NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|46485456|ref|NP_997470|]
View 

adiponectin receptor protein 1 [Rattus norvegicus]

Protein Classification

HlyIII domain-containing protein (domain architecture ID 10503285)

HlyIII domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HlyIII pfam03006
Haemolysin-III related; Members of this family are integral membrane proteins. This family ...
129-352 8.92e-85

Haemolysin-III related; Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus. It has been proposed that YOL002c encodes a Saccharomyces cerevisiae protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolism. In eukaryotes, members are seven-transmembrane pass molecules found to encode functional receptors with a broad range of apparent ligand specificities, including progestin and adipoQ receptors, and hence have been named PAQR proteins. The mammalian members include progesterone binding proteins. Unlike the case with GPCR receptor proteins, the evolutionary ancestry of the members of this family can be traced back to the Archaea.


:

Pssm-ID: 308575  Cd Length: 222  Bit Score: 260.28  E-value: 8.92e-85
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456   129 FRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFmaPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLD 208
Cdd:pfam03006   1 FQIHNETLNIWTHLLGAILFIALLIFLLALSTIDS--QLSAVLPFLIFLLSACLCLGCSALYHTFSCHSEKVRKLFRKLD 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456   209 YSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIA 288
Cdd:pfam03006  79 YSGIFLLIAGSYTPVIYYAFYCAPKLGTIYLSFIWALAILGIISKLLWCFSKPAPRWLRTAVYILMGWSGIIPIAHRALA 158
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 46485456   289 EGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHF 352
Cdd:pfam03006 159 LGGAGEALEIALVLLVLGGVLYIIGAVFYALRVPERLFPGKFDIVGHSHQIFHVFVVLAALCHY 222
 
Name Accession Description Interval E-value
HlyIII pfam03006
Haemolysin-III related; Members of this family are integral membrane proteins. This family ...
129-352 8.92e-85

Haemolysin-III related; Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus. It has been proposed that YOL002c encodes a Saccharomyces cerevisiae protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolism. In eukaryotes, members are seven-transmembrane pass molecules found to encode functional receptors with a broad range of apparent ligand specificities, including progestin and adipoQ receptors, and hence have been named PAQR proteins. The mammalian members include progesterone binding proteins. Unlike the case with GPCR receptor proteins, the evolutionary ancestry of the members of this family can be traced back to the Archaea.


Pssm-ID: 308575  Cd Length: 222  Bit Score: 260.28  E-value: 8.92e-85
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456   129 FRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFmaPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLD 208
Cdd:pfam03006   1 FQIHNETLNIWTHLLGAILFIALLIFLLALSTIDS--QLSAVLPFLIFLLSACLCLGCSALYHTFSCHSEKVRKLFRKLD 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456   209 YSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIA 288
Cdd:pfam03006  79 YSGIFLLIAGSYTPVIYYAFYCAPKLGTIYLSFIWALAILGIISKLLWCFSKPAPRWLRTAVYILMGWSGIIPIAHRALA 158
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 46485456   289 EGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHF 352
Cdd:pfam03006 159 LGGAGEALEIALVLLVLGGVLYIIGAVFYALRVPERLFPGKFDIVGHSHQIFHVFVVLAALCHY 222
YqfA COG1272
Predicted membrane channel-forming protein YqfA, hemolysin III family [Intracellular ...
105-355 1.07e-30

Predicted membrane channel-forming protein YqfA, hemolysin III family [Intracellular trafficking, secretion, and vesicular transport];


Pssm-ID: 224191  Cd Length: 226  Bit Score: 118.11  E-value: 1.07e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456 105 KDNDYLLHGHRPPMPSFracfksifriHTETGNIWTHLLGFVLFLFLgiLTMLRPNMYFMAPLQEKVVFGMFFLGAVLCL 184
Cdd:COG1272   2 RDNNYIAEGKRSKSYSW----------HEEIANAITHLIGAILAIVG--LVLLLVYALITGSALAVIVFSIYGLSLFLLF 69
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456 185 SFSWLFHTVYcHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCspQPRLIYLSIVCVLGISAIIVAQwdrFATPKHR 264
Cdd:COG1272  70 LVSTLYHSIP-NGQKAKAILRKFDHSGIYVLIAGSYTPFLLVGLYG--PLGWILLGLIWGLALAGILFKL---FFKKRFR 143
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456 265 QTRAGVFLGLGLSGVVPTMHFTIAEGFVKATtvgqmgWFFLMAVMYITGAGLYAARIperffpgkfDIWFQSHQIFHVLV 344
Cdd:COG1272 144 KLSLVLYLAMGWLGLIVIKPLIAKLGLIGLV------LLALGGVLYSVGAIFYVLRI---------DRIPYSHAIWHLFV 208
                       250
                ....*....|.
gi 46485456 345 VAAAFVHFYGV 355
Cdd:COG1272 209 VGGAACHFIAI 219
hlyIII TIGR01065
channel protein, hemolysin III family; This family includes proteins from pathogenic and ...
134-355 2.32e-11

channel protein, hemolysin III family; This family includes proteins from pathogenic and non-pathogenic bacteria, Homo sapiens and Drosophila. In Bacillus cereus, a pathogen, it has been show to function as a channel-forming cytolysin. The human protein is expressed preferentially in mature macrophages, consistent with a role cytolytic role.


Pssm-ID: 273425  Cd Length: 204  Bit Score: 62.34  E-value: 2.32e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456   134 ETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAplQEKVVFGMFFLGAVLCLSFSWLFHTVyCHSEKVSRTFSKLDYSGIA 213
Cdd:TIGR01065   2 EIANAITHGIGAVLSIIALALLVIYSWDHGGA--VAVLGFSIYGISLILLFLVSTLYHSI-PKGSKAKNWLRKIDHSMIY 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456   214 LLIMGSFVPWLYYSFYcSPQPRLIyLSIVCVLGISAIIVAQwdrFATPKHRQTRAGVFLGLGLS--GVVPTMhftiaegf 291
Cdd:TIGR01065  79 VLIAGTYTPFLLLALP-GPLGWTV-LWIIWGLAIGGIIYKL---FFHKRPRWLSLFLYLIMGWLvvLVIKPL-------- 145
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 46485456   292 VKATTVGQMGWFFLMAVMYITGAGLYAARIPerffpgkfdIWFQSHQIFHVLVVAAAFVHFYGV 355
Cdd:TIGR01065 146 YHNLPGAGFSLLAAGGLLYTVGAIFYALKWP---------IPFTYHAIWHLFVLGASACHFVAI 200
 
Name Accession Description Interval E-value
HlyIII pfam03006
Haemolysin-III related; Members of this family are integral membrane proteins. This family ...
129-352 8.92e-85

Haemolysin-III related; Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus. It has been proposed that YOL002c encodes a Saccharomyces cerevisiae protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolism. In eukaryotes, members are seven-transmembrane pass molecules found to encode functional receptors with a broad range of apparent ligand specificities, including progestin and adipoQ receptors, and hence have been named PAQR proteins. The mammalian members include progesterone binding proteins. Unlike the case with GPCR receptor proteins, the evolutionary ancestry of the members of this family can be traced back to the Archaea.


Pssm-ID: 308575  Cd Length: 222  Bit Score: 260.28  E-value: 8.92e-85
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456   129 FRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFmaPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLD 208
Cdd:pfam03006   1 FQIHNETLNIWTHLLGAILFIALLIFLLALSTIDS--QLSAVLPFLIFLLSACLCLGCSALYHTFSCHSEKVRKLFRKLD 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456   209 YSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIA 288
Cdd:pfam03006  79 YSGIFLLIAGSYTPVIYYAFYCAPKLGTIYLSFIWALAILGIISKLLWCFSKPAPRWLRTAVYILMGWSGIIPIAHRALA 158
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 46485456   289 EGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHF 352
Cdd:pfam03006 159 LGGAGEALEIALVLLVLGGVLYIIGAVFYALRVPERLFPGKFDIVGHSHQIFHVFVVLAALCHY 222
YqfA COG1272
Predicted membrane channel-forming protein YqfA, hemolysin III family [Intracellular ...
105-355 1.07e-30

Predicted membrane channel-forming protein YqfA, hemolysin III family [Intracellular trafficking, secretion, and vesicular transport];


Pssm-ID: 224191  Cd Length: 226  Bit Score: 118.11  E-value: 1.07e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456 105 KDNDYLLHGHRPPMPSFracfksifriHTETGNIWTHLLGFVLFLFLgiLTMLRPNMYFMAPLQEKVVFGMFFLGAVLCL 184
Cdd:COG1272   2 RDNNYIAEGKRSKSYSW----------HEEIANAITHLIGAILAIVG--LVLLLVYALITGSALAVIVFSIYGLSLFLLF 69
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456 185 SFSWLFHTVYcHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCspQPRLIYLSIVCVLGISAIIVAQwdrFATPKHR 264
Cdd:COG1272  70 LVSTLYHSIP-NGQKAKAILRKFDHSGIYVLIAGSYTPFLLVGLYG--PLGWILLGLIWGLALAGILFKL---FFKKRFR 143
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456 265 QTRAGVFLGLGLSGVVPTMHFTIAEGFVKATtvgqmgWFFLMAVMYITGAGLYAARIperffpgkfDIWFQSHQIFHVLV 344
Cdd:COG1272 144 KLSLVLYLAMGWLGLIVIKPLIAKLGLIGLV------LLALGGVLYSVGAIFYVLRI---------DRIPYSHAIWHLFV 208
                       250
                ....*....|.
gi 46485456 345 VAAAFVHFYGV 355
Cdd:COG1272 209 VGGAACHFIAI 219
hlyIII TIGR01065
channel protein, hemolysin III family; This family includes proteins from pathogenic and ...
134-355 2.32e-11

channel protein, hemolysin III family; This family includes proteins from pathogenic and non-pathogenic bacteria, Homo sapiens and Drosophila. In Bacillus cereus, a pathogen, it has been show to function as a channel-forming cytolysin. The human protein is expressed preferentially in mature macrophages, consistent with a role cytolytic role.


Pssm-ID: 273425  Cd Length: 204  Bit Score: 62.34  E-value: 2.32e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456   134 ETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAplQEKVVFGMFFLGAVLCLSFSWLFHTVyCHSEKVSRTFSKLDYSGIA 213
Cdd:TIGR01065   2 EIANAITHGIGAVLSIIALALLVIYSWDHGGA--VAVLGFSIYGISLILLFLVSTLYHSI-PKGSKAKNWLRKIDHSMIY 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46485456   214 LLIMGSFVPWLYYSFYcSPQPRLIyLSIVCVLGISAIIVAQwdrFATPKHRQTRAGVFLGLGLS--GVVPTMhftiaegf 291
Cdd:TIGR01065  79 VLIAGTYTPFLLLALP-GPLGWTV-LWIIWGLAIGGIIYKL---FFHKRPRWLSLFLYLIMGWLvvLVIKPL-------- 145
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 46485456   292 VKATTVGQMGWFFLMAVMYITGAGLYAARIPerffpgkfdIWFQSHQIFHVLVVAAAFVHFYGV 355
Cdd:TIGR01065 146 YHNLPGAGFSLLAAGGLLYTVGAIFYALKWP---------IPFTYHAIWHLFVLGASACHFVAI 200
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH