTT), is a transmembrane transporter that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The antiport of a K+ ion is believed to follow the transport of serotonin and promote the reorientation of SERT for another transport cycle. Human SERT is encoded by the SLC6A4 gene. SERT is expressed in brain, peripheral nervous system, placenta, epithelium, and platelets. SERT may play a role in diseases or disorders including anxiety, depression, autism, gastrointestinal disorders, premature ejaculation, and obesity. It may also have a role in social cognition. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271399  Cd Length: 537  Bit Score: 454.67  E-value: 1.87e-152
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVW-NICPLF 130
Cdd:cd11513   1 RETWGKKMDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLIPYTIMAIFGGIPLFYMELALGQYHRNGCISIWrKICPIF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEdcaNASLANltcdqlaDRRSPV 210
Cdd:cd11513  81 KGIGYAICIIALYVASYYNTIIAWALYYLYSSFTDELPWTSCNNSWNTGNCTNYFAKD---NITWTL-------HSTSPA 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 IEFWENKVLRL--SGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDG 288
Cdd:cd11513 151 EEFYTRHVLQVhrSKGLGDLGGISWQLTLCLFLIFTIVYFSIWKGVKTSGKVVWVTATFPYIVLFILLVRGATLPGAWRG 230
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  289 IIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAA 368
Cdd:cd11513 231 VVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYQDALVTSVVNCLTSFVSGFVIFTVLGYMAE 310
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  369 EQGVHISKVA-ESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYFRfqREISV 447
Cdd:cd11513 311 MRNEDVSEVAkDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWSKR--REKFV 388
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  448 ALCCALCFVIDLSMVTDGGMYVFQLFDYYsASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFT 527
Cdd:cd11513 389 LGLVIVCFLGSLATLTFGGAYVVKLLEEY-ATGPAVLTVVLLEAVAVSWFYGITQFCNDVKEMLGFSPGWFWRVCWVAIS 467
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  528 PLVCMGIFIFNVVYYEPLVYNNtYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQP 597
Cdd:cd11513 468 PLFLLFIICSFLMNPPQLRLFD-YNYPYWSIVVGYCIGTSSIICIPIYMAYRLIITPGTLKERIIKSITP 536
SLC6sbd_ATB0 cd11501
Na(+)- and Cl(-)-dependent beta-alanine transporter ATB0+; solute-binding domain; ATB0+ (also ...
52-600 4.18e-136

Na(+)- and Cl(-)-dependent beta-alanine transporter ATB0+; solute-binding domain; ATB0+ (also known as the beta-alanine carrier) is a transmembrane transporter with a broad substrate specificity; it can transport non-alpha-amino acids such as beta-alanine with low affinity, and can transport dipolar and cationic amino acids such as leucine and lysine, with a higher affinity. It may have a role in the absorption of essential nutrients and drugs in the distal regions of the human gastrointestinal tract. Human ATB0+ is encoded by the SLC6A14 gene. ATB0+ is expressed in the lung, trachea, salivary gland, mammary gland, stomach, and pituitary gland. ATB0+ may play a role in obesity, and its upregulation may have a pathogenic role in colorectal cancer. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271391  Cd Length: 602  Bit Score: 415.05  E-value: 4.18e-136
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFK 131
Cdd:cd11501   1 RGNWSKKSDYLLSMIGYAVGLGNVWRFPYLTYKNGGGAFLIPYTIMLALAGLPLFFMECSLGQFASLGPISVWRILPLFQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  132 GLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCgHTWNTPDCVEIFRHEDCaNASLA--------------N 197
Cdd:cd11501  81 GVGITMVLISTFVAIYYNVIIAYSLYYLFASFQSELPWSDC-FSWADENCSKTPIVTHC-NVSTAnngihenkswvdinN 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  198 LTCDQ----LADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLV 273
Cdd:cd11501 159 LTCINgsiiYQPGQLPSEQYWNKVALQRSSGMDETGVIVWYLALCLLLSWIIVGAALFKGIKSSGKVVYFTALFPYVVLL 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  274 VLLVRGVLLPGALDGIIYYL--KPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGT 351
Cdd:cd11501 239 ILLVRGATLEGASDGIEYYIgaQSNITKLMEAEVWKDAATQIFYSLSVAWGGLVALSSYNKFHNNCYSDAIVVCVTNCLT 318
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  352 SFFAGFVVFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLD 431
Cdd:cd11501 319 SVFAGFAIFSVLGHMAHVSGRPVSEVVDSGFDLAFIAYPEALSKLPISPLWSILFFFMLLTLGLDSQFASIETITTTIQD 398
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  432 LLPAsyYFRFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSAsGTTLLWQAFWECVVVAWVYGADRFMDDIACMI 511
Cdd:cd11501 399 AYPK--VMKKMRIPITLGVCVILFLLGLVCVTQAGIYWVNLIDHFCA-GWGILFAAVLELVGIIWIYGGNRFIEDIEMMI 475
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  512 GYRPCP-WMKW--CWSFFTPLVCMGIFIFNVVYYEPLVYNNTyVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMA 588
Cdd:cd11501 476 GAKSWIfWLWWraCWFFITPVLLIAILIWSLVTFHSPTYGSV-PYPDWGTALGWCMIIFCLIWIPIVAVIKIIKAKGNLF 554
                       570
                ....*....|....
gi 5032097  589 ERWQHLTQPI--WG 600
Cdd:cd11501 555 QRIKSCCRPTsnWG 568
SLC6sbd_NTT4-like cd11515
Na(+)-dependent neurotransmitter transporter 4, and related proteins; solute-binding domain; ...
52-574 6.46e-117

Na(+)-dependent neurotransmitter transporter 4, and related proteins; solute-binding domain; This subgroup includes the solute-binding domain of NTT4 (also called XT1) and SBAT1 (also called B0AT2, v7-3, NTT7-3); both these proteins can transport neutral amino acids. Human SBAT1 is encoded by the SLC6A15 gene, a susceptibility gene for major depression. SBAT1 is expressed in brain, and may have a role in transporting neurotransmitter precursors into neurons. Human NTT4 is encoded by the SLC6A17 gene. NTT4 is specifically expressed in the nervous system, in synaptic vesicles of glutamatergic and GABAergic neurons, and may play an important role in synaptic transmission. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271400  Cd Length: 530  Bit Score: 362.73  E-value: 6.46e-117
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:cd11515   1 RPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLIVIGIPLFFLELSVGQRIRRGSIGVWNyISPRL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNtpdcveifrhedcANASLANLTCDQladrRSPV 210
Cdd:cd11515  81 GGIGFASCVVCLFVALYYNVIIGWSLFYFSQSFQQPLPWDQCPLVKN-------------ASHTFVEPECEK----SSAT 143
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 IEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGII 290
Cdd:cd11515 144 TYYWYREALNISDSISESGGLNWKMTICLLAAWVIVCLAMIKGIQSSGKIMYFSSLFPYVVLICFLIRALLLNGSVDGIR 223
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  291 YYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGF----M 366
Cdd:cd11515 224 HMFTPKLEIMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFkiqkV 303
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  367 AAEQ----GVHISKVAE------SGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLlpas 436
Cdd:cd11515 304 KEEEfpalHLNPCLIEDelnkavQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLVNLGLGSMFGTIEGITTPIVDT---- 379
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  437 yyFRFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSASgTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPC 516
Cdd:cd11515 380 --FKVRKEILTVICCLLAFCIGLIFVQRSGNYFVTMFDDYSAT-LPLLIVVILENIAVAFVYGIDKFMEDLKDMLGFRPY 456
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 5032097  517 PWMKWCWSFFTPLVCMGIFIFNVVYY--EPLVYN---------NTYVYPWWGEAMGWAFALSSMLCVPL 574
Cdd:cd11515 457 RYYYYMWKYISPLMLLSLLIASIVNMglSPPGYNawiedkaseRFLSYPTWGMVLCISLIVVAILPIPV 525
SLC6sbd_B0AT3 cd11517
glycine transporter, B0AT3; solute-binding domain; B0AT3 (also called Xtrp2, XT2) transports ...
52-581 6.27e-114

glycine transporter, B0AT3; solute-binding domain; B0AT3 (also called Xtrp2, XT2) transports glycine. Human B0AT3 is encoded by the SLC6A18 gene. B0AT3 is expressed in the kidney. Mutations in the SLC6A18 gene may contribute to the autosomal recessive disorder iminoglycinuria and its related disorder hyperglycinuria. SLC6A18 or its neighboring genes are associated with increased susceptibility to myocardial infarction. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 212086  Cd Length: 576  Bit Score: 356.43  E-value: 6.27e-114
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:cd11517   2 RPKWDNKAQYLLSCIGFAVGLGNIWRFPYLCQTYGGGAFLIPYFIALVFEGIPLFHLELAIGQRLRKGSIGVWTtISPYL 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEifrheDCANASlanltcdqladrrsPV 210
Cdd:cd11517  82 GGVGLGCVTVSFLVSLYYNTILAWVLWYFLNSFQHPLPWSSCPLDLNRTGFVE-----ECQGST--------------AV 142
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 IEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGII 290
Cdd:cd11517 143 SYFWYRQTLNITPDINDSGSIQWWLLLCLAACWAIVYLCVIRGIETTGKVIYFTALFPYLVLTIFLIRGLTLPGATEGLI 222
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  291 YYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAA-- 368
Cdd:cd11517 223 YLFTPNMHILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPRNDCEKDAVTIALVNSMTSLYASIPVFSVLGFKATnd 302
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  369 -------------------EQGVHI---------------SKVAE----------------SGPGLAFIAYPRAVTLMPV 398
Cdd:cd11517 303 yehcldrnilslinefdfpEQSISRdnypsvlmhlnatwpERVAQlplkaclledfldksaSGPGLAFIVFTEAVLHMPG 382
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  399 APLWAALFFFMLLLLGLDSQFVGVEGFITGLLDL--LPASyyfrFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYY 476
Cdd:cd11517 383 AQVWAVLFFGMLFTLGLSSMFGNVEGVITPLLDVgvLPRW----VPKEALTGLVCLVCFLSALCFTLQSGNYWLEIFDSF 458
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  477 SASgTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLVCMGIFIFNVVY--------------Y 542
Cdd:cd11517 459 AAS-LNLLVIAFFEVVGVVYVYGIKRFCDDIEWMTGRRPSLYWRLTWRVVSPLLLLTIFVAYIILlfqkppsykawnpkY 537
                       570       580       590
                ....*....|....*....|....*....|....*....
gi 5032097  543 EPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLL 581
Cdd:cd11517 538 ELFPSREEKLYPGWVQAICVLLSLLPVLWVPVVALAQLL 576
SLC6sbd_SBAT1 cd11522
Sodium-coupled branched-chain amino-acid transporter 1; solute-binding domain; SBAT1 (also ...
52-574 1.18e-110

Sodium-coupled branched-chain amino-acid transporter 1; solute-binding domain; SBAT1 (also called B0AT2, v7-3, NTT7-3) is a high-affinity Na(+)-dependent transporter for large neutral amino acids, including leucine, isoleucine, valine, proline and methionine. Human SBAT1 is encoded by the SLC6A15 gene, a susceptibility gene for major depression. SBAT1 is expressed in brain, and may have a role in transporting neurotransmitter precursors into neurons. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 212091  Cd Length: 580  Bit Score: 348.06  E-value: 1.18e-110
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:cd11522   1 RPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLVPYLILLLVIGIPLFFLELSVGQRIRRGSIGVWNyISPKL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATC------GHTWNTPDCveifrhedcanaslanltcdqla 204
Cdd:cd11522  81 GGIGFASCIVCFFVALYYNVIIGWSLFYFSQSFQQPLPWDQCplvknaSHTFVEPEC----------------------- 137
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  205 DRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPG 284
Cdd:cd11522 138 EKSSATTYYWYREALNISSSISESGGLNWKMTICLLAAWVMVCLAMIKGIQSSGKIMYFSSLFPYVVLICFLIRALLLNG 217
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  285 ALDGIIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILG 364
Cdd:cd11522 218 SVDGIRHMFTPKLEIMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLG 297
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  365 FMA-----------------------AEQGV---HIS-----------------KVAES--------------------- 380
Cdd:cd11522 298 FKAnvinekciiqnsekiikllkmgnLSQDIiphHINfssitaedynlvydiiqKVKEEefpalglkscqiedelnkavq 377
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  381 GPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLlpasyyFRFQREISVALCCALCFVIDLS 460
Cdd:cd11522 378 GTGLAFIAFTEAMTHFPASPFWSVMFFLMLVNLGLGSMFGTIEGIITPIVDT------FKVRKEILTVICCLLAFCIGLI 451
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  461 MVTDGGMYVFQLFDYYSASgTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLVCMGIFIFNVV 540
Cdd:cd11522 452 FVQRSGNYFVTMFDDYSAT-LPLLIVVILENIAVSFVYGIDKFMEDLKDMLGFTPNRYYYYMWKYISPLVLLSLLVASVV 530
                       570       580       590       600
                ....*....|....*....|....*....|....*....|....*
gi 5032097  541 -----------YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPL 574
Cdd:cd11522 531 qmglsppgynaWIEDKATEEFLSYPTWGLVVCISLVVLAILPVPV 575
SLC6sbd_SIT1 cd11518
Na(+)- and Cl(-)-dependent imino acid transporter SIT1; solute-binding domain; SIT1 (also ...
52-578 1.96e-107

Na(+)- and Cl(-)-dependent imino acid transporter SIT1; solute-binding domain; SIT1 (also called XTRP3, XT3, IMINO) transports imino acids, such as proline, pipecolate, MeAIB, and sarcosine. It has weak affinity for neutral amino acids such as phenylalanine. Human SIT1 is encoded by the SLC6A20 gene. SIT1 is expressed in brain, kidney, small intestine, thymus, spleen, ovary, and lung. SLC6A20 is a candidate gene for the rare disorder iminoglycinuria. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271401  Cd Length: 576  Bit Score: 339.63  E-value: 1.96e-107
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVW-NICPLF 130
Cdd:cd11518   4 RPLWDNPLQFVFACISYAVGLGNVWRFPYLCQMYGGGGFLIPYLIMLILEGMPLLYLELAVGQLMRQGSIGAWkSISPYL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEifrheDCanaslanltcdqlaDRRSPV 210
Cdd:cd11518  84 GGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDPLPWSNCPLNSNHTAYNE-----EC--------------EKASPT 144
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 IEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGII 290
Cdd:cd11518 145 QYFWYRKTLNISPSILENGGIQWELAVCLILAWLVVYLCILRGTESTGKVVYVTALIPYLVLLIYLIRGLTLHGAANGLA 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  291 YYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAA-- 368
Cdd:cd11518 225 YMFTPKLEQLANPKTWINAATQIFFSLGLGFGSLIAFASYNEPSNNCERHAIIVSLINSGTSIFASIVTFSIYGFKATfn 304
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  369 ------------------EQG----------------VHISKVAE------------------SGPGLAFIAYPRAVTLM 396
Cdd:cd11518 305 yencmkkvillltntfdlEEGsvttenlgdmknylasAFPQEYSSivpqikncslekeldtavQGTGLAFIVYTEAIKNM 384
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  397 PVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLLPASYYfrFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYY 476
Cdd:cd11518 385 EVSQLWSVLYFLMLLMLGIGSMLGNTAAILTPLTDSKFISSH--LPKEAISGLLCFTNCIIGLVFTMEAGNYWFDIFNDY 462
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  477 SASgTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLVCMGIFIFnvvYYEPLVYNNTYVYPWW 556
Cdd:cd11518 463 AAT-LSLLLIVLVETIAVCYVYGLRRFENDLEAMTGHKLSWYWKIMWAFVSPLLIVSLFIF---YLTDYIMTGTLQYQAW 538
                       570       580       590
                ....*....|....*....|....*....|....*..
gi 5032097  557 GEAMG---------WAFAL------SSMLCVPLHLLG 578
Cdd:cd11518 539 DATLGqlvtkdyppYALAVigllvaASTCCIPLVAIV 575
SLC6sbd_NTT4 cd11521
Na(+)-dependent neurotransmitter transporter 4; solute-binding domain; NTT4 (also called XT1) ...
52-536 5.96e-103

Na(+)-dependent neurotransmitter transporter 4; solute-binding domain; NTT4 (also called XT1) transports the neutral amino acids, proline, glycine, leucine, and alanine, and may play an important role in synaptic transmission. Human NTT4 is encoded by the SLC6A17 gene. NTT4 is specifically expressed in the nervous system, in synaptic vesicles of glutamatergic and GABAergic neurons. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271403  Cd Length: 589  Bit Score: 328.09  E-value: 5.96e-103
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:cd11521   1 RPAWNSKLQYILAQIGYSVGLGNVWRFPYLCQKNGGGAYLVPYLVLLIIIGIPLFFLELAVGQRIRRGSIGVWNyICPRL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCghtwntpdcvEIFRhedcaNASLANLTCDqlADRRSPV 210
Cdd:cd11521  81 GGIGYASCLVCFFVGLYYNVIIGWSIFYFFKSFQYPLPWSEC----------PVVR-----NGSVAVVEAE--CEKSSAT 143
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 IEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGII 290
Cdd:cd11521 144 TYFWYREALDISNSISESGGLNWKMTLCLLVAWSLVGMAMIKGIQSSGKVMYFSSLFPYVVLVCFLVRGLLLRGAVDGIL 223
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  291 YYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMA--- 367
Cdd:cd11521 224 HMFTPKLDKMLDPQVWREAATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSFINFFTSVLATLVVFAVLGFKAnim 303
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  368 ----------------------------------------AEQGVHISKVAE---------------------SGPGLAF 386
Cdd:cd11521 304 nekcvvenaekilgylntnvlshdlipphvnfshlttkdyNEMYRVIMTVKEdhfkelgldaclledeldksvQGTGLAF 383
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  387 IAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDLlpasyyFRFQREISVALCCALCFVIDLSMVTDGG 466
Cdd:cd11521 384 IAFTEAMTHFPASPFWSVMFFLMLINLGLGSMIGTMSGITTPIIDT------FKVRKEVFTVGCCIFAFLVGLIFVQRSG 457
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  467 MYVFQLFDYYSASgTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLvCMGIFI 536
Cdd:cd11521 458 NYFVTMFDDYSAT-LPLTVVVILENIAVAWIYGTKKFMQELTEMLGFRPYQFYFYTWKYVSPI-CMAVLM 525
SLC6sbd_B0AT1 cd11516
Na(+)-dependent neutral amino acids transporter, B0AT1; solute-binding domain; B0AT1 (also ...
52-540 4.12e-102

Na(+)-dependent neutral amino acids transporter, B0AT1; solute-binding domain; B0AT1 (also called HND) transports neutral amino acids. Human B0AT1 is encoded by the SLC6A19 gene. B0AT1 is expressed primarily in the kidney and intestine; it requires collectrin for expression in the kidney, and angiotensin-converting enzyme 2 for expression in the intestine. Interaction with these two proteins implicates B0AT1 in more complex processes such as glomerular structure, exocytosis, and blood pressure control. The autosomal recessive disorder, Hartnup disorder, is caused by mutations in B0AT1. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 212085  Cd Length: 581  Bit Score: 325.69  E-value: 4.12e-102
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:cd11516   1 RPKWDNKAQYMLTCVGFCVGLGNVWRFPYLCQSHGGGAFMIPFLILLVFEGIPLLHLEFAIGQRLRKGSVGVWStIHPTL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEifrheDCAnaslanltcdqladRRSPV 210
Cdd:cd11516  81 KGVGIASMCVSFLVSLYYNTIIAWVMWYFFNSFQEPLPWSQCPLNENRTGYIP-----ECA--------------KSSPV 141
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 IEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGII 290
Cdd:cd11516 142 DYFWYRETLNTSTSIDDSGGIQWWMVLCLACAWGVLYVCTIRGIETTGKAVYVTSTLPYLVLTIFLIRGLTLKGSVNGIK 221
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  291 YYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQ 370
Cdd:cd11516 222 FLFTPDINELANPVTWLDAGAQVFYSFSLAFGGLISFSSYNSVHNNCEKDAVIISVINGFTSIYAATVIYSIIGFRATER 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  371 ---------------------------------------GVHISKV-------------AESGPGLAFIAYPRAVTLMPV 398
Cdd:cd11516 302 fddcfdgniltlinafdlpegnitqdnyqdmqqslnstdPDIISSLslqtcdlnnflseGVEGTGLAFIVFTEAITKMPL 381
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  399 APLWAALFFFMLLLLGLDSQFVGVEGFITGLLDL--LPASYyfrfQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYY 476
Cdd:cd11516 382 SPLWSVLFFIMLFCLGLSSMFGNMEGVLVPLQDLkvIPKSW----PKEIITGLICLVSFLIGLIFVLGSGNYWLALFDSF 457
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 5032097  477 SASgTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLVCMGIFIFNVV 540
Cdd:cd11516 458 AGS-IPLLIIAFCEMFSVVYVYGIDRFNKDIEFMIGHKPNIFWQATWRVISPLIMLVIFLFYFV 520
SLC6sbd_u1 cd10334
uncharacterized bacterial and archaeal solute carrier 6 subfamily; solute-binding domain; SLC6 ...
52-566 4.30e-93

uncharacterized bacterial and archaeal solute carrier 6 subfamily; solute-binding domain; SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter.


Pssm-ID: 271366  Cd Length: 480  Bit Score: 299.03  E-value: 4.30e-93
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVW-NICPLF 130
Cdd:cd10334   1 REQWGSRAGFILAAIGSAVGLGNIWRFPYVAYENGGGAFLIPYLIALLTAGIPLLILEYGLGHKYRGSAPLAFrRLNKKF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTttLPWatcghtWNTPDcveifrhedcanaslanltcdqladrrspv 210
Cdd:cd10334  81 EWIGWWQVLVAFVIATYYAVIIAWALSYLFFSFT--LAW------GDDPE------------------------------ 122
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 iEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKS-TGKIVYFTATFPYVVLVVLLVRGVLLPGALDGI 289
Cdd:cd10334 123 -AFFFGDFLQLSDSPFDLGGIVWPILIALVLVWLIIWFILYRGVKKgIEKASKIFMPLLFVLFLILVIRALTLPGAADGL 201
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  290 IYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAE 369
Cdd:cd10334 202 NALFTPDWSALLDPKVWIAAYGQIFFSLSLGFGIMITYASYLPKKSDLTNNALITAFANSGFEILAGIGVFSILGFMAQA 281
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  370 QGVHISKVAESGPGLAFIAYPRAVTLM-PVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDllpasyYFRFQREISVA 448
Cdd:cd10334 282 QGVPVSEVVSSGIGLAFVAFPKAINLMpPLGALFGVLFFLSLVFAGLTSLISLVEVVISAVQD------KFGLSRKKAVT 355
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  449 LCCALCFVIDLSMVTDGGMYVFQLFDYYsASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTP 528
Cdd:cd10334 356 IVCLVGFLVSLLFATGAGLYLLDIVDHF-INNYGIVLVGLVEVIVVGWVFGAEKLREHLNAVSDFKVGKWWDFLIKVVTP 434
                       490       500       510
                ....*....|....*....|....*....|....*....
gi 5032097  529 LVCMGIFIFNVVyyePLVYNNTYVYPWWGE-AMGWAFAL 566
Cdd:cd10334 435 LVLGYMLILGLI---GLLTEPYGGYPVWALlLFGWGIVA 470
SLC6sbd_NTT5 cd11502
Neurotransmitter transporter 5; solute-binding domain; Human NTT5 is encoded by the SLC6A16 ...
52-573 3.18e-84

Neurotransmitter transporter 5; solute-binding domain; Human NTT5 is encoded by the SLC6A16 gene. NTT5 is expressed in testis, pancreas, and prostate; its expression is predominantly intracellular, indicative of a vesicular location. Its substrates are unknown. This subgroup belongs to the solute carrier 6 (SLC6) transporter family.


Pssm-ID: 271392  Cd Length: 535  Bit Score: 277.39  E-value: 3.18e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLF 130
Cdd:cd11502   1 RPLWSKKTEYILAQVGFSVGLSSIWRFPYLWHHNGGGSFLLIYILMLFLVGIPLLFLEMAVGQRLRQGSIGVWKiLSPWL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTwntpdcveifrhedcANASLANLTCDqladRRSPV 210
Cdd:cd11502  81 GGVGYSSFLVCFIVGLYNNVLNSWSLFYLSQSFQFPLPWEKCPLV---------------KNSSDFDPECA----RTTPS 141
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  211 IEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGII 290
Cdd:cd11502 142 QYFWYRQTLKASDRIEDGGVLVLSLTLSLFLAWCLLCVFMINGLKSTGKMLYVLVLLPYIILLCFLIRTLFLEGAKFGLK 221
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  291 YYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQ 370
Cdd:cd11502 222 HLLVAKVSALYSLSVWRQAGGQVLYSLGLGFGTIISFSSYMPRSNNCLKDAFLVALVNLVTSLLTTPFIFAVLGFWATPA 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  371 GVH---------------ISKV-----------AESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEG 424
Cdd:cd11502 302 SIYlswlnnlpqhiksqvLSKVpecsiqkqkekIMEGPGFAFLAFSEAISLFPGSSFWSILFFLMLLILGLSTMLGIMQG 381
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  425 FITGLLDLLPasyYFRFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSASGTTLLWQAFwECVVVAWVYGADRFM 504
Cdd:cd11502 382 IITPLQDTFS---FFRKHPKLLTVGVCLLMFLCSLIFTRPSGSYYVSLLDDYWVPMPIIFIVIC-ENLAVAWAYGAKRFL 457
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  505 DDIACMIGYRPCPWMKWCWSFFTPLVCMGIFIFNVV--YYEPLVY------NNTYV---YPWWgeAMGWAFALSSMLCVP 573
Cdd:cd11502 458 ADLMILLGHPISPIFTWLWCYLTPVVLLVLFTITLIqlYVKPITYlawdssTSHEVtrpYPSW--ALGLVIFLSVIVLLP 535
SLC6sbd_u2 cd11554
uncharacterized eukaryotic solute carrier 6 subfamily; solute-binding domain; SLC6 proteins ...
55-508 4.52e-77

uncharacterized eukaryotic solute carrier 6 subfamily; solute-binding domain; SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, and are involved in regulating neurotransmitter signaling and homeostasis, and are the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter.


Pssm-ID: 212092  Cd Length: 406  Bit Score: 254.17  E-value: 4.52e-77
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   55 WTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWN-ICPLFKGL 133
Cdd:cd11554   3 WGSRTAFVLAAMGGAVGLGNLLRFPSVVYNNGGLQFFIPYLLALVLLAIPILILELALGQAYRGGCVKAFNlINRRAKGV 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  134 GYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTtlpwatcghtwntpdcveifrhedcanaslanltcdqladrrspvief 213
Cdd:cd11554  83 GAAVVFGGFVVCTYYVPILAWIMVYFRHSFTV------------------------------------------------ 114
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  214 wenkvlrlsgglevpgalnwevtLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGIIYYL 293
Cdd:cd11554 115 -----------------------GWLAFTWFVVWLCVFRGVGSTGRVVYITMGLPIVLIIILLGRGASLPNAGDGIRLYF 171
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  294 KPDWS-KLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQGV 372
Cdd:cd11554 172 ATWRGdKLASGEIWQAAAGQVFFSTGVGFGYMTAYASYNSKFSNAVQDALIIAGSNSLFEIIAGFAVFGIVGYLGMTPGV 251
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  373 hiSKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDllpASYYFRFQREISVALCCA 452
Cdd:cd11554 252 --EGEALGGFVLGFVTYPEAIAQMPGSNFFAVLFFLTLFLLGISSAFALLEAVVTLICD---SGWGRKVKRWWIATVVCF 326
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 5032097  453 LCFVIDLSMVTDGGMYVFQLFDYYsASGTTLLWQAFWECVVVAWVYGADRFMDDIA 508
Cdd:cd11554 327 VSFLLSLPYCTRFGYYLLDAVDAW-ISNVALVFVVWAECVAATTVYRFEDVVDQVG 381
YocR COG0733
Na+-dependent transporter, SNF family [General function prediction only];
52-536 3.56e-56

Na+-dependent transporter, SNF family [General function prediction only];


Pssm-ID: 223805  Cd Length: 439  Bit Score: 198.60  E-value: 3.56e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVW---NICP 128
Cdd:COG0733   5 REQWSSRLGFILAAAGSAVGLGNIWRFPYMAGENGGGAFLLPYLIFLLLVGIPLLLAEFAIGRRGRKNAVGAFrklAPKK 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  129 LFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPwatcghtwntpdcveifrhedcanaslanltcdqladrrs 208
Cdd:COG0733  85 KWEWIGWFGVLGGFLILSFYSVIGGWILSYLVKSLTGALP---------------------------------------- 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  209 PVIEFWENKVLRLSGGlevpgalNWEVTLCLLACWVLVYFCVWKGVKS-TGKIVYFTATFPYVVLVVLLVRGVLLPGALD 287
Cdd:COG0733 125 DTGEQFAQLFGQTISN-------PGLAVIFHLLFLVLTALIVSRGVKKgIEKANKIMMPLLFVLFIILVIRAVTLPGAME 197
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  288 GIIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMA 367
Cdd:COG0733 198 GLKFLFKPDFSKLTDPKVWLAALGQAFFSLSLGFGIMITYSSYLSKKSDLVSSALSIVLLNTLISLLAGLVIFPALFSFG 277
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  368 AEqgvhiskvAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVGVEGFITGLLDllpasyYFRFQREISV 447
Cdd:COG0733 278 AD--------ASQGPGLVFIVLPAVFNQMPLGTLFGILFFLLLLFAALTSAISMLEVLVAALID------KFGISRKKAT 343
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  448 ALCCALCFVIDLSMVTDGGMYVFQLFDYYsASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWmKWCWSFFT 527
Cdd:COG0733 344 WLIGILIFLLGIPSILSFGLSIFDLVDFV-VSNILMPLGALLIAIFVGWVLKKELLREELNAGSAKLFKIW-LYLVRYIA 421

                ....*....
gi 5032097  528 PLVCMGIFI 536
Cdd:COG0733 422 PIVILVVLI 430
SLC6sbd_Tyt1-Like cd10336
solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain; SLC6 ...
53-539 1.23e-45

solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain; SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.


Pssm-ID: 271367  Cd Length: 440  Bit Score: 168.77  E-value: 1.23e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   53 ETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNIC----P 128
Cdd:cd10336   1 EQWSSRLGFILAAAGSAVGLGNIWRFPYLAGENGGGAFLLVYLLFVLLIGLPLLIAEFAIGRRTRKNPVGAFAKLagggK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  129 LFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLpwatcgHTWNTPDCVEIFrhedcaNASLANLtcdqladrrs 208
Cdd:cd10336  81 KWKLIGWLGVLGGFLILSFYSVVGGWVLKYLFKSLTGLF------AGADAAEVGAAF------FGFIASP---------- 138
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  209 pviefwenkvlrlsgglevpgalnWEVTLCLLACWVLVYFCVWKGVKS----TGKI------------VYFTATFPyvvl 272
Cdd:cd10336 139 ------------------------LSPLLWHLLFLLLTALIVARGVKKgierANKIlmpllfilliilAIRSLTLP---- 190
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  273 vvllvrgvllpGALDGIIYYLKPDWSKLgSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTS 352
Cdd:cd10336 191 -----------GAGEGLKFLLKPDFSKL-TPEVVLAALGQAFFSLSLGMGVMITYGSYLSKDENLPKSALIVAVLDTLVA 258
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  353 FFAGFVVFSILgfmaAEQGVhiskVAESGPGLAFIAYPRAVTLMPVAPLWAALFffmllllgldsqFVGVeGF--ITGLL 430
Cdd:cd10336 259 LLAGLVIFPAV----FAFGL----DPAAGPGLLFITLPAVFAQMPGGRLFGILF------------FLLL-LFaaLTSAI 317
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  431 DLL--PASY---YFRFQREISVALCCALCFVI---------DLSMVTDGGMYVFQLFDYysASGTTLL-WQAFWECVVVA 495
Cdd:cd10336 318 SLLevVVAYlidEFGWSRKKATLIVGIIIFLLgipsalsfgVLSDVTIFGKTFFDLLDF--LVSNILLpLGGLLIAIFVG 395
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*
gi 5032097  496 WVYGADRFMDDIACMIGYRPCP-WMKWCWSFFTPLVCMGIFIFNV 539
Cdd:cd10336 396 WVLGKEALLEELNKGGLGKKLFkIWLFLLRYVAPVAILIIFLLGL 440
SLC5-6-like_sbd cd06857
Solute carrier families 5 and 6-like; solute binding domain; This superfamily includes the ...
60-537 4.74e-33

Solute carrier families 5 and 6-like; solute binding domain; This superfamily includes the solute-binding domain of SLC5 proteins (also called the sodium/glucose cotransporters or solute sodium symporters), SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporters or Na+/Cl--dependent transporters), and nucleobase-cation-symport-1 (NCS1) transporters. SLC5s co-transport Na+ with sugars, amino acids, inorganic ions or vitamins. SLC6s include Na+/Cl--dependent plasma membrane transporters for the monoamine neurotransmitters serotonin, dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. NCS1s are essential components of salvage pathways for nucleobases and related metabolites; their known substrates include allantoin, uracil, thiamine, and nicotinamide riboside. Members of this superfamily are important in human physiology and disease. They contain a functional core of 10 transmembrane helices (TMs): an inverted structural repeat, TMs1-5 and TMs6-10; TMs numbered to conform to the SLC6 Aquifex aeolicus LeuT.


Pssm-ID: 271356  Cd Length: 407  Bit Score: 131.71  E-value: 4.74e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   60 DFIMSCVGFAVGLGNVWRFPYLCYKNGGGvFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFKGLGYASMV 139
Cdd:cd06857   2 DLILACIGLALGLANFIRFPQMTYSYGGA-FILPYIVLSIIVGIPLLVLELSMGQFSGIGFISMWRCSPFFKGLGVVSLF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  140 IVFYCNTYYIMVLAWGFYYLVKSFtttlpwatcghtwntpdcveifrhedcanaslanltcdqladrrspviefwenkvl 219
Cdd:cd06857  81 LSFLLLIYYTYLAALALVYIINLY-------------------------------------------------------- 104
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  220 rlsgglevpgalNWEVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLP--GALDGIIYYLKPDW 297
Cdd:cd06857 105 ------------YWILALGLFLIWVTIYGIFFRGLKSIGKLIVIAVIVLLVLLLVLTVRALFLEgaGASEGLNKGGTPDF 172
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  298 SKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQGVHISKV 377
Cdd:cd06857 173 MELNNSGIWTAATIQVFFSLGAGWGSVITIASFCLFKKNAQRDALIAAFLNLIASIIFVGLIGIAAGVLSFDPQNMVVLG 252
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  378 AESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFVgvegFITGLLDLLPASYYFRFQREISVALCCALCFVI 457
Cdd:cd06857 253 LLNSLYLTFIASPQAISSLAGSNLWAFLYYAALLLAGLSSMAT----ITNTVAQSLFDEFRRKLKTGVIDTALIVVLLVA 328
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  458 DLSMVTDGGMYVFQLFDYYSASGTTLLwqAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWsFFTPLVCMGIFIF 537
Cdd:cd06857 329 AVIFLVLGLRILFLTDKQLVGTSVVPL--LLILLLVVFWIYGRERIQRDIEFMLGPVGSIVWFWLW-VIAPAILVIILVW 405
LeuT-like_sbd cd10333
Aquifex aeolicus LeuT and related proteins; solute binding domain; LeuT is a bacterial amino ...
52-555 3.70e-27

Aquifex aeolicus LeuT and related proteins; solute binding domain; LeuT is a bacterial amino acid transporter with specificity for the hydrophobic amino acids glycine, alanine, methionine, and leucine. This subgroup belongs to the solute carrier 6 (SLC6) transporter family; LeuT has been used as a structural template for understanding fundamental aspects of SLC6 function. It has an arrangement of 12 transmembrane helices (TMs), which appears to be a common motif for eukaryotic and some prokaryotic and archaeal SLC6s: an inverted topology repeat: TMs1-5 and TMs6-10, and TMs11-12.


Pssm-ID: 271365  Cd Length: 496  Bit Score: 115.49  E-value: 3.70e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097   52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFM-KAGSINVWNICPLF 130
Cdd:cd10333   1 REHWGSRIGLILAMAGNAVGLGNFLRFPVQAAQNGGGAFMIPYFIAFLLLGIPLMWIEWAMGRYGgKYGHGTTPMIFLLA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  131 KGLGYASMV------IVFYCNTYYIMVLAWGFYYLVKSFTTTLPwatcghtwntpdcveifrHEDCANASLANLTCDQLA 204
Cdd:cd10333  81 WENRFAKILgaiglaIPLLVNSYYVYIESWTLGYAFKSLTGAYP------------------EPPSILRPTAEFFYSYIG 142
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  205 DRRSPVIEFWenkvlrlsgglevpgalnwevTLCLLACWVLVYFCVWKGVKSTGKI----VYFTATFPYVVLVVLLVRGV 280
Cdd:cd10333 143 KPSGLAYIFF---------------------LITMALNFFILYRGVSKGIEAFAKIamplLYVFAIILLIRVLTLGSPVN 201
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  281 LLPGALDGIIYYLKPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINS-GTSFFAGFVV 359
Cdd:cd10333 202 PNWTALKGLNFLWNPDFSKLKNPKVWLAAAGQIFFTLSLGMGIIQNYASYLKKDDDVVLSGLTAASLNEfAEVILGGSIA 281
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  360 FSI-LGFMaaeqGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQfVGVEGFITGLLDllpasYY 438
Cdd:cd10333 282 IPAaFAFL----GVAVAIAKAGGFGLGFIALPNVFSQMPGGQFFGFLWFLLLFFAGITSS-IAMYQPLIAFLE-----EE 351
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5032097  439 FRFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSASgTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPW 518
Cdd:cd10333 352 LGISRKHAAWVVFAIVFFLGLPVVLEFDLKALDELDFWVGT-ILLVILGLIEIIVFGWIFGAKKGWEEINRGALIKVPRF 430
                       490       500       510
                ....*....|....*....|....*....|....*..
gi 5032097  519 MKWCWSFFTPLVCMGIFIFNVVYYEPLVYNNTYVYPW 555
Cdd:cd10333 431 YKYVMKYITPAFLAVVLVFWTISYIPKGYFKMNLIPT 467
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH