NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4759076|ref|NP_004582|]
View 

C-C motif chemokine 20 isoform 1 precursor [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Chemokine_CC_DCCL cd01119
Chemokine_CC_DCCL: subgroup of the Chemokine_CC subgroup based on the presence of a DCCL ...
30-90 1.06e-25

Chemokine_CC_DCCL: subgroup of the Chemokine_CC subgroup based on the presence of a DCCL motif involving the two N-terminal cysteine residues; includes a number of small inducible cytokines capable of reversibly inhibiting normal hematopoietic progenitor proliferation by blocking progression through the cell cycle; DCCL subgroup contains Exodus-1 (also known as CCL20, MIP-3alpha, LARC, ST38 (mouse)), Exodus-2 (also known as CCL21, SLC, 6-Ckine, TCA4, CKbeta9), and Exodus-3 (also known as CCL-19, ELC, MIP-3beta, CKbeta11). Exodus-3 was shown to inhibit the growth of human breast cancer cells in vivo in a mouse model; Exodus-1, -2, and -3 were all shown to significantly inhibit chronic myelogenous leukemia progenitor cell proliferation; Exodus-2 and -3 show potent immunotherapeutic activity toward solid tumors; chemotatic for T cells, B cells, dendritic cells, macrophage progenitor cells, and NK cells; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates. See CDs: Chemokine_CC (cd00272) for the entire CC subgroup, Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


:

Pssm-ID: 238539  Cd Length: 61  Bit Score: 92.08  E-value: 1.06e-25
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4759076  30 FDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLS 90
Cdd:cd01119  1 EDCCLSYTQHPIPWRVLRGYTYQEISESCDIPAIIFHTRRGRKVCADPKQDWVKRAIQLLS 61
 
Name Accession Description Interval E-value
Chemokine_CC_DCCL cd01119
Chemokine_CC_DCCL: subgroup of the Chemokine_CC subgroup based on the presence of a DCCL ...
30-90 1.06e-25

Chemokine_CC_DCCL: subgroup of the Chemokine_CC subgroup based on the presence of a DCCL motif involving the two N-terminal cysteine residues; includes a number of small inducible cytokines capable of reversibly inhibiting normal hematopoietic progenitor proliferation by blocking progression through the cell cycle; DCCL subgroup contains Exodus-1 (also known as CCL20, MIP-3alpha, LARC, ST38 (mouse)), Exodus-2 (also known as CCL21, SLC, 6-Ckine, TCA4, CKbeta9), and Exodus-3 (also known as CCL-19, ELC, MIP-3beta, CKbeta11). Exodus-3 was shown to inhibit the growth of human breast cancer cells in vivo in a mouse model; Exodus-1, -2, and -3 were all shown to significantly inhibit chronic myelogenous leukemia progenitor cell proliferation; Exodus-2 and -3 show potent immunotherapeutic activity toward solid tumors; chemotatic for T cells, B cells, dendritic cells, macrophage progenitor cells, and NK cells; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates. See CDs: Chemokine_CC (cd00272) for the entire CC subgroup, Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


Pssm-ID: 238539  Cd Length: 61  Bit Score: 92.08  E-value: 1.06e-25
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4759076  30 FDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLS 90
Cdd:cd01119  1 EDCCLSYTQHPIPWRVLRGYTYQEISESCDIPAIIFHTRRGRKVCADPKQDWVKRAIQLLS 61
IL8 pfam00048
Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted ...
30-87 6.65e-22

Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity. Structure contains two highly conserved disulfide bonds.


Pssm-ID: 278477  Cd Length: 58  Bit Score: 82.21  E-value: 6.65e-22
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 4759076    30 FDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVR 87
Cdd:pfam00048  1 SDCCLSYTSKKIPLKRIKSYRIQETSSSCPKPAVIFTTKKGRQVCADPKQKWVQKLMK 58
SCY smart00199
Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved ...
31-89 2.76e-16

Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved in cell-specific chemotaxis, mediation of cell growth, and the inflammatory response.


Pssm-ID: 197570  Cd Length: 59  Bit Score: 67.66  E-value: 2.76e-16
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 4759076     31 DCCLGYTDRILHPKFIVGFTRqlANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLL 89
Cdd:smart00199  3 RCCLSYTSKKIPLKRIKSYYP--TSSHCPKPAVIFTTKKGRKVCADPKAKWVQRYIKKL 59
 
Name Accession Description Interval E-value
Chemokine_CC_DCCL cd01119
Chemokine_CC_DCCL: subgroup of the Chemokine_CC subgroup based on the presence of a DCCL ...
30-90 1.06e-25

Chemokine_CC_DCCL: subgroup of the Chemokine_CC subgroup based on the presence of a DCCL motif involving the two N-terminal cysteine residues; includes a number of small inducible cytokines capable of reversibly inhibiting normal hematopoietic progenitor proliferation by blocking progression through the cell cycle; DCCL subgroup contains Exodus-1 (also known as CCL20, MIP-3alpha, LARC, ST38 (mouse)), Exodus-2 (also known as CCL21, SLC, 6-Ckine, TCA4, CKbeta9), and Exodus-3 (also known as CCL-19, ELC, MIP-3beta, CKbeta11). Exodus-3 was shown to inhibit the growth of human breast cancer cells in vivo in a mouse model; Exodus-1, -2, and -3 were all shown to significantly inhibit chronic myelogenous leukemia progenitor cell proliferation; Exodus-2 and -3 show potent immunotherapeutic activity toward solid tumors; chemotatic for T cells, B cells, dendritic cells, macrophage progenitor cells, and NK cells; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates. See CDs: Chemokine_CC (cd00272) for the entire CC subgroup, Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


Pssm-ID: 238539  Cd Length: 61  Bit Score: 92.08  E-value: 1.06e-25
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4759076  30 FDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLS 90
Cdd:cd01119  1 EDCCLSYTQHPIPWRVLRGYTYQEISESCDIPAIIFHTRRGRKVCADPKQDWVKRAIQLLS 61
IL8 pfam00048
Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted ...
30-87 6.65e-22

Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity. Structure contains two highly conserved disulfide bonds.


Pssm-ID: 278477  Cd Length: 58  Bit Score: 82.21  E-value: 6.65e-22
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 4759076    30 FDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVR 87
Cdd:pfam00048  1 SDCCLSYTSKKIPLKRIKSYRIQETSSSCPKPAVIFTTKKGRQVCADPKQKWVQKLMK 58
Chemokine cd00169
Chemokine: small cytokines, including a number of secreted growth factors and interferons ...
32-89 6.63e-18

Chemokine: small cytokines, including a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; distinguished from other cytokines by their receptors, which are G-protein coupled receptors; divided into 4 subfamilies based on the arrangement of the two N-terminal cysteines; some members can bind multiple receptors and many chemokine receptors can bind more than one chemokine; this redundancy allows precise control in stimulating the immune system and in contributing to the homeostasis of a cell; when expressed inappropriately, chemokines play a role in autoimmune diseases, vascular irregularities, graft rejection, neoplasia, and allergies; exist as monomers, dimers and multimers, but are believed to function as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine_CXC (cd00273), Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for chemokine subgroups.


Pssm-ID: 238098  Cd Length: 59  Bit Score: 71.60  E-value: 6.63e-18
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....*...
gi 4759076  32 CCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLL 89
Cdd:cd00169  1 CCLKYTSKPIPPKNIKSYRVQEAGGHCSIPAVIFTTKKGRKVCADPKEPWVKDLIQKL 58
Chemokine_CC cd00272
Chemokine_CC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
32-90 6.79e-17

Chemokine_CC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; some members (e.g. 2HCC) contain an additional disulfide bond which is thought to compensate for the highly conserved Trp missing in these; chemotatic for monocytes, macrophages, eosinophils, basophils, and T cells, but not neutrophils; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses; a subgroup of CC, identified by an N-terminal DCCL motif (Exodus-1, Exodus-2, and Exodus-3), has been shown to inhibit specific types of human cancer cell growth in a mouse model. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups, and Chemokine_CC_DCCL for the DCCL subgroup of this CD.


Pssm-ID: 238170  Cd Length: 57  Bit Score: 69.20  E-value: 6.79e-17
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....*....
gi 4759076  32 CCLGYTDRILHPKFIVGFTRQLANegCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLS 90
Cdd:cd00272  1 CCLSYSKKRIPLRVLKSYRRTSSS--CSKPAVIFKTKRGREVCADPKQKWVQRYMKLLD 57
SCY smart00199
Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved ...
31-89 2.76e-16

Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved in cell-specific chemotaxis, mediation of cell growth, and the inflammatory response.


Pssm-ID: 197570  Cd Length: 59  Bit Score: 67.66  E-value: 2.76e-16
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 4759076     31 DCCLGYTDRILHPKFIVGFTRqlANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLL 89
Cdd:smart00199  3 RCCLSYTSKKIPLKRIKSYYP--TSSHCPKPAVIFTTKKGRKVCADPKAKWVQRYIKKL 59
Chemokine_C cd00271
Chemokine_C, C or lymphotactin subgroup, 1 of 4 subgroup designations of chemokines based on ...
33-92 3.33e-06

Chemokine_C, C or lymphotactin subgroup, 1 of 4 subgroup designations of chemokines based on the arrangement of two N-terminal, conserved cysteine residues. Most of the known chemokines (cd00169) belong to either the CC (cd00272) or CXC (cd00273) subclass. The two other subclasses each have a single known member: fractalkine for the CX3C (cd00274) class and lymphotactin for the C (cd00271) class. Chemokine_Cs differ structurally since they contain only one of the two disulfide bridges that are conserved in all other chemokines and they possess a unique C-terminal extension, which is required for biological activity and thought to play a role in receptor binding. Lymphotactin, a mediator of mucosal immunity, has been found to chemoattract neutrophils and B cells through the XCR1 receptor and thought to be a factor in acute allograft rejection and inflammatory bowel disease.


Pssm-ID: 238169  Cd Length: 72  Bit Score: 40.22  E-value: 3.33e-06
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4759076  33 CLGYTDRILHPKFIVGFTRQlanEGcDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKK 92
Cdd:cd00271 11 CVSLTTQRLPVQKIKTYTIK---EG-SVRAVIFITKRGLKICADPQAKWVKSAVKTIDRR 66
Chemokine_CX3C cd00274
Chemokine_CX3C: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
52-83 5.41e-04

Chemokine_CX3C: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteines; differ structurally from the other subgroups in that they are attached to a membrane-spanning domain via a mucin-like stalk and can be proteolytically cleaved to a freely diffusible form; chemotatic for T cells, monocytes, and natural killer cells; function as monomers and are found only in vertebrates and a few viruses; currently only fractalkine (sometimes called neurotactin) has been identified as a member of this subfamily; the primary source of fractalkine is neurons, and they exhibit cell adhesion and chemoattractive properties in the central nervous system. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_CC (cd00272), and Chemokine_C (cd00271) for the additional chemokine subgroups.


Pssm-ID: 238172  Cd Length: 76  Bit Score: 34.27  E-value: 5.41e-04
                       10        20        30
               ....*....|....*....|....*....|..
gi 4759076  52 QLANEGCDINAIIFHTKKKLSVCANPKQTWVK 83
Cdd:cd00274 28 QQNQESCGKRAIILETRQHRLFCADPKEQWVK 59
Chemokine_CXC cd00273
Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
33-91 8.15e-03

Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; many members contain an RCxC motif which may be a general requirement for binding to CXC chemokine receptors; those with the ELR motif are chemotatic for neutrophils and have been shown to be angiogenic, while those without the motif act on T and B cells, and are typically angiostatic; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


Pssm-ID: 238171  Cd Length: 64  Bit Score: 30.69  E-value: 8.15e-03
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....*....
gi 4759076  33 CLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSK 91
Cdd:cd00273  6 CIKTTSGFVHPKSIKKLEVIPPGPHCPNTEIIATLKNGRKVCLNPEAPWVQKIIKKLLK 64
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH