NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|47085995|ref|NP_998365|]
View 

neuronal membrane glycoprotein M6-a [Danio rerio]

Protein Classification

Myelin_PLP domain-containing protein (domain architecture ID 10472648)

Myelin_PLP domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Myelin_PLP pfam01275
Myelin proteolipid protein (PLP or lipophilin);
14-247 1.07e-104

Myelin proteolipid protein (PLP or lipophilin);


:

Pssm-ID: 307439  Cd Length: 236  Bit Score: 308.10  E-value: 1.07e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47085995    14 CMECCLKCLGGIPYPSLIATILLYAGVALFCGCGHEALSGTVTILQNYFevIRGPGDGLDVFTIIDIIKYVIYGIASAFF 93
Cdd:pfam01275   1 CYDCCIRCLGRVPYASLIATILCFLGVALFCGCGHRALTLTVLMLETVF--SRNTQDYHLLLDWIEAVQYVIYGIAAFMF 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47085995    94 VYGILLMVEGFFTSGAIKDLYGDFKITTCGRCVSAWFIMLTYIFMLAWLGVTAFTSLPVFIYFNIWTICQNTT----VLQ 169
Cdd:pfam01275  79 LLGILLLAEGFLTTGATRELYGAFRSRVGGRCSCAVFMGLTYVLALIWLGVFAFLAIPVFIFTNFWGTCQSMEttnsQVQ 158
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 47085995   170 GASLCLDPRQFGVVPIGEEKTLCVGSENFFKMCESNELDMTFHLFVCALAGAGAAVIAMIHYLMVLSANWAYVKDACK 247
Cdd:pfam01275 159 QYYLCIDFRQFGFLPWNATPGKVCGMTESKIFCKDSEEKMTYHLFILALAGAGAVLLALVHYLMCLSANYAHLRDHER 236
 
Name Accession Description Interval E-value
Myelin_PLP pfam01275
Myelin proteolipid protein (PLP or lipophilin);
14-247 1.07e-104

Myelin proteolipid protein (PLP or lipophilin);


Pssm-ID: 307439  Cd Length: 236  Bit Score: 308.10  E-value: 1.07e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47085995    14 CMECCLKCLGGIPYPSLIATILLYAGVALFCGCGHEALSGTVTILQNYFevIRGPGDGLDVFTIIDIIKYVIYGIASAFF 93
Cdd:pfam01275   1 CYDCCIRCLGRVPYASLIATILCFLGVALFCGCGHRALTLTVLMLETVF--SRNTQDYHLLLDWIEAVQYVIYGIAAFMF 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47085995    94 VYGILLMVEGFFTSGAIKDLYGDFKITTCGRCVSAWFIMLTYIFMLAWLGVTAFTSLPVFIYFNIWTICQNTT----VLQ 169
Cdd:pfam01275  79 LLGILLLAEGFLTTGATRELYGAFRSRVGGRCSCAVFMGLTYVLALIWLGVFAFLAIPVFIFTNFWGTCQSMEttnsQVQ 158
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 47085995   170 GASLCLDPRQFGVVPIGEEKTLCVGSENFFKMCESNELDMTFHLFVCALAGAGAAVIAMIHYLMVLSANWAYVKDACK 247
Cdd:pfam01275 159 QYYLCIDFRQFGFLPWNATPGKVCGMTESKIFCKDSEEKMTYHLFILALAGAGAVLLALVHYLMCLSANYAHLRDHER 236
PLP smart00002
Myelin proteolipid protein (PLP or lipophilin);
157-212 1.29e-14

Myelin proteolipid protein (PLP or lipophilin);


Pssm-ID: 128322  Cd Length: 60  Bit Score: 67.51  E-value: 1.29e-14
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 47085995    157 NIWTICQNTTVLQGAS-----LCLDPRQFGVVPIGE-EKTLCvGSeNFFKMCESNELDMTFH 212
Cdd:smart00002   1 NTWTTCQSITFPEKTTtsigtLCVDARQYGILPWNAfPGKVC-GS-NLLSICKTSEFQMTFH 60
 
Name Accession Description Interval E-value
Myelin_PLP pfam01275
Myelin proteolipid protein (PLP or lipophilin);
14-247 1.07e-104

Myelin proteolipid protein (PLP or lipophilin);


Pssm-ID: 307439  Cd Length: 236  Bit Score: 308.10  E-value: 1.07e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47085995    14 CMECCLKCLGGIPYPSLIATILLYAGVALFCGCGHEALSGTVTILQNYFevIRGPGDGLDVFTIIDIIKYVIYGIASAFF 93
Cdd:pfam01275   1 CYDCCIRCLGRVPYASLIATILCFLGVALFCGCGHRALTLTVLMLETVF--SRNTQDYHLLLDWIEAVQYVIYGIAAFMF 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47085995    94 VYGILLMVEGFFTSGAIKDLYGDFKITTCGRCVSAWFIMLTYIFMLAWLGVTAFTSLPVFIYFNIWTICQNTT----VLQ 169
Cdd:pfam01275  79 LLGILLLAEGFLTTGATRELYGAFRSRVGGRCSCAVFMGLTYVLALIWLGVFAFLAIPVFIFTNFWGTCQSMEttnsQVQ 158
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 47085995   170 GASLCLDPRQFGVVPIGEEKTLCVGSENFFKMCESNELDMTFHLFVCALAGAGAAVIAMIHYLMVLSANWAYVKDACK 247
Cdd:pfam01275 159 QYYLCIDFRQFGFLPWNATPGKVCGMTESKIFCKDSEEKMTYHLFILALAGAGAVLLALVHYLMCLSANYAHLRDHER 236
PLP smart00002
Myelin proteolipid protein (PLP or lipophilin);
157-212 1.29e-14

Myelin proteolipid protein (PLP or lipophilin);


Pssm-ID: 128322  Cd Length: 60  Bit Score: 67.51  E-value: 1.29e-14
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 47085995    157 NIWTICQNTTVLQGAS-----LCLDPRQFGVVPIGE-EKTLCvGSeNFFKMCESNELDMTFH 212
Cdd:smart00002   1 NTWTTCQSITFPEKTTtsigtLCVDARQYGILPWNAfPGKVC-GS-NLLSICKTSEFQMTFH 60
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH